Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.58.844ON1032103254960.0
TPHA0I002708.844ON103947014560.0
TDEL0B005408.844ON111555212531e-154
CAGL0B02365g8.844ON105048212351e-152
Kwal_27.102398.844ON91451211921e-147
KLTH0C03784g8.844ON99749111891e-146
YML117W (NAB6)8.844ON113456211801e-143
Suva_13.268.844ON112255811631e-140
Skud_13.248.844ON112855511571e-140
NDAI0E002708.844ON119851611491e-138
KNAG0G034408.844ON105351011371e-137
KAFR0A028508.844ON104248811221e-135
ZYRO0G14256g8.844ON125932111281e-134
NCAS0B002808.844ON108149711031e-132
TBLA0B032808.844ON136229210691e-125
Ecym_46158.844ON106750510221e-121
Smik_13.178.844ON113128510261e-121
ABL122C8.844ON10435179991e-118
KLLA0D01485g8.844ON11512398345e-94
SAKL0D01364g8.844ON10823965321e-54
AFL061C6.183ON5232014579e-48
Ecym_22336.183ON5762014582e-47
NCAS0H010406.183ON6292014567e-47
TBLA0B052106.183ON7103244544e-46
NDAI0F022606.183ON6802014534e-46
SAKL0A05280g6.183ON5822014484e-46
KNAG0M004306.183ON4432014361e-45
Kpol_1002.696.183ON5902014432e-45
KAFR0B066906.183ON5332014375e-45
KLLA0E19031g6.183ON6522014401e-44
TDEL0G016206.183ON5842014316e-44
CAGL0C01419g6.183ON6392014321e-43
KLTH0H04906g6.183ON5692014281e-43
Suva_16.1236.183ON5962014282e-43
Skud_16.946.183ON6142014274e-43
YPL184C (MRN1)6.183ON6122014264e-43
Smik_6.3906.183ON6252014274e-43
Kwal_27.111586.183ON5672014244e-43
TPHA0J022106.183ON5932014238e-43
ZYRO0G08140g6.183ON6323434186e-42
ACR135C8.670ON376701030.001
KAFR0A038308.670ON37468940.016
KLTH0D11088g8.670ON42270910.032
ZYRO0A02398g2.306ON41075840.24
AGR390C2.306ON37875830.32
TPHA0C035202.306ON44277820.47
Suva_8.2928.670ON37070810.59
Ecym_33442.306ON42175800.66
KAFR0D016608.797ON21250780.70
TPHA0D012108.670ON364208800.71
YOR242C (SSP2)8.670ON37170800.74
Smik_15.4268.670ON37169800.81
AGR010C4.66ON26693780.95
Skud_15.4098.670ON37170791.0
KLLA0E08779g2.306ON47572791.2
SAKL0E07128g2.306ON40192781.2
KLLA0F11275g8.670ON38573781.2
Kpol_1043.342.306ON44285781.3
Suva_14.3302.306ON45775781.5
Skud_14.3122.306ON45975781.5
Smik_14.3132.306ON45175771.5
YNL016W (PUB1)2.306ON45375771.5
TDEL0G023602.306ON40275771.7
TBLA0B071702.306ON47076771.9
KLLA0C03652g3.100ON705194772.1
CAGL0H02123g5.382ON55574753.0
NDAI0B007605.30ON24794743.1
Kpol_543.175.486ON42896753.1
TDEL0D045003.173ON46784753.1
KLTH0E14036g8.797ON20996733.1
Skud_11.2861.224ON977110754.0
SAKL0H13266g8.416ON60825744.9
Ecym_73444.66ON26988726.0
Skud_4.5975.374ON49843726.8
Suva_7.1singletonON34358726.8
KLLA0C05522g6.104ON54082727.6
Smik_8.1345.334ON379102717.6
Suva_15.2525.334ON378169718.9
Kwal_33.137581.166ON57187719.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.5
         (1032 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...  2121   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   565   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   487   e-154
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   480   e-152
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   463   e-147
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   462   e-146
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   459   e-143
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   452   e-140
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   450   e-140
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     447   e-138
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   442   e-137
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   436   e-135
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   439   e-134
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     429   e-132
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   416   e-125
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   398   e-121
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   399   e-121
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   389   e-118
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   325   5e-94
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   209   1e-54
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   180   9e-48
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   181   2e-47
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   180   7e-47
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   179   4e-46
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    179   4e-46
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   177   4e-46
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   172   1e-45
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   175   2e-45
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   172   5e-45
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   174   1e-44
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   170   6e-44
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   171   1e-43
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   169   1e-43
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   169   2e-43
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   169   4e-43
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   168   4e-43
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   169   4e-43
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   167   4e-43
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   167   8e-43
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   165   6e-42
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    44   0.001
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    41   0.016
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    40   0.032
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...    37   0.24 
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...    37   0.32 
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...    36   0.47 
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    36   0.59 
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...    35   0.66 
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    35   0.70 
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    35   0.71 
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    35   0.74 
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    35   0.81 
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    35   0.95 
Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {...    35   1.0  
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...    35   1.2  
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...    35   1.2  
KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weak...    35   1.2  
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...    35   1.3  
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...    35   1.5  
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...    35   1.5  
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...    34   1.5  
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...    34   1.5  
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...    34   1.7  
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...    34   1.9  
KLLA0C03652g Chr3 (333038..335155) [2118 bp, 705 aa] {ON} some s...    34   2.1  
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    33   3.0  
NDAI0B00760 Chr2 (171634..172377) [744 bp, 247 aa] {ON} Anc_5.30...    33   3.1  
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...    33   3.1  
TDEL0D04500 Chr4 (825355..826758) [1404 bp, 467 aa] {ON} Anc_3.1...    33   3.1  
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    33   3.1  
Skud_11.286 Chr11 (509095..512028) [2934 bp, 977 aa] {ON} YJL129...    33   4.0  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    33   4.9  
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    32   6.0  
Skud_4.597 Chr4 (1063921..1065417) [1497 bp, 498 aa] {ON} YDR330...    32   6.8  
Suva_7.1 Chr7 (1952..2983) [1032 bp, 343 aa] {ON} YNR071C (REAL)       32   6.8  
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    32   7.6  
Smik_8.134 Chr8 complement(199313..200452) [1140 bp, 379 aa] {ON...    32   7.6  
Suva_15.252 Chr15 complement(425632..426768) [1137 bp, 378 aa] {...    32   8.9  
Kwal_33.13758 s33 (380210..381925) [1716 bp, 571 aa] {ON} YJL172...    32   9.8  

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score = 2121 bits (5496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1032/1032 (100%), Positives = 1032/1032 (100%)

Query: 1    MAGSPRKNSSNSHVTTQYQQSSQFPASQQQAGSYAQLQQQSHHNGGHLPILQQQQHQQQQ 60
            MAGSPRKNSSNSHVTTQYQQSSQFPASQQQAGSYAQLQQQSHHNGGHLPILQQQQHQQQQ
Sbjct: 1    MAGSPRKNSSNSHVTTQYQQSSQFPASQQQAGSYAQLQQQSHHNGGHLPILQQQQHQQQQ 60

Query: 61   HQHQHQHQHQHQHQQPYLNSGYPVYHQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPN 120
            HQHQHQHQHQHQHQQPYLNSGYPVYHQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPN
Sbjct: 61   HQHQHQHQHQHQHQQPYLNSGYPVYHQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPN 120

Query: 121  APPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPA 180
            APPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPA
Sbjct: 121  APPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPA 180

Query: 181  PPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNII 240
            PPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNII
Sbjct: 181  PPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNII 240

Query: 241  KRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLI 300
            KRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLI
Sbjct: 241  KRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLI 300

Query: 301  NSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSE 360
            NSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSE
Sbjct: 301  NSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSE 360

Query: 361  FKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQP 420
            FKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQP
Sbjct: 361  FKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQP 420

Query: 421  ITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMD 480
            ITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMD
Sbjct: 421  ITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMD 480

Query: 481  RIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNSEFENTRLIHLIWM 540
            RIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNSEFENTRLIHLIWM
Sbjct: 481  RIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNSEFENTRLIHLIWM 540

Query: 541  ETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNV 600
            ETINCNLR   MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNV
Sbjct: 541  ETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNV 600

Query: 601  VRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPK 660
            VRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPK
Sbjct: 601  VRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPK 660

Query: 661  SISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQ 720
            SISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQ
Sbjct: 661  SISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQ 720

Query: 721  VNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVN 780
            VNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVN
Sbjct: 721  VNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVN 780

Query: 781  KSLISGKNSKFYRKVKKPSYNIRLQQLEEERKQEEKNKISNKSINLNSFGIQVETPSQNE 840
            KSLISGKNSKFYRKVKKPSYNIRLQQLEEERKQEEKNKISNKSINLNSFGIQVETPSQNE
Sbjct: 781  KSLISGKNSKFYRKVKKPSYNIRLQQLEEERKQEEKNKISNKSINLNSFGIQVETPSQNE 840

Query: 841  SEQEEPKISLDGLGMSLSKPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKK 900
            SEQEEPKISLDGLGMSLSKPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKK
Sbjct: 841  SEQEEPKISLDGLGMSLSKPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKK 900

Query: 901  QNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQN 960
            QNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQN
Sbjct: 901  QNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQN 960

Query: 961  DMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE 1020
            DMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE
Sbjct: 961  DMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE 1020

Query: 1021 FYDENVINAGNS 1032
            FYDENVINAGNS
Sbjct: 1021 FYDENVINAGNS 1032

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/470 (61%), Positives = 348/470 (74%), Gaps = 40/470 (8%)

Query: 563  QFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTF 622
            QFATSAE+A+ MGGG GNRT++IGNINPRSK EDICNV RGG +QQ+K+ +EK ICFV F
Sbjct: 602  QFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIF 661

Query: 623  IEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYA 682
            I+  +AAQFYANSFIDPIILHNNTL++GWGDH GPLPK+I LAVT GASRNVYVSLPE+A
Sbjct: 662  IDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFA 721

Query: 683  FKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIK 742
            FKDK+INDP YKEYHNKY+LP+E++LR+DFS FGEMEQ+NFL D HCCWINF NIRSAIK
Sbjct: 722  FKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIK 781

Query: 743  LVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802
            LVE V + +    FHERY NRYKGLIIGYGKDRCGNVNKSL+S KNS+++RKVKKPSYNI
Sbjct: 782  LVELVKNEDNN-NFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNI 840

Query: 803  RLQQLEEERKQ-EEKNKISNKSINLNSFGIQVETPSQNESEQEEPKISLDGLGMSLSK-- 859
            RLQQLEEERK+ +E  +I NK INL+S GI   T S N++ QE+  +SL  L ++     
Sbjct: 841  RLQQLEEERKRNDEIKQIDNKRINLDSLGI---TTSPNQNIQEDETLSLAKLKLTSDTGF 897

Query: 860  PNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKKQNHRKNDMNNNLNFGNPPP 919
             NSEN    + DDS S+ STD+ELII+ P      GN  K   +RK    NNL+ G  P 
Sbjct: 898  KNSENES--DIDDSASNSSTDVELIINSP------GNGFKSHRNRK-PKPNNLDLGERPK 948

Query: 920  VSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRS 979
            V   + ++  P+AP  LS D+ ++                        NT   N   +R+
Sbjct: 949  VDAIVFKADGPMAPNKLSHDYHRT-----------------------HNTRVDNPRSERT 985

Query: 980  SKK-NKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDENVIN 1028
             K+ +KK++PGSDVMSQYLAQ+QHSTFMYAAN+L AS +EPEFYDEN I+
Sbjct: 986  RKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDENDID 1035

 Score =  250 bits (639), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 173/440 (39%), Positives = 234/440 (53%), Gaps = 68/440 (15%)

Query: 86  HQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPNAPPTP-FDSAYGASLLPSHLLMGSP 144
           HQGL+  D+   IN   SQ  + P  Y++ Q     PP   FD AYG +LLPSH+LM SP
Sbjct: 75  HQGLSQLDS--PINSSYSQYESHP--YHSQQTPLPNPPPTPFDYAYGTTLLPSHILMNSP 130

Query: 145 FVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNN 204
           FVSTP   +SY    A PS     N        +P PP I  P        S    ++N 
Sbjct: 131 FVSTP--NKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSP--HLVGDKSERAKSDNY 186

Query: 205 SSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDE 264
                 ++   NR                       + F+E S   + ISY++LPKG+D 
Sbjct: 187 EKVDTLDDEKRNR-----------------------EVFEEESAIAYKISYQILPKGDDT 223

Query: 265 YQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNND 324
           Y TRSLLFEN+++S+DLH FI+KFVN+G IESVY++ S   Y+ ++N+            
Sbjct: 224 YHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPS---YETHQNS------------ 268

Query: 325 NDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKY----- 379
                     +SILLSF SR ICLDFYNSVLQ+LSE+KTQLNS +L LSFV L Y     
Sbjct: 269 ---------VKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNI 319

Query: 380 -----KNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSF 434
                K        E+DF   L   ++Y +   GATRS+ +EF++ +   + F+ + L F
Sbjct: 320 NKGNGKISVESQKNETDFE--LTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPF 377

Query: 435 LLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKC 494
           L S  NKRYIIES+ I+N   +D   P + VIL+FLNISM ++V+  IR +     I  C
Sbjct: 378 LSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNC 437

Query: 495 VFVTFNKENPTVPNMKRLSL 514
           ++V+F++    V N  R SL
Sbjct: 438 LYVSFDRTKHAVSNSNRQSL 457

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  487 bits (1253), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/552 (47%), Positives = 345/552 (62%), Gaps = 78/552 (14%)

Query: 552  MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKF 611
            M   + ++ + Q+ATSAE+A++MGGG GNRTVYIGNI+PRS+ EDICNVVRGG LQ +KF
Sbjct: 563  MTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKF 622

Query: 612  FKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGAS 671
              EK ICFVTF+EA++A QFY N+FIDPI+LH N L+VGWG HSGPLPKSI+LAVTVGAS
Sbjct: 623  LAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGAS 682

Query: 672  RNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCW 731
            RNVYVSLPE+AFKDK+I DP+Y+EY+ K+ LP EE+LR DFS++G++EQ+N+LNDGHCCW
Sbjct: 683  RNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCW 742

Query: 732  INFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKF 791
            +NF NI +AIKLVE V    GG  F++    RY GL+IGYGKDRCGNVNK+ I+GKNS+F
Sbjct: 743  VNFTNISAAIKLVEEVKYEGGG-NFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRF 801

Query: 792  YRKVKKPSYNIRLQQLEEERKQEEKNKI------SNKSINLNSFGI-------------- 831
            Y+KVKKPS+NIRL ++EEER+Q E+         S K +   S GI              
Sbjct: 802  YKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDSNGKEDPEKVD 861

Query: 832  -----------------QVETPSQNESEQEEPKI--------SLDGLGMSLSKPNS---- 862
                              VE  S  ES+QEE ++           GL +  S+  S    
Sbjct: 862  DVDFEDEVKFDSNSPKKTVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREK 921

Query: 863  ------ENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKKQNHRKNDMNNNLNFGN 916
                   NH   +   + SD S+D+ELII+ P  E +       +  RKND     N   
Sbjct: 922  EATKLTRNHSENDETSAKSDASSDVELIINSPEEEESNFKSKSNRGFRKNDRRKLANCAE 981

Query: 917  PPPVSKTL---------------LESSPPLAPATLSRDFQKSSKQL--SSDLTNLSTMDQ 959
                 +                 LE++PP+APAT+SR++    KQ      L +      
Sbjct: 982  GASSKERFKSTTNDVSSALSSSSLEANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESF 1041

Query: 960  NDMSENDSN----TSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGAS 1015
            +D S+ +SN    ++ +    +  ++++ K +PGSDVM+QYLAQLQHSTF+YAANILGAS
Sbjct: 1042 DDESQQESNFDFESTQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGAS 1101

Query: 1016 SD-EPEFYDENV 1026
            +D +  + DEN 
Sbjct: 1102 NDGDNNYLDENA 1113

 Score =  323 bits (829), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 187/432 (43%), Positives = 245/432 (56%), Gaps = 86/432 (19%)

Query: 104 QLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM------------ 151
           Q  NS  +YY    + NAPPTPFD+AYG +LLPSHLLMGSPFVS+P +            
Sbjct: 39  QFMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQ 98

Query: 152 -GQSYSQQFARPSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNN 210
             Q YS      S S  G S G+L++AYP PP++N PP+SR                 N 
Sbjct: 99  RLQQYSHN---QSKSSSGRSFGKLATAYPVPPSLNSPPASR-----------------NA 138

Query: 211 NNNNNNRRGNHNSHRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSL 270
            +N   RRG+H     +++   RF              + F ++Y+VLPKGNDE++TRSL
Sbjct: 139 LHNRGPRRGSHYKSIQSSDASKRFK-------------DPFILTYRVLPKGNDEFRTRSL 185

Query: 271 LFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNAN 330
           LFENVD S+DLH F+  F N+GP+ESVYL  S G                          
Sbjct: 186 LFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEG-------------------------- 219

Query: 331 NHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYK-------NQD 383
             D  SILLSF S+ ICLDFYNSVLQRLSE+K+ L+S  LTLSFV L+YK       + D
Sbjct: 220 --DHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDID 277

Query: 384 RPDDEESD-FSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKR 442
           + DD + D F+     SL YD+I RGATRSI + F  P  SK+  ++ KL FL    N R
Sbjct: 278 KEDDSKPDAFNITAAGSLRYDVINRGATRSIMITFKTP-CSKDELIDKKLEFLKKENNTR 336

Query: 443 YIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKE 502
           Y++ES+D++ A E   + P+N  +LTFLNI M V+++D IRL  +   ISKC F++    
Sbjct: 337 YVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISI--- 393

Query: 503 NPTVPNMKRLSL 514
            P +P+ KRLS+
Sbjct: 394 QPQIPDGKRLSV 405

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  480 bits (1235), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 331/482 (68%), Gaps = 52/482 (10%)

Query: 566  TSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEA 625
            TSA IA  MGG A NRTVYIGNINPRSK EDICNVVRGG LQ +KF ++K ICFVTFIEA
Sbjct: 589  TSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEA 648

Query: 626  ASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKD 685
            ++AAQF ANSFIDPI+LH NTLRVGWG+ SGPLPKSI+LAVTVGA+RNVYVSLPEYAFKD
Sbjct: 649  SAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKD 708

Query: 686  KFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVE 745
            KFINDP+YKEYH +Y LP++E+LRKDF+ +GE+EQ+N+L D HCCW+NF+NI SAI+LVE
Sbjct: 709  KFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVE 768

Query: 746  SVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQ 805
             +N +N G+ FH+++ NRY+GLII YGKDRCGN+NK+LI+GK SKFY+KVKKPSY+IR++
Sbjct: 769  DINHNN-GEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIK 827

Query: 806  QLEEERKQEEKNKISNK--SINLNSFGIQVETPSQNES---------------------- 841
            ++EE+RK +E N +S K  SI L+S GI V+    NES                      
Sbjct: 828  KMEEKRKMQEDNLLSQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQDLESN 887

Query: 842  --EQEEPKISLDG-LGMSLSKPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKN 898
              + + P+IS +G +G+ LS   S   D  +   SD  + +D E   +   +E +  ++ 
Sbjct: 888  DYKSDHPQISSNGPIGIGLSSKKSPIFD--DISGSDESVISDFE---NSASKETSSSDRK 942

Query: 899  KKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMD 958
             +  + + D            V KT L  +PP AP+T++  ++K        ++ +  ++
Sbjct: 943  YQTTNSRGDTF----------VPKTNLSHAPPRAPSTINMTYKK--------ISYVPPLN 984

Query: 959  QNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018
                 + D     K   +   +++  + +PGSDVM+QYLAQLQHSTFMYAANILGAS + 
Sbjct: 985  -GQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVET 1043

Query: 1019 PE 1020
             E
Sbjct: 1044 EE 1045

 Score =  192 bits (489), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 138/415 (33%), Positives = 209/415 (50%), Gaps = 51/415 (12%)

Query: 120 NAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMG-RLSSAY 178
           N PPTPFD+AYGASLLPSHLLMGSP +ST  + +  +        ++   S   R +S +
Sbjct: 48  NVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRNSGF 107

Query: 179 PAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKN 238
                 N P  S   +S +       +  S      N+   +  SH        + T  +
Sbjct: 108 VLQSNGNTPYMSSKRSSLSQ------APMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPID 161

Query: 239 IIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVD-LHCFIKKFVNFGPIESV 297
           + K+     ++  +I+Y+VLP G+D Y+TRSLLFENV K+ + L  F++  +N+  +ESV
Sbjct: 162 VTKKL----ISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESV 217

Query: 298 YLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQR 357
           Y+         +K +D                   DT  + LSFLSR   LDFYN+ LQR
Sbjct: 218 YVFQQTDTPSKDKESD------------------KDTCCLQLSFLSRQAALDFYNNFLQR 259

Query: 358 LSEFKTQLNSNDLTLSFVLLKYKNQDRP----------DDEESDFSPALPL----SLEYD 403
           L +FK +L+S  L++SFV   Y   +            + E+ +   +  L    +L  +
Sbjct: 260 LPDFKKKLSSPKLSVSFVSFSYVTDEDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEE 319

Query: 404 IIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKN 463
           I    ATRSIA+EF   +     F   KL FL   +NKRYI+E+VDII+A +   + P N
Sbjct: 320 IFSHDATRSIAIEFYSQVEQDALF--EKLPFLDDKDNKRYILEAVDIISAEDAADDFPAN 377

Query: 464 TVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTF-----NKENPTVPNMKRLS 513
            VILTF+NI M ++V+D ++       +++C FV+       +E+ T P +  +S
Sbjct: 378 YVILTFINIKMAIEVLDYLKANLMTYSVNECFFVSLPGCKSQRESSTTPVLGHIS 432

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  463 bits (1192), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 251/512 (49%), Positives = 335/512 (65%), Gaps = 50/512 (9%)

Query: 552  MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKF 611
            M   L +  + Q+  +A++A  MGGGAGNRTVYIGNI+PRSK EDICNVVRGG LQ +K+
Sbjct: 409  MSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKY 468

Query: 612  FKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGAS 671
             + K ICFVTFIEAASA QF+ANS I+PI+LH + L+VGWG HSG LP+SISLAVT+GAS
Sbjct: 469  IEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGAS 528

Query: 672  RNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCW 731
            RNVYVSLPEYAFKDKFI DPEY+ +  K+ LP++++L  DFS FG++E +NFL DGHCCW
Sbjct: 529  RNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCW 588

Query: 732  INFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKF 791
            INFMNI +AIKLVE  N+SN  ++FHE++ NRY+GL IGYGKDRCGNVNK+L+S KNSK+
Sbjct: 589  INFMNISNAIKLVEDANNSN-NESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKY 647

Query: 792  YRKVKKPSYNIRLQQ-----LEEERKQEEKNKISNKSINLNSFGIQVETPSQNESEQEEP 846
            ++KVKK SYNIRL++     +E + K  + ++ S K + +++FGI V +        EE 
Sbjct: 648  FKKVKKASYNIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQ 707

Query: 847  KISLDGLGMSLSKPNSENHDLKETDDSDSDIS---------------------TDIELII 885
            KI  + L + LSKPNS    L  +   D  ++                      DI L+ 
Sbjct: 708  KIEENEL-LLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGSSEVDI-LVS 765

Query: 886  DP------------PVRENTKGNKNKKQNHRKNDMNNNLNFGN-PPPVSKTLLESSPPLA 932
             P            P +  T  +  KK+  R + ++    F    P VSK  L++ PPLA
Sbjct: 766  APGSANTSQLEGGGPTQRTTAASNGKKE--RSSGVSKLHCFSEIAPRVSKASLDAVPPLA 823

Query: 933  PATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHK--RSSKKNKKLLPGS 990
            PA L+  +  + ++  S   N    D N +S + S+  SK+   K  +S ++N + +PGS
Sbjct: 824  PAALNCHYNSAPRR--SARKNGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQRNAQAIPGS 881

Query: 991  DVMSQYLAQLQHSTFMYAANILGASSDEPEFY 1022
            +VM+QYLAQLQHSTFMYAA+ILG   D+P  +
Sbjct: 882  NVMAQYLAQLQHSTFMYAADILGV--DDPNLH 911

 Score =  126 bits (316), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 102/362 (28%), Positives = 168/362 (46%), Gaps = 97/362 (26%)

Query: 141 MGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNN 200
           M SPF++TP +G S        SP +  +   + S AY +   + +PPS     S     
Sbjct: 1   MSSPFLATPGVGHS--------SPHR--HVTNKSSQAYKST-QLRMPPSDAIRGS----- 44

Query: 201 NNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPK 260
                           RR  HN  ++  + G R                 + +++ +LP+
Sbjct: 45  ----------------RR--HNKEKHLYDEGTRQIP--------------YKLTFNILPR 72

Query: 261 -GN---DEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYD 316
            GN   D+++TRSL F N++  V LH F+  F  F  IESVY+++               
Sbjct: 73  NGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVD--------------- 117

Query: 317 DDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVL 376
                           + QS+L+SFL++  CLDFYN +LQ+LSEFK +L S +L+LSF  
Sbjct: 118 ---------------REQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFA- 161

Query: 377 LKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLL 436
                   P   ES   P L   +++++++ GATRS+ +EF   I      +  K  F  
Sbjct: 162 -------SPQKVES--GPTLQ-EIKFEVLRAGATRSLGLEFKDEIDFAS--LLKKFDF-F 208

Query: 437 SPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDS-GISKCV 495
                RY+IES++ +N  +       N  I+ F++I+M V+ M+ ++++  +S G++K  
Sbjct: 209 DNSGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPESFGLTKVS 268

Query: 496 FV 497
           +V
Sbjct: 269 YV 270

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  462 bits (1189), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/491 (51%), Positives = 325/491 (66%), Gaps = 40/491 (8%)

Query: 570  IANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAA 629
            +A  MGGG GNRTVYIGNI+PRSK EDICNVVRGG LQ +K+ + K ICFVTFIEAASA 
Sbjct: 504  VATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAV 563

Query: 630  QFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFIN 689
            QF+ANS I+PI+LH N L+VGWG HSG LP+SISLAVT+GASRNVYVSLPE+AFKDKFI 
Sbjct: 564  QFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIK 623

Query: 690  DPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNS 749
            DPEY+E+  K+ LP++E+L +DFS FG++E VNFL DGHCCWINFMNI +AIKLVE  N+
Sbjct: 624  DPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANN 683

Query: 750  SNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEE 809
             N   +FHE++ NRYKGL IGYGKDRCGNVNK+L++ KNSK+++KVKK SYNIRL++ ++
Sbjct: 684  PN-NDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQQK 742

Query: 810  -------ERKQEEKNKISNKSINLNSFGIQV-ETPSQNESEQEEPKISLD---------- 851
                   E K E K    +K I  ++FGI V +T +      EE K+  D          
Sbjct: 743  GASDAPTEVKDEAKEL--DKPIKADAFGISVGDTQNLVRDSDEEQKLEEDELLRLSDLNN 800

Query: 852  ---GLGMSLS-----KPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKKQNH 903
               GLG+SL+     + N+   D    ++S S  S+D+++++  P   +T   ++K    
Sbjct: 801  TGGGLGISLASSTGEETNTPVSDESSKEESVSSESSDVDILVSAPGSADTSQLESKTAPR 860

Query: 904  RKNDMNNNLNFGNPPP--------VSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLS 955
                     N    P         VS   L++ PPLAP+TLSR +  +SK  S   +   
Sbjct: 861  SPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFG 920

Query: 956  TMDQNDMSENDSNTS-SKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGA 1014
            T +++    ND  +  SK   H R  ++  K +PGSDVM+QYLAQLQHSTFMYAANILG 
Sbjct: 921  TTEKSSPRYNDIRSQDSKKPLHPR--RRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGV 978

Query: 1015 SSDEPEFYDEN 1025
               E  FYDEN
Sbjct: 979  DDGETVFYDEN 989

 Score =  178 bits (451), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 191/391 (48%), Gaps = 91/391 (23%)

Query: 112 YYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSM 171
           YY    +P AP TPFD++YG SLLPSHLLM SPF++TP MG +        SP + G S 
Sbjct: 39  YYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSA--------SPHRAGGSR 90

Query: 172 GRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNG 231
                               +HA S+ +  N  S+          R   H S    N++ 
Sbjct: 91  S-------------------SHAQSSYHTPNFGSTQLRMPPPTEKRNFKHGSSYRHNSS- 130

Query: 232 GRFTQKNIIKRFQENSLNRFTISYKVLPK----GNDEYQTRSLLFENVDKSVDLHCFIKK 287
                       Q+ +   + + + +LP+    G DEY TRSLLF N++    LH F+ K
Sbjct: 131 -----------VQQRA---YEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTK 176

Query: 288 FVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPIC 347
           F  F  +ESVYL++S                                QS+L+SFL++  C
Sbjct: 177 FEKFDRVESVYLVDSQ------------------------------QQSVLVSFLTKETC 206

Query: 348 LDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKR 407
           LDFYN VLQ+LSEFK +L S +LTL+F  L+          +    P L   ++ ++++ 
Sbjct: 207 LDFYNGVLQKLSEFKKELKSKELTLNFASLR----------DVKTGPTLQ-EIKIEVLRA 255

Query: 408 GATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVIL 467
           GATRS+ +EF   +      ++  L F+++ E  RY++E+++I+NA     +   +  I+
Sbjct: 256 GATRSLILEFQDKV--DLALLSKSLGFIVN-EGPRYVVEAIEIVNAGRSSKHFGPHYAII 312

Query: 468 TFLNISMTVDVMDRIRLER-KDSGISKCVFV 497
            F++I+M ++ ++ ++ +  K +G+ K  +V
Sbjct: 313 HFISIAMALETVEYLKSQSNKLAGLIKFRYV 343

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  459 bits (1180), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 264/562 (46%), Positives = 350/562 (62%), Gaps = 80/562 (14%)

Query: 522  SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581
            SNQ N      +LI      + N  +    + + + ++ +  F  SA++A++MG   GNR
Sbjct: 594  SNQSNGAIIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNR 653

Query: 582  TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641
            T+YIGNINPRSKAEDICNVVRGG LQ IK+  EK ICFVTFIEA SA QFYANSFIDPI+
Sbjct: 654  TIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIV 713

Query: 642  LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701
            LH N LRVGWG +SGPLPK ISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 714  LHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLS 773

Query: 702  LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNS------SNGGKT 755
            LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N        +G  T
Sbjct: 774  LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVT 833

Query: 756  F----HERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEER 811
                  E++  RYKGL+I YGKDRCGN+NK+LI+GKNS+FY+KVK+PSYNIRL +LEE+R
Sbjct: 834  LKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKR 893

Query: 812  KQ---EEKNKISNKSINLNSFGIQVE---------------TPSQNESEQEE------PK 847
            +Q   +EK K  +K +NL S GI ++               T  +NESE E         
Sbjct: 894  RQNEIDEKEKAFDKPLNLESLGISLDAHKDNGGGETGTANNTGHENESELEAENENGNET 953

Query: 848  ISLDGLGMSLSKPNSENHDLKETDDSD--------SDISTDIELIIDPP----------- 888
             S  GLG++++  + +     ETD  D        SD S+D+E+I+  P           
Sbjct: 954  GSFGGLGLAVASSDVKRATSDETDYEDIFNKSSGSSDSSSDVEVIMHSPSDPEYALKSQT 1013

Query: 889  VRENTKGNKNKKQNHRKNDMN-----NNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKS 943
            +R +++   N K+  +  D       + LN+       ++ L  +PP AP+TLS +  K+
Sbjct: 1014 LRSSSQTVINSKRPVKIEDEEEAVGMSQLNY-------RSSLRQAPPRAPSTLSYNHSKN 1066

Query: 944  SKQLSSDL-TNLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQH 1002
            ++    D+ TN  T              + N   KR S    + +PGSDVM+QYLAQ+QH
Sbjct: 1067 NETPMQDIFTNGET--------------ANNRKKKRGSFARHRTIPGSDVMAQYLAQVQH 1112

Query: 1003 STFMYAANILGASSDEPEFYDE 1024
            STFMYAANILGAS+++    DE
Sbjct: 1113 STFMYAANILGASAEDNTHPDE 1134

 Score =  263 bits (672), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 174/431 (40%), Positives = 237/431 (54%), Gaps = 54/431 (12%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYS---------QQFAR 161
            YYTN  +PN PPTPFD+AYGASL PSHLLMGSPFVS+P M   Y+         + ++R
Sbjct: 53  AYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSR 112

Query: 162 PSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNH 221
           P  +  G +    S+       + + PS+      N+ + NNNS+ +  +NNN      +
Sbjct: 113 PVSNHNGYNGNSNSNQNNTNNGM-VTPSNYYRMGRNSFSRNNNSTRNVTHNNNKGCDTRN 171

Query: 222 NSHRNTNNNGGRFTQKNIIKR-FQENSLNR-FTISYKVLPKGNDEYQTRSLLFENVDKSV 279
           NS R T      F + NI      E  L R F I+YKVLP G+D Y+TRSLL ENVD S+
Sbjct: 172 NSGRRT------FARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSI 225

Query: 280 DLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILL 339
           DLH  +K FV    +ES YLI      +  K++D  D +  N              SIL+
Sbjct: 226 DLHSIVKNFVKSNTLESAYLI------EGGKSDDSKDVETKN-------------LSILI 266

Query: 340 SFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRP----------DDEE 389
           SFL++  CL+FYN++LQRLSEFKT L S  L L FV L Y  +  P          + EE
Sbjct: 267 SFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEE 326

Query: 390 SDF---SPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIE 446
           +D    S  +  SL ++I  + ATRSI +EF  P+  K      KL FL   +NKRYI+E
Sbjct: 327 ADITNGSTMISASLHHNIANKDATRSIIIEFKSPV-EKSDLFKKKLQFLDRSKNKRYILE 385

Query: 447 SVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKENPTV 506
           S+D++N        P+N  +LTFLNISM ++V+D ++   K+ GISKC +V+     P V
Sbjct: 386 SIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKKYSKNLGISKCFYVSL---APLV 442

Query: 507 PNMKRLSLVDI 517
            +  R S+ +I
Sbjct: 443 VSSARSSVANI 453

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score =  452 bits (1163), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 253/558 (45%), Positives = 343/558 (61%), Gaps = 75/558 (13%)

Query: 522  SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581
            SNQ N    + +LI     ++ N  +    + + + ++ +  F  SA++A++MG   GNR
Sbjct: 585  SNQSNGTIVSQQLITAPSPQSPNPQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNR 644

Query: 582  TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641
            T+YIGNINPRS+AEDICNVVRGG LQ IK+  EK ICFVTFIEAASA QFYANSFIDPI+
Sbjct: 645  TIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIV 704

Query: 642  LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701
            LH N LRVGWG +SGPLPKSISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 705  LHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLA 764

Query: 702  LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG-------- 753
            LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N    G        
Sbjct: 765  LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELI 824

Query: 754  --KTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEER 811
                  E++  RYKGL+I YGKDRCGN+NK+L++GKNS+FY+KVK+PSYNIRL +LEE R
Sbjct: 825  PKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERR 884

Query: 812  KQEEKNKIS--NKSINLNSFGIQVETPSQNESEQEEPKISL--------------DGLGM 855
            +Q E +K    +K +NL S GI ++     + ++ E + +               + +G+
Sbjct: 885  RQNENDKKESFDKVLNLESLGISLDPHKGTDIDEAEAEGTTGAEVENEVEAENGNETVGL 944

Query: 856  SLSKPNSENHDLKE--TDDSDSD-----------ISTDIELIIDPPVRENTKGNKNKKQN 902
                    N D+K   +D++D D            S+DIE+I+  P    +      K  
Sbjct: 945  GGLGLGVVNSDVKRALSDETDYDEFFNKSSRSSDSSSDIEVIMHSP----SDPEYALKSQ 1000

Query: 903  HRKNDMNNNLNFGNPPPVS-------------KTLLESSPPLAPATLSRDFQKSSKQLSS 949
              ++     LN   P  V              ++ L+ +PP AP+TLS +  K       
Sbjct: 1001 TLRSSSQTVLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSK------- 1053

Query: 950  DLTNLSTMDQNDMSENDSNTSSK---NASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFM 1006
                     +N M   D+  +++   N + KR S    + +PGSDVM+QYLAQ+QHSTFM
Sbjct: 1054 ---------KNQMPIQDAGINAEVTDNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFM 1104

Query: 1007 YAANILGASSDEPEFYDE 1024
            YAANILGAS+++  + DE
Sbjct: 1105 YAANILGASAEDNAYSDE 1122

 Score =  262 bits (669), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 179/462 (38%), Positives = 241/462 (52%), Gaps = 61/462 (13%)

Query: 65  HQHQHQHQHQQPYLNSGYP-VYHQGLAGRDAVAAINMINSQLSNSPG---VYYTNQHIPN 120
           H ++ QH H       G P +YH           ++ +N      P     YYTN  +PN
Sbjct: 13  HAYRKQHDHNGMNAMVGNPMLYH----------PVDFMNGAGQYGPSQHPAYYTNSPLPN 62

Query: 121 APPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSY----SQQFARPSPSKGGNSMGRLSS 176
            PPTPFD+AYGASLLPSHLLMGSPFVS+P M   Y    S +F R + S+  +S    ++
Sbjct: 63  VPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSYNA 122

Query: 177 AYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRN--TNNNGGRF 234
            +      +   +     SS   N     S  +NN  N      HN H+   T N+ GR 
Sbjct: 123 NHNNNNNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVN----VTHNIHKGYETRNSSGRR 178

Query: 235 TQK--NIIKRFQENSLNR--FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVN 290
           T    NI       +L +  F I+YK+LP G+D Y+TRSLL ENVD S DLH  +K FV 
Sbjct: 179 TSSRINIFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVK 238

Query: 291 FGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDF 350
              +ES Y++ S       K  D+ + +   N             SIL+SFL+R  CL+F
Sbjct: 239 SNALESAYIVGS-------KETDNLEKEETKN------------LSILISFLTRGDCLNF 279

Query: 351 YNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRP---DDEE----------SDFSPALP 397
           YN++LQRLSEFKT L S  L L FV L Y ++  P   +DEE           D S  + 
Sbjct: 280 YNNILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMIS 339

Query: 398 LSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERD 457
            SL +D+  + ATRSI +EF  P+   E F   KL FL   +NKRYI+ES+DI++     
Sbjct: 340 ASLHHDVENKDATRSIIIEFKSPLEKAELF-KEKLQFLDRSKNKRYILESIDIVDTDVPS 398

Query: 458 ANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTF 499
              P+N V+LTFLNI M ++V+D ++   K  GISKC +V+ 
Sbjct: 399 NQFPENYVVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSL 440

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score =  450 bits (1157), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 255/555 (45%), Positives = 341/555 (61%), Gaps = 69/555 (12%)

Query: 522  SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581
            SNQ N      +LI      + N  +    + + + ++ +  F  SA++A++MG   GNR
Sbjct: 591  SNQSNGAVIPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNR 650

Query: 582  TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641
            T+YIGNINPRS+AEDICNVVRGG LQ IK+  EK I FVTFIEA SA QFYANSFIDPI+
Sbjct: 651  TIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIV 710

Query: 642  LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701
            LH N LRVGWG +SGPLPKSISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 711  LHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLA 770

Query: 702  LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSS-----NGGKTF 756
            LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N       +GG+  
Sbjct: 771  LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVI 830

Query: 757  -----HERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEER 811
                  E++  RYKGL+I YGKDRCGN+NK+L++GKNS+FY+KVK+PSYNIRL +LEE R
Sbjct: 831  VKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERR 890

Query: 812  KQEEKNKIS--NKSINLNSFGIQVE---------------TPSQNESEQEEPKISL-DGL 853
            +Q E +K    +K +NL S GI ++               T  + ESE E   ++  +  
Sbjct: 891  RQNENDKKESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETT 950

Query: 854  GMSLSKPNSENHDLKETDDSDSDI-------------STDIELIIDPP-----------V 889
            G+        N D+K     ++D              S+DIE+I+  P           +
Sbjct: 951  GLGGLGLGVANCDVKRATSDETDYEELFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTL 1010

Query: 890  RENTKGNKNKKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSS 949
            R +++   N K+  +  D +   + G      ++ L  +PP AP+TLS D  K S+    
Sbjct: 1011 RSSSQTVINSKRPVKVEDED---DVGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQ 1067

Query: 950  DLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAA 1009
            D  N  T              + N   KR S    + +PGSDVM+QYLAQ+QHSTFMYAA
Sbjct: 1068 DSRNAET--------------ANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAA 1113

Query: 1010 NILGASSDEPEFYDE 1024
            NILGAS+++  + +E
Sbjct: 1114 NILGASAEDNAYSEE 1128

 Score =  249 bits (635), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 174/462 (37%), Positives = 239/462 (51%), Gaps = 85/462 (18%)

Query: 95  VAAINMINSQLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQS 154
           V  IN +    S+    YYTN  +PN PPTPFD+AYGASLLPSHLLMGSPFVS+P M   
Sbjct: 37  VDFINGVGQYGSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM--- 93

Query: 155 YSQQFARPSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNN 214
                      +GG S  R S         NL   + +   SN N  N NSS+ N++ N 
Sbjct: 94  -----------QGGYSPARSS---------NLKRKAYSRPVSNQNGYNGNSSNHNHSGNG 133

Query: 215 NNRRGNHNSHRNT--------------NNNGGRFTQKNIIKRFQ-----------ENSLN 249
                N+  +                 NNN G  T+ +  +R             E  L 
Sbjct: 134 MMTPSNYYRNGRNSSSRNNNSTRNVSHNNNKGCDTRNSSGRRASSRSNIFDEINPEILLQ 193

Query: 250 R-FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDN 308
           R F I+YK+LP G+D Y+TRSLL ENVD+S DLH  +K FV F  +ES Y +      DN
Sbjct: 194 RPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFV------DN 247

Query: 309 NKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSN 368
           +KN+D  D + +N              S+L+SFL+R  CL+FYN++LQRLSEFK  L S 
Sbjct: 248 DKNDDLEDGETEN-------------LSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSK 294

Query: 369 DLTLSFVLLKYKNQ--------DRPDDEESDFSPA-----LPLSLEYDIIKRGATRSIAV 415
            L L FV L Y+++        ++P + +     A     +  SL +D+  + ATRSI +
Sbjct: 295 SLNLKFVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIII 354

Query: 416 EFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMT 475
           EF   +   E F   +L FL   +NKRYI+ES+D++N        P+N  +LTFLNI M 
Sbjct: 355 EFKSALEKTELF-RKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMA 413

Query: 476 VDVMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDI 517
           V+V+D ++   K   ISKC +V+     P + +  R S+ +I
Sbjct: 414 VEVLDYLKKFSKSLEISKCFYVSL---TPLMVSSTRSSVANI 452

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  447 bits (1149), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 240/516 (46%), Positives = 332/516 (64%), Gaps = 65/516 (12%)

Query: 553  LHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFF 612
            ++ ++R  + +F TSA++A++MG   GNRT+YIGN+NPRSKAED+CNVVRGG LQ IK  
Sbjct: 700  MYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLI 759

Query: 613  KEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASR 672
              K ICFVTFIEA++A QFYANSFIDP+ILH NTL++GWG++  PL KSI+LAVT+GASR
Sbjct: 760  ASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASR 819

Query: 673  NVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWI 732
            NVYVSLPE+AFKDKF+NDPEYKE+H KY LP+E++LR DF+ +G +EQ+N+L+D HCCW+
Sbjct: 820  NVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWV 879

Query: 733  NFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFY 792
            NFMNI SAIKLVE VN++    TF +++ +RY GLII YGKDRCGNVN++LIS KNS+ Y
Sbjct: 880  NFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHY 939

Query: 793  RKVKKPSYNIRLQQLEEERK-QEEKNKISNKSIN------LNSFGIQVE---------TP 836
            RKVKK S N +L+QL+E+R+ ++EK K  N  +N      L++ GI ++          P
Sbjct: 940  RKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVP 999

Query: 837  SQNESEQ-------EEPKISLDGLGMSLSKPNSENHD----------------LKETDDS 873
              NE +        E    + + LG  + + N+++HD                +   DD 
Sbjct: 1000 ESNEDDANYDSAVTESDTNTFNALGFRI-QSNTDSHDDEQNDEKGEEQEEVDVIAHADDI 1058

Query: 874  DSDISTDIELIIDPPVRE-NTKGNKNKKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLA 932
             S  S+D+E+IID P  E +T   + KK+  RKN    +            L ++   + 
Sbjct: 1059 SSVNSSDVEIIIDCPHNESDTSMIQEKKKTIRKNQQKID-----------RLAKARNAMF 1107

Query: 933  PATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNAS----HKRSSKKNKKLLP 988
            P           ++   D+ N    D+ +  +N              H  S+ K ++++P
Sbjct: 1108 P---------EHRETIPDINNKLFHDRKNKDKNRRKQVQGGIQDQDPHLSSTGKQQRVIP 1158

Query: 989  GSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024
            G+DVM+QYL QLQHSTFMYAANILG S+++  +YDE
Sbjct: 1159 GADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDE 1194

 Score =  221 bits (562), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 161/455 (35%), Positives = 226/455 (49%), Gaps = 120/455 (26%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPT----MGQSYSQQF---ARPS 163
            YY    +PNAPPTPFD+AYGA+LLPSHLLMGSP+VSTP       Q  SQ F     P+
Sbjct: 72  AYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPA 131

Query: 164 PSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNS 223
            +    S  +L+S    P       SSR++  +++ NN                      
Sbjct: 132 GTPNRKSFSQLNSMLNQP-------SSRSNFFTDSYNN---------------------- 162

Query: 224 HRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHC 283
            R  NN   R  + +  + FQ+     F ISYK+LP G+D Y+TRSLLF NV  S+DLH 
Sbjct: 163 -RYQNNPQTRIPEVDPNELFQK----PFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHS 217

Query: 284 FIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLS 343
           FI  FV +  IES+YLI++             DD+ D +N+ND N      +SILLSFLS
Sbjct: 218 FIYDFVQYSSIESIYLISNT------------DDEKDQDNENDKNK-----RSILLSFLS 260

Query: 344 RPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKY---------------------KNQ 382
           R ICL FYN+VLQRL+EFKT L S  LTL+FV+L Y                     +N+
Sbjct: 261 REICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQENE 320

Query: 383 DRPDDEESDFSPALPL--SLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLL-SPE 439
           +  +  E D+  ++    +L++D+I   ATR I +E  +    KE  +N  LSFL+ + +
Sbjct: 321 NDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIEL-KTKCDKETLLNKHLSFLIDNKK 379

Query: 440 NKRYIIESVDIIN-------------------------AAERDA------------NLPK 462
           N RYI+ES+D+ N                           E+D               P 
Sbjct: 380 NIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSKRTFPN 439

Query: 463 NTVILTFLNISMTVDVMDRIRLERKDSGISKCVFV 497
           +  +L+F+NI M +++ D ++L     GI+   +V
Sbjct: 440 HYAVLSFINIYMAMELRDYLKLNGLKHGITNASYV 474

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  442 bits (1137), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 330/510 (64%), Gaps = 72/510 (14%)

Query: 554  HQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFK 613
            H +  + + Q  TS ++A  MG    NRT+YIGNINPRS+AEDICNVVRGG LQ IKF +
Sbjct: 576  HPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIE 635

Query: 614  EKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRN 673
             K ICF+TFIEA++A QFYAN+FIDPI+LH NTL++GWG ++GPLPK I+LAVT+GASRN
Sbjct: 636  AKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRN 695

Query: 674  VYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWIN 733
            VY+SLPE AFKDK+I DP++K YH  + LP +E LRKDF ++G +EQ+N LND HCCW+N
Sbjct: 696  VYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVN 755

Query: 734  FMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYR 793
            FMNI SAI+LVE  ++S     F++ + +RY+GL+I YGKDRCGN+N++L++GK SK+++
Sbjct: 756  FMNISSAIRLVE--DASTKQDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHK 813

Query: 794  KVKKPSYNIRLQQLEEERKQE--EKNKISNKSI----NLNSFGIQVETPSQNESEQEEPK 847
            KVKK + ++RL QLEE+R+ +  E+ ++ N +I      ++F I         S +++ +
Sbjct: 814  KVKKHTRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINT------GSAEKKDE 867

Query: 848  ISLDGLGMSLSKPNS-----------ENHDLKETDDS---------DSDISTDIELIIDP 887
            +SLD LG+S+ +  S           E+H      D+         +S  S+DIELII+P
Sbjct: 868  LSLDSLGISIMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINP 927

Query: 888  PVRENTKGNKNKKQNHRKNDMNNNLNF--GNP----PPVSKTLLES-------SPPLAPA 934
            P                 ND N ++    G+P    PP  K  L +        PPLAP 
Sbjct: 928  P-----------------NDPNRSVGVLEGDPSTLSPPSDKRKLVALHEVSSPPPPLAPD 970

Query: 935  TLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMS 994
            T+SR + ++S         L T   ND  +      ++N  H++   +N + +PGSDVM+
Sbjct: 971  TISRQYAEASYH-----NELVT--GNDHPDTGYG-KAENGRHRQQLPRNARTIPGSDVMA 1022

Query: 995  QYLAQLQHSTFMYAANILGASSDEPEFYDE 1024
            QYLAQLQHSTFMYAAN+LGAS++  E YD+
Sbjct: 1023 QYLAQLQHSTFMYAANVLGASNEGTEQYDD 1052

 Score =  185 bits (470), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 138/397 (34%), Positives = 182/397 (45%), Gaps = 111/397 (27%)

Query: 119 PNAP-----PTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGR 173
           PN+P     PTPFD+AYGA+LLPSHLLMGSPFVSTP                        
Sbjct: 82  PNSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTP------------------------ 117

Query: 174 LSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGR 233
                      NLP                        N    R+G+H    N   +   
Sbjct: 118 -----------NLP----------------------QTNYTAQRKGSHTGMANGTGSMNY 144

Query: 234 F-TQKNIIKRFQENSLNR--FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVN 290
           + T   II     N L +  F ISYK+LPKG+D Y+TRSLL  N+D  VDLH F+ KFV 
Sbjct: 145 YRTDPQII-----NGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQ 199

Query: 291 FGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDF 350
              +ESVY+                                 +    LLSFLS  ICL+F
Sbjct: 200 NNSVESVYITKE--------------------------GQQPEKYGFLLSFLSVQICLNF 233

Query: 351 YNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALP-------LSLEYD 403
           YN+VLQRL EFK QL ++ L LSFV ++     RP   E                +L +D
Sbjct: 234 YNNVLQRLKEFKEQLKASSLELSFVSMR----QRPTKVEGKIYRRFAADDGDGMANLHFD 289

Query: 404 IIKR-GATRSIAVEF--NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANL 460
           +  + GATRSIA+EF     I +++  +N KL F LS  N RYI+E + +          
Sbjct: 290 MAAQTGATRSIAIEFVDKDVILTRDELLNKKLKF-LSEGNNRYILEHIAVFKTQHGTKVF 348

Query: 461 PKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFV 497
            KN  I+TFL+I M +++MD ++L  K   ++K  +V
Sbjct: 349 GKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYV 385

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
            Anc_8.844 YML117W
          Length = 1042

 Score =  436 bits (1122), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 326/488 (66%), Gaps = 39/488 (7%)

Query: 547  LRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTL 606
             R    +H +  + ++Q +TSA++A+ MG  AGNRT+YIGNINPRSKAEDICNVVRGG L
Sbjct: 575  FRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGIL 634

Query: 607  QQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAV 666
            Q IKF + K ICFVTFIEAA+A QFYAN+FIDPI+LH NTL++GWG++SGPLPKSI+LAV
Sbjct: 635  QSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAV 694

Query: 667  TVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLND 726
            T+GASRNVYVSLPE+AFKDK+INDPE+KEYH K+ LP  E+LR DFS +G  EQ+N+L+D
Sbjct: 695  TIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSD 754

Query: 727  GHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISG 786
             HCCW+NFMNI SAIKLVE   ++N    F+E++  RY GL+I YGKDRCGN+NK+LI+G
Sbjct: 755  SHCCWVNFMNISSAIKLVEE--ATNDFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAG 812

Query: 787  KNSKFYRKVKKPSYNIRLQQLEEERKQEEKNKISNKSINLNSFGIQVETPSQNESEQEEP 846
            KNS+FY K+++ ++N +L +LEE+R+  ++ +   K +  +   I  E+   +    EE 
Sbjct: 813  KNSRFY-KIRQ-NHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEES 870

Query: 847  K------ISLDGLGMSLSKPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKK 900
            K      + LD LG+SL              +S ++I+ DI   +     EN K      
Sbjct: 871  KENDGKFLQLDSLGISL--------------ESKNEIADDINDALTVDQFENEKS----- 911

Query: 901  QNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMD-- 958
                KN+   N +F +       L+ +SP  +  T   D   S K ++S  T   T +  
Sbjct: 912  --ITKNNGFENTSFHSDSSSDIELIINSPN-SLRTKDNDVLDSEKIINSANTTNRTGNAN 968

Query: 959  --QNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASS 1016
              +ND ++N ++      +  R+  +  + +PGSDVM+QYLAQLQHSTFMYAANILGAS 
Sbjct: 969  GYKNDYTKNRND--GMRNNRSRNRSRYSRTIPGSDVMAQYLAQLQHSTFMYAANILGASG 1026

Query: 1017 DEPEFYDE 1024
            +E E+YDE
Sbjct: 1027 EE-EYYDE 1033

 Score =  230 bits (586), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 158/397 (39%), Positives = 214/397 (53%), Gaps = 69/397 (17%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVST---PTMGQSYSQQFARPSPSKG 167
            YY    +PNAPPTPFD+AYGA+LLPSHLLMGSPF+S+   PT  Q Y  Q    + +  
Sbjct: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPQQQYFLQQQFNTNNNN 122

Query: 168 GNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNT 227
           G+S  R S    +    N P SSR+   S                    R+    ++  T
Sbjct: 123 GSSTPRKSFFKVS----NRPISSRSSRFS------------------EKRKSFIINNPTT 160

Query: 228 NNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKK 287
           NN+      K I+++     +N   ISY +LPKG+D Y+TRSLLFENVD +++LH FI  
Sbjct: 161 NNSNNNNNNKEILEKLFTEPIN---ISYVILPKGDDAYRTRSLLFENVDNAINLHSFITN 217

Query: 288 FVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPIC 347
           FV    IES+YL+                           N N+ +T  I+LSFLSR IC
Sbjct: 218 FVKNNSIESIYLV--------------------------PNKNDSNTCDIILSFLSRHIC 251

Query: 348 LDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKR 407
           LDFYN+VLQRL EFK  LNS  L L+FV LKY    R +            SLE++I+ R
Sbjct: 252 LDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGP---------SLEFNIVTR 302

Query: 408 GATRSIAVEF-----NQPITSKEGFMNSKLSFLL-SPENKRYIIESVDIINAAERDANLP 461
            ATRS+A+E      +  I  KE      L+ +L + ENKRY++ES+D+++  + +    
Sbjct: 303 DATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFG 362

Query: 462 KNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVT 498
           KN  IL+FLNI+M +++MD I++      I KC FVT
Sbjct: 363 KNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVT 399

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  439 bits (1128), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 204/321 (63%), Positives = 253/321 (78%), Gaps = 12/321 (3%)

Query: 538 IWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDI 597
           I+ME      R   M+  + ++ + QFATSAE+AN+MGGG GNRTVYIGNI+PRSK EDI
Sbjct: 628 IYMEPFG--RRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDI 685

Query: 598 CNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGP 657
           CNVVRGG LQ I+F ++K ICFVTFIEA++A QFY N+FIDPI+LH N L+VGWG HSGP
Sbjct: 686 CNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGP 745

Query: 658 LPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGE 717
           LPKS+SLAVTVGASRNVYVSLP++AFKDK+INDP+Y+ Y ++Y LP EE+LR DF+ FG+
Sbjct: 746 LPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGD 805

Query: 718 MEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCG 777
           +EQ+NFL+DGHCCW+NFMNI SAIKLVE +   N G+ FH+ + NRY+GLIIGYGKDRCG
Sbjct: 806 IEQINFLSDGHCCWVNFMNISSAIKLVEEIK-YNDGEAFHKSFDNRYRGLIIGYGKDRCG 864

Query: 778 NVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEERKQEEKNKIS------NKSINLNSFGI 831
           NVNK+LISGKNS+FY+KVKKPSYNIRL ++EEERK+ E+   S       K +   S GI
Sbjct: 865 NVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGI 924

Query: 832 QVETPSQNESEQEEPKISLDG 852
            +E    N++  E    SL+G
Sbjct: 925 HLEGNDNNKTSYER---SLNG 942

 Score =  233 bits (595), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 156/410 (38%), Positives = 220/410 (53%), Gaps = 67/410 (16%)

Query: 126 FDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPAPPTIN 185
           FD+AYG +LLPSHLL+GSPFVS+P + QS  Q           + +G ++S        +
Sbjct: 87  FDTAYGITLLPSHLLIGSPFVSSPDLFQSQQQSQHHHHHQNHQHQIGMVNSNASHQ---S 143

Query: 186 LPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNIIKRFQE 245
           L    R  A+  N  + NN+S +N + N ++R    +              +N  +R  +
Sbjct: 144 LNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASYPVPPPLKNPPVVARNRHRRRAQ 203

Query: 246 NSL------NRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYL 299
           N          F ++Y++LPKG+DEY+TRSLLFENV+ SVDL+ F+ K+  +GP+ES+Y+
Sbjct: 204 NEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYM 263

Query: 300 INSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLS 359
                          + D ND               S+LLSFLSR ICLD YNSVLQRL+
Sbjct: 264 ---------------FKDRNDKTK-----------HSVLLSFLSRKICLDSYNSVLQRLA 297

Query: 360 EFKTQLNSNDLTLSFVLLKY-KNQDRPDDEESDFSPALPL-------------------- 398
           EFKT L S  LT+SFV LKY K+ D  + +++D S + P+                    
Sbjct: 298 EFKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQD 357

Query: 399 ---------SLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVD 449
                    SL+YDI+ RGATRS+A+E +     K   ++ +L FL    N+RY++ES+ 
Sbjct: 358 DAYNVTVVASLQYDIVNRGATRSVALELDGEY-DKTKLLDQELDFLSPANNQRYVLESIY 416

Query: 450 IINAAERDANLPKNTVILTFLNISMTVDVMDRIR-LERKDSGISKCVFVT 498
           +INA E   + PKN  ILTFLNISM V+V+D +R  E   S   KC FV+
Sbjct: 417 LINAKEPFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVS 466

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 129/283 (45%), Gaps = 78/283 (27%)

Query: 809  EERKQEEKN--KISNKSINLNSFGIQVETPSQNESEQEEPKISLDGLGMSLSKPNSENHD 866
            E+ ++EEK   K+SNKS  ++  GI     +  +    + +  LD             H+
Sbjct: 992  EKYQEEEKELLKLSNKSQIIDGLGIAAVAGNGKDMVASQDQDILD-----------RAHE 1040

Query: 867  LKETDDSDSDISTDIELIIDPPVRENTKGNKNKKQNHRKN------------------DM 908
              + +  DS +S+++ELI+  P+    +G+ N ++ H KN                  D+
Sbjct: 1041 SGDEESLDSGVSSNVELILHSPL----EGDSNNQKKHEKNNKPFKSKKLENVSATGTGDV 1096

Query: 909  NN-NLNFG-NPPPVSKTLLESSPPLAPATLSRDFQKSSK---------QLSSDLTNL--- 954
            +N N + G     VS   +  +PP+AP+T+SR++    K         + SSD  N    
Sbjct: 1097 SNYNSSLGEGASAVSNPSISMNPPIAPSTISRNYSLMMKTQNGHPHPRRDSSDRQNQQQQ 1156

Query: 955  ----------------------------STMDQNDMSENDSNTSSKNASHKRSSKKNKKL 986
                                        S+ +  D   +    S       R+ ++N K 
Sbjct: 1157 QQQQQQQQQQQQQQQQHQQQQQQQPNPSSSHNSGDRMSSHVGNSRGQQGKGRNKRRNAKA 1216

Query: 987  LPGSDVMSQYLAQLQHSTFMYAANILGASSD-EPEFYDENVIN 1028
            +PGSDVM+QYLAQLQHSTFMYAANILGA+++ + ++Y++N  N
Sbjct: 1217 IPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTEN 1259

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  429 bits (1103), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 237/497 (47%), Positives = 321/497 (64%), Gaps = 60/497 (12%)

Query: 565  ATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIE 624
             T++++ N++G  AGNRT+YIGNIN RSK EDICNVVRGG LQ +K+ + K ICF+TFIE
Sbjct: 605  TTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIE 664

Query: 625  AASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFK 684
            A++A  FYANSFIDPI+LHN+TL++GWG++  PLPK+++LAVTVGASRNVYVSLPE+AFK
Sbjct: 665  ASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFK 724

Query: 685  DKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLV 744
            DKFINDPEY+EYH KY LP  ++LR DFS +G +EQ+N+L D HCCW+NF+NI +AI+LV
Sbjct: 725  DKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLV 784

Query: 745  ESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRL 804
            E  ++    K F E++ NRY GLII YGKDRCGNVNKSL+S KNS+FY+KVK  S N++L
Sbjct: 785  EDAHNPVESK-FSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKL 843

Query: 805  QQLEEERKQ--EEKNKISNKSIN------LNSFGIQVETPSQNESE------QEEPKISL 850
            ++LEE+RK   E  N +   S +      L++FGI ++T S NE +          KI  
Sbjct: 844  KELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEEDGNIEKGNTLSKIDT 903

Query: 851  DGLGM-SLSKPNSENHDLK-ETDDSD-----------SDISTDIELIIDPP--------V 889
            D  G  +L       HD+  ET D++           SD S++IEL+I  P        V
Sbjct: 904  DVNGFNALGFKIEPKHDMMNETMDNNTEGNNTLENISSDESSNIELMISSPKESVQKGDV 963

Query: 890  RENTKGNKNKKQNHRKNDMNNNLNFGNPPP--VSKTLLESSPPLAPATLSRDFQKSSKQL 947
              N K + N   N ++N  +N   +         +    S+   AP          +K+ 
Sbjct: 964  ITNQKPHSNNHHNFKRNSSSNRQRYKETDTQNTHRNNNNSNATFAP----------NKEF 1013

Query: 948  SSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMY 1007
               ++    +D++  +    NT+ K A          +++PGSDVM+QYLAQLQHSTFMY
Sbjct: 1014 GFGIS--PNVDEHQKNNKKHNTNDKEA----------RVIPGSDVMAQYLAQLQHSTFMY 1061

Query: 1008 AANILGASSDEPEFYDE 1024
            AANILGAS+++  +YDE
Sbjct: 1062 AANILGASAEDGSYYDE 1078

 Score =  270 bits (690), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 234/416 (56%), Gaps = 64/416 (15%)

Query: 112 YYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARP---SPSKGG 168
           YY    +PN PPTPFD+AYGA+LLPSHLLMGSPFV+TPT G S S  F +P   +P++  
Sbjct: 69  YYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMMTPNRAS 128

Query: 169 NSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTN 228
                  S  P+   +  PPS+R                  N N+ N RR ++ S     
Sbjct: 129 ------FSQIPSMLNVGNPPSARRQG---------------NQNDPNRRRSSYRSKVPET 167

Query: 229 NNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKF 288
           +    F Q              F +SYK+LP G+D Y+TRSLLFENV  S++LH F+ +F
Sbjct: 168 DPKTLFLQP-------------FRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEF 214

Query: 289 VNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICL 348
           V F PIESVYLIN    +D++K +DD                  + +SILLSFL+R +CL
Sbjct: 215 VRFSPIESVYLINH---HDSDKPDDD-----------------TECRSILLSFLTREVCL 254

Query: 349 DFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDF--SPALPL--SLEYDI 404
            FYN+VLQRL EFK +L S +L LSFV +KY  QD  ++EE++    P+     S+ +++
Sbjct: 255 TFYNNVLQRLKEFKAKLKSENLRLSFVSIKY--QDENEEEETNIVDEPSFYTKESVYFEL 312

Query: 405 IKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNT 464
               ATRSI ++F  P + +E F + KL FL    N RYI+ES+D++N  + +   PK+ 
Sbjct: 313 SNPQATRSILIQFKNPCSEQELF-DKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHY 371

Query: 465 VILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSD 520
            ILTF+NI M +++ D +++     GI  C+FV    +  +  + KR S++   +D
Sbjct: 372 AILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASIISKDND 427

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  416 bits (1069), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 189/292 (64%), Positives = 238/292 (81%), Gaps = 13/292 (4%)

Query: 556  LLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEK 615
            L +  ++ F TS E++  +GGG GNRTVYIGNINPRSK ED+CNVVRGG LQ+I F ++K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 616  GICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVY 675
             ICFVTFIEA +AAQF+AN++IDPI+LH N L+VGWG+HSGPLPKSISLAVT+GA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 676  VSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFM 735
            VSLPE+AFKDKFIN+P+Y++YH  Y LP E +LRKDFS +GE+EQ+N+LNDGHCCWINFM
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 736  NIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKV 795
            NI SAI LVE VN  +G + FH ++  RY GLIIGYGKDRCGNVNK+L++ KNSKF++KV
Sbjct: 981  NINSAITLVEEVNEDDGIR-FHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKV 1039

Query: 796  KKPSYNIRLQQLEEERKQEEK------NKISNKS------INLNSFGIQVET 835
            KKP+Y I+L+++EEER+ +E+      NK+SN S      +NL S GI  E+
Sbjct: 1040 KKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGITFES 1091

 Score =  194 bits (494), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 171/509 (33%), Positives = 238/509 (46%), Gaps = 152/509 (29%)

Query: 99  NMINSQLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQ-SYSQ 157
           NMI+   + +P  Y     IP+APPTPFD +YGA+LLPSHLLMGSPFVSTP +    YS 
Sbjct: 85  NMIDHTSALNPTYY---SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSA 141

Query: 158 QFARPSPSKGGNSMGRLSSA---------------------YPAPPTINL--PPSSRAHA 194
                +P++   S    +S                      YP PP   L  PP      
Sbjct: 142 TSISSTPTRKSFSRKNSNSNSISNSNSSSMSNLNLNSKYDNYPIPPVPILKNPPL----- 196

Query: 195 SSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNT--NNNGGRFTQKN------IIKRFQEN 246
                   NN +  N+ NN+N  R NH  +R    ++N  R +Q+       II++ + +
Sbjct: 197 --------NNQNIRNSRNNSNRIRNNHIINRKLLKDDNSYRISQQTFKENPMIIEKPKYS 248

Query: 247 S---LNRF-----TISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVY 298
           S   +N+       +SYK+LPKG DE++TRSLL EN+++S+D    +K F+NFGPIESVY
Sbjct: 249 SVIDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVY 308

Query: 299 LINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRL 358
           LI  N     N                          SILLSF+SR ICLDFYN+VLQRL
Sbjct: 309 LIKLNPGSKYN--------------------------SILLSFVSREICLDFYNNVLQRL 342

Query: 359 SEFKTQLNSNDLTLSFVLLKYKNQD----------------------------------- 383
            EFKT+L+S  LTLSFV+LKY+  D                                   
Sbjct: 343 MEFKTELSSKSLTLSFVILKYEFTDYNHPINEHASDNGDESSSSNKNLKIDTIKEEEEDE 402

Query: 384 -------------RPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNS 430
                        R D  + +F      +L+ D++KRGATRS+ ++FN  + SK+  +N 
Sbjct: 403 EETDGEEIVIEDIRNDLNKENFPLTFASALQSDLVKRGATRSLLLKFNG-VVSKDQLINE 461

Query: 431 K-LSFLLSPENKRYIIESVDIINAAE-----------------RDANLPK---NTVILTF 469
           K   F+ +  N RYI+ES+ ++N                     D  + K   N  +LTF
Sbjct: 462 KLNLFINNNLNNRYILESISLVNIENNTKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTF 521

Query: 470 LNISMTVDVMDRIRLERKDSGISKCVFVT 498
            NI M ++  D  + +  +  I  C FV+
Sbjct: 522 SNILMAIEAFDYFKAKLNELNIFDCFFVS 550

 Score = 75.5 bits (184), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 7/102 (6%)

Query: 924  LLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQND--MSEN-----DSNTSSKNASH 976
            +L   PP+A +TL+R ++K+  +  +D     T D  D  +S+      D     +   +
Sbjct: 1248 VLNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKNPFRGPRN 1307

Query: 977  KRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018
            K  ++  +K +PGSDVMSQYL QLQHSTFMYAANILG S+++
Sbjct: 1308 KNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAED 1349

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
            similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  398 bits (1022), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 229/505 (45%), Positives = 309/505 (61%), Gaps = 58/505 (11%)

Query: 576  GGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANS 635
            GG+ NRTVYIGNI+PRSK EDICNVVRGG LQ IK+   K ICFVTFIEAA+A QFYAN+
Sbjct: 564  GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANA 623

Query: 636  FIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKE 695
             ++PI+LH N LRVGWG  SG LPK+I+LAVT+GASRNVYVSLPEY+FK+K+IN+PE+KE
Sbjct: 624  SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKE 683

Query: 696  YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVN--SSNGG 753
            YH KY LP+EE+LR+DF+ +G++EQ+N+L+DGHCCW+NFMNI  AI+LVE  N  S    
Sbjct: 684  YHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNL 743

Query: 754  KTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEERKQ 813
            + FH ++  RYK LIIGYGKDRCGNVNK+L + KNS+F++K+KK +   +      +R+Q
Sbjct: 744  EKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTK----PNKRQQ 799

Query: 814  EEKNKISNKSINLNSFGIQVE-TPSQNESEQEEPKISL-------DGLGMSLS------- 858
             ++   S  S +        E  P  ++    +  + L       +GLG+SLS       
Sbjct: 800  SKRGTSSASSDDARKDDASTEKVPVSSKEPVCDEILGLNDDNALAEGLGISLSSAYVNEY 859

Query: 859  ------KPNSENHDLKETDDSDSDIST----DIELIIDPPVREN--TKGNKNKKQNHRKN 906
                  + N +N    ET + D+  +T    DI++I+ PP+  N   +GN N  ++ RK+
Sbjct: 860  GDDISKRTNKKNRSKTETVEEDTGYTTSGSSDIDIIVAPPLEHNKGKEGNSNHGKSKRKS 919

Query: 907  DMNNNLNFGNPPPV--------------------SKTLLESSPPLAPATLSRDFQKSSKQ 946
                 L  G    V                    S T L+S PPL P+ +++ F   S  
Sbjct: 920  QGGKRLQNGAQDGVGGGYGGHSQHYLAGSFELVNSNTYLDSIPPLVPSPINQHFHDKSLC 979

Query: 947  LSSDLTNL---STMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHS 1003
              S   N    +    N+ S N   +++ N + +R   K  K + G DVMSQYL QL HS
Sbjct: 980  RGSAHVNDNNNALGGFNNYSYNCGGSNNGNRTRRRRQAKFSKPIAGQDVMSQYLEQLHHS 1039

Query: 1004 TFMYAANILGASS--DEPEFYDENV 1026
            TF+Y+ NILGA++  D   FYD N 
Sbjct: 1040 TFLYSTNILGATTVHDPLGFYDVNA 1064

 Score =  192 bits (488), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 192/390 (49%), Gaps = 108/390 (27%)

Query: 118 IPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSA 177
           +P  P TPFD  YGASLLPSH+LMGSPFVSTP   Q +      PS S   N   R    
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGH----FHPSASSHSNH-SRSFLY 133

Query: 178 YPAPPTIN-LPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQ 236
           YP PP +  +PP  R                                             
Sbjct: 134 YPQPPILKPIPPRRR--------------------------------------------- 148

Query: 237 KNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDK--SVDLHCFIKKFVNFGPI 294
               K F  N    + +++K+LPKG DEY TRSLLF N+++  + D+H F+  F+ FGPI
Sbjct: 149 ----KSFSLNHSEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPI 204

Query: 295 ESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSV 354
           ES+YL++                               D+ SILLSFL++  CLDFYN++
Sbjct: 205 ESIYLLD-------------------------------DSHSILLSFLTKATCLDFYNNL 233

Query: 355 LQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIA 414
           LQR SEFK++L+S  L++SFV           DE + F       L+ +++ RG TRS+ 
Sbjct: 234 LQRFSEFKSKLHSTKLSVSFVC---------QDETNWFR-----LLQMNVVTRGVTRSLC 279

Query: 415 VEF-NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAE-RDANLPKNTVILTFLNI 472
           +EF +Q +      ++ K+ +L    + R++IE +D++NAA  ++ N     +++ F+ I
Sbjct: 280 IEFEDQSMELTSDLIHEKIPWLFF--SHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICI 337

Query: 473 SMTVDVMDRIRL--ERKDSGISKCVFVTFN 500
           SM ++V + ++   ++K  GISK  FV  N
Sbjct: 338 SMALEVEEYLQQASQKKQLGISKIQFVNVN 367

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  399 bits (1026), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 181/285 (63%), Positives = 228/285 (80%), Gaps = 13/285 (4%)

Query: 564 FATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFI 623
           F  SA++A++MG   GNRT+YIGNINPRS+AEDICNVVRGG LQ IK+  EK ICFVTFI
Sbjct: 634 FNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFI 693

Query: 624 EAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAF 683
           EA SA QFYANSFIDPI+LH N LRVGWG +SGPLPKSISLAVT+GASRNVYVSLPE+AF
Sbjct: 694 EAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAF 753

Query: 684 KDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKL 743
           K+KFI+DP+YK+ H    LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI L
Sbjct: 754 KEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISL 813

Query: 744 VESVNSSN-----GGKTFH-----ERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYR 793
           VE +N  +      G+  H     +++  RY+GL+I YGKDRCGN+NK+L++GKNS+FY+
Sbjct: 814 VEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYK 873

Query: 794 KVKKPSYNIRLQQLEEERKQEE---KNKISNKSINLNSFGIQVET 835
           KVK+PSYNIRL +LEE R+Q E   K +  +K++NL S GI +++
Sbjct: 874 KVKRPSYNIRLSKLEERRRQNENDKKERAFDKALNLESLGISLDS 918

 Score =  259 bits (663), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 172/430 (40%), Positives = 236/430 (54%), Gaps = 53/430 (12%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYS---------QQFAR 161
            YY+N  +PN PPTPFD+AYGASLLPSHLLMGSPFVS+P M   YS         + ++R
Sbjct: 53  AYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSR 112

Query: 162 PSPSKGGNSMGRLSSAYPAPPTINLPPS-SRAHASSNNNNNNNNSSSSNNNNNNNNRRGN 220
           P  +    +    S+       +  P +  R   +S + NNN+  +S++NN   +NR  +
Sbjct: 113 PVSNHNNYNGNNNSNQNNNNNGMVTPSNYYRIERNSFSRNNNSTRNSTHNNKGCDNRNSS 172

Query: 221 HNSHRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVD 280
                  NN     + + +++R        F I+YK+LP G+D Y+TRSLL ENVD+S D
Sbjct: 173 GRRTSTRNNIFDDISSELLLQR-------PFRINYKILPTGDDAYRTRSLLIENVDRSTD 225

Query: 281 LHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLS 340
           LH  +K FV    +ES Y+I        N+ +DD  D+  +N             SIL+S
Sbjct: 226 LHSIVKNFVKSNTLESTYII-------GNEKSDDLKDEQTSN------------LSILIS 266

Query: 341 FLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRP----DD------EES 390
           FL+R  CL+FYN++LQRLSEFKT L S  L L FV L Y  +       DD      E+ 
Sbjct: 267 FLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALTENVEQI 326

Query: 391 DF---SPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIES 447
           D    S  +  SL +D+  + ATRSI VEF  P+ S E F N KL FL    NKRYI+ES
Sbjct: 327 DITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELF-NKKLQFLDRSNNKRYILES 385

Query: 448 VDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKENPTVP 507
           +DI+N        P+N  +LTFLNI M ++V+D ++   K  GISKC +V+     P V 
Sbjct: 386 IDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSL---APLVI 442

Query: 508 NMKRLSLVDI 517
           +  R S+ +I
Sbjct: 443 SSTRSSVANI 452

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  389 bits (999), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 227/517 (43%), Positives = 312/517 (60%), Gaps = 70/517 (13%)

Query: 561  KHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFV 620
            + Q+   A  AN    G  NRTVYIGNI+PRSK EDICNVVRGG LQ IK+   K ICFV
Sbjct: 540  QRQYLAGASQAN----GINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFV 595

Query: 621  TFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPE 680
            TFIE A+A QFYAN+ ++PI+LH N LRVGWG  SG LPK+I+LAVT+GASRNVYVSLPE
Sbjct: 596  TFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPE 655

Query: 681  YAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSA 740
            Y+FK+K+IN+PE+K YH KY LPTEE+LR+DF+ +G++EQ+N+L DGHCCW+NFMNI  A
Sbjct: 656  YSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHA 715

Query: 741  IKLVESVNS--SNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKP 798
            I+LVE  NS      + FH ++  RYK LIIGYGKDRCGNVNK+L + KNS+FY+K+KK 
Sbjct: 716  IRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQ 775

Query: 799  SYNIRLQQLEEERKQEEKNKISNKSINLNSF---GIQVETPSQNESEQEEPKISLD---- 851
            SY+++  Q ++ RK  E   +++  +  N+    G+Q+ + S+N    E   +  D    
Sbjct: 776  SYSMK--QGKQPRK--EDGIVNSDDLTKNNEVLPGVQMNS-SKNGGVGESQSLVGDQELA 830

Query: 852  -GLGMSLS----KPNSENHDLKETDDS-------------DSDISTDIELIIDPP----- 888
             GLG+SL+     P++  H    +D                +  S+DI++I+ PP     
Sbjct: 831  EGLGISLTSAQISPDT-GHTHHYSDGVEEGDECDDDDAGYSTSGSSDIDIIVAPPDEFKR 889

Query: 889  ----------------VRENTKGNKNKKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLA 932
                             R N   N     ++ +     +L+  +    S   L++ PPLA
Sbjct: 890  RESGTSSGKHKKKSKSTRRNQHSNAASSASYNQQYSLGSLDHTS----SAGSLDAPPPLA 945

Query: 933  PATLSRDFQ-KSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSD 991
            P+++ +    +  +      T+ S    N  +  ++N  S+    +R   K  K + G D
Sbjct: 946  PSSMQQHLADRRPRHTPGRSTDSSASQYNSQTPTNANYKSR----RRRQAKFSKPIAGQD 1001

Query: 992  VMSQYLAQLQHSTFMYAANILGASS-DEP--EFYDEN 1025
            VMSQYL QL HSTF+YA NILGA++  EP   +YD N
Sbjct: 1002 VMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSN 1038

 Score =  192 bits (489), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/395 (33%), Positives = 194/395 (49%), Gaps = 111/395 (28%)

Query: 118 IPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSA 177
           +P  P TPFD  YGASLLPSH+LMGSPF+STP   Q++   F   +P    +S+    SA
Sbjct: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAH---FHPSTPGHSSHSLHHAQSA 112

Query: 178 ------YPAPPTIN-LPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNN 230
                 YP PP +  +PP  +   + N++                               
Sbjct: 113 RSSFLYYPQPPMLKPIPPRRKKSVTLNHSE------------------------------ 142

Query: 231 GGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVD--KSVDLHCFIKKF 288
                               + I++K+LPKG DEY TRSLL  N++  + +D+H F+  F
Sbjct: 143 -------------------PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSF 183

Query: 289 VNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICL 348
           V FGP+ES+YL+                         DDN       SILLSFL++  CL
Sbjct: 184 VKFGPVESIYLM-------------------------DDN------HSILLSFLTKATCL 212

Query: 349 DFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRG 408
           DFYN++LQR SEFKT+L+S  L++SFV           DE S F       L+ +++ RG
Sbjct: 213 DFYNNLLQRFSEFKTKLHSPKLSVSFVC---------QDESSWFK-----YLQMNVVTRG 258

Query: 409 ATRSIAVEFNQPITS-KEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVIL 467
           ATRS+ VEF   +    E F+  K  +L    ++R+++E +D+INA   + +     +IL
Sbjct: 259 ATRSLTVEFEDSVKELNEDFVRLKFPWLFC--SQRFVLERIDLINATTVNQHFGTRYMIL 316

Query: 468 TFLNISMTVDVMDRIRL--ERKDSGISKCVFVTFN 500
            F++ISM ++V D ++   +++   IS+  FV  N
Sbjct: 317 HFISISMALEVDDFLQQPSQKRQLNISRIQFVNVN 351

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  325 bits (834), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 183/239 (76%), Gaps = 4/239 (1%)

Query: 552 MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKF 611
           M  Q+ +  ++Q++ S +  N    G  +RTVYIGNINPRSKAEDICNVVRGG LQ IK+
Sbjct: 620 MPPQITQTIQNQYSKSIQAVN---AGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKW 676

Query: 612 FKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGAS 671
              K ICFVTFIE A+A QFYAN+ ++PIILH N L+VGWG + GPLPK+I+LAVTVGAS
Sbjct: 677 VSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGAS 736

Query: 672 RNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCW 731
           RNVYVSLP+ AFKDKFINDP++KEY N+Y +P   +L+ DF  +G MEQVNF +DGHCCW
Sbjct: 737 RNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCW 796

Query: 732 INFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSK 790
           INFMNI SAIKLVE   S      FH++   RY GLIIGYGKDRCGN+N++L+  KN K
Sbjct: 797 INFMNISSAIKLVEEY-SDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854

 Score =  156 bits (395), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 135/456 (29%), Positives = 215/456 (47%), Gaps = 75/456 (16%)

Query: 122 PPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRL-----SS 176
           P TPFD  YG +LLPSHLL+GSPFV+TP  G   S          G N++  L      S
Sbjct: 69  PQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKS 128

Query: 177 AYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNN-----NNRRG--------NHNS 223
            YP  P +   PS R   +   +N        + +NN      +  RG        + + 
Sbjct: 129 FYPPAPKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVERGYSSRSASRSQSF 188

Query: 224 HRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHC 283
             +T+ +    +    I++  ++ L +    Y +LPKGND Y++RSLLF NV+  +D+  
Sbjct: 189 SASTSGSMSGSSGPKSIRKTIDSEL-KIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVE 247

Query: 284 FIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDND----------------D 327
           F++K     PIES+YLI       +    DD ++ N +NND+D                D
Sbjct: 248 FLQKVAKNYPIESIYLIK------DEDTGDDIENLNTSNNDDDPNQNYNADNNNNSKRED 301

Query: 328 NANNHDT----------------QSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLT 371
           + +                    QS LLSF ++  CLDFYN++LQR +E K  + S+ L 
Sbjct: 302 DKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLA 361

Query: 372 LSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSK 431
           ++FV ++       DDEE         +L+ ++I  GATRS+ VEF     + +   ++ 
Sbjct: 362 MNFVKIQ-------DDEE------WMANLKMNVISLGATRSLYVEFADDSVTSDTIWDT- 407

Query: 432 LSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGI 491
           L FL +  + +Y++  VD++   ER  N   +  +L FL+++M ++V +   LE  D  +
Sbjct: 408 LPFLKN--SGKYVVIDVDVVTTDERRKNFGLHYCLLHFLSVTMALEVKE--LLETGDEAV 463

Query: 492 SKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNS 527
           S+  FVT           +R S + +  + S Q+ S
Sbjct: 464 SRVSFVTPANSADKEMRRRRSSAISLKQEASPQMFS 499

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 1/45 (2%)

Query: 981  KKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDEN 1025
            K + K + GSDVM++YL QL H+TF+YAANILGA+ D P FYDE+
Sbjct: 1106 KSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQD-PVFYDED 1149

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  209 bits (532), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 143/396 (36%), Positives = 209/396 (52%), Gaps = 57/396 (14%)

Query: 112 YYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSM 171
           YY    +P+AP TPFD++YGA+LLPSHLLMGSPF+STP   Q+ +   A    S+G NS 
Sbjct: 57  YYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTP---QNAAMMHAG---SRGLNSS 110

Query: 172 GRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGN-----HNSHRN 226
            +                   H + +NN  N  SS  NN +      G+     ++    
Sbjct: 111 QQ----------------QFYHYTYSNNGKNKGSSKKNNRDKKKVENGHVMMTRYSYPPP 154

Query: 227 TNNNGGRFTQKNIIKRFQEN----SLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLH 282
              N    T K       E     S   + I++K+LPKG+DEY TRSLL  NV+ S+ LH
Sbjct: 155 PQLNAPPMTHKRKTHLRHETNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNASIKLH 214

Query: 283 CFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFL 342
            FI KFV FGPIESVY++         +  ++ +++ +   + ++       QSILLSFL
Sbjct: 215 DFITKFVKFGPIESVYVVPE-----EEEEEEEEEEEEEEEEEEEEEKGEEKKQSILLSFL 269

Query: 343 SRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEY 402
           ++  CLDFYN+VLQ+LS+FK  LNS  LTL+FV L   ++D  D                
Sbjct: 270 TKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSL--TSEDIRD---------------- 311

Query: 403 DIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPK 462
           D++++GATRSIA+EF    T+K+      +  L +  N R+++E +DI+N    + N   
Sbjct: 312 DVLRKGATRSIALEFKNSFTTKQ---LESIEILSNASNSRFVVEKIDIVNTESPNKNFNT 368

Query: 463 NTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVT 498
           +  I+ F++ISM V+    +    +  GIS+  FVT
Sbjct: 369 HYAIIHFISISMAVEASSYLLNWDEKLGISRLFFVT 404

 Score = 85.1 bits (209), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 68/114 (59%), Gaps = 8/114 (7%)

Query: 915  GNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNA 974
            G P  VS T L++ PPLAP+T+SR +  +S   ++   N    D +         ++ + 
Sbjct: 967  GFPSMVSSTSLDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTHHG 1026

Query: 975  SHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE---FYDEN 1025
             H++S     K +PGS VM+QYLAQLQHSTFMYAANILG ++ + E    YDEN
Sbjct: 1027 RHRKS-----KAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDEN 1075

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  180 bits (457), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 92/201 (45%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 340 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 399

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSGPLP  ++LAV+ GASRN+Y+   ++A  DK    P +     
Sbjct: 400 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIF----- 453

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                TE  LR  F  FGE+EQ+NFL + +CC+INF NI SAI  ++ + S         
Sbjct: 454 -----TEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKS--------- 499

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 500 --IPTFKDLKINFGKDRCGNV 518

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 112/207 (54%), Gaps = 19/207 (9%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P    +++ + VR G ++++K   EK   F++F+E  SA  F++++ +
Sbjct: 100 APSRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAIL 159

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL--PEYAFKDKFINDPEYKE 695
             + + +  +++GWG  +   P   +     GA+RNVY+           ++  DP    
Sbjct: 160 KRLNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLNTNKDICAQWGVDP---- 215

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
             N+ V+ TEE+LR D S FGE+E V  + +    +++F +I +AIK+V ++ + N    
Sbjct: 216 --NEEVI-TEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANIN---- 268

Query: 756 FHERYANRYKGLIIGYGKDRCGNVNKS 782
               YA +     I YGKDRC  + K+
Sbjct: 269 --PYYAQKK----IFYGKDRCAFITKT 289

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  181 bits (458), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 393 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 452

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSGPLP  ++LAV+ GASRN+Y+   ++   D+ +  P +     
Sbjct: 453 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF----- 506

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                TE  LR  F  FGE+EQ+NFL + +CC+INF NI SAI  ++ + S         
Sbjct: 507 -----TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKS--------- 552

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 553 --IPTFKDLKINFGKDRCGNV 571

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 110/209 (52%), Gaps = 23/209 (11%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P     ++ + VR G ++ +K   EK   F++F++  SA  F++++ +
Sbjct: 153 APSRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAIL 212

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDP----EY 693
             + + +  +++GWG  +   P   +     GA+RNVY+         K   +P    ++
Sbjct: 213 KRLNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLG--------KLNTNPKMCAQW 264

Query: 694 KEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG 753
               N+  + TEE+LR D + FGE+E V  + +    +++F +I SAIK+V ++ + N  
Sbjct: 265 GADPNEETI-TEEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANVN-- 321

Query: 754 KTFHERYANRYKGLIIGYGKDRCGNVNKS 782
                 YA +     I YGKDRC  + K+
Sbjct: 322 ----PYYAQKK----IFYGKDRCAFITKT 342

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  180 bits (456), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 126/201 (62%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICNVVRGG LQ +K   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 446 GNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSLH 505

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +     +VGWG HSGPLP +++LAV+ GASRNVY+      F+   + DP       
Sbjct: 506 GLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPR------ 557

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE+ LRK F  +GE+EQ+NFL + +CC+INF NI +AI  ++ + S+        
Sbjct: 558 ---IFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIKSN-------- 606

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                ++ L I +GKDRCGNV
Sbjct: 607 ---PHFEDLKINFGKDRCGNV 624

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 107/206 (51%), Gaps = 23/206 (11%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      +++ + VR G ++ +K   EK   F++F++ +SA  F++++ +
Sbjct: 211 APSRTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAIL 270

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + +    +++GWG  +   P   +  +   A+RNV++        +K  ND   KE  
Sbjct: 271 KRLNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFI-----GHLNKTDNDSCTKE-- 323

Query: 698 NKYVLP-TEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTF 756
                P TE +LR+D   FGE+E V  + +    +++F +I SAIK V ++ S N     
Sbjct: 324 -----PITEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMN----- 373

Query: 757 HERYANRYKGLIIGYGKDRCGNVNKS 782
              Y N+     I YGKDRC  + K+
Sbjct: 374 -PYYENKK----IAYGKDRCAFITKT 394

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  179 bits (454), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 168/324 (51%), Gaps = 50/324 (15%)

Query: 480 DRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNSEFENTRLIHLIW 539
           +++R + KD G   CV +  +K    V     LS + + ++++ Q N  ++N R    I+
Sbjct: 408 EKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVVNNLA-QTNPYYQNKR----IF 462

Query: 540 METINCNLRXXXMLH---QLLRAS---KH--QFATSAEIANTM--------------GG- 576
                C        H   Q L      +H  QF+    I+NT+              GG 
Sbjct: 463 YGKDRCAFITKTQQHNAAQFLGVQPGMEHLVQFSDREFISNTLLQQSAAAAAIATSAGGP 522

Query: 577 -GAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANS 635
              GNRTVY+GN+    K ++ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S
Sbjct: 523 NNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMS 582

Query: 636 FIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKE 695
            +  + +     +VGWG HSGPLP  I+LAV+ GASRNVY+   ++    K  N P +  
Sbjct: 583 SLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIF-- 640

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
                   TE  LR  F  +G++EQ+NFL + +CC+INF NI +AI  +E + ++     
Sbjct: 641 --------TELSLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKNNPD--- 689

Query: 756 FHERYANRYKGLIIGYGKDRCGNV 779
                   +K L I +GKDRCGN+
Sbjct: 690 --------FKDLKINFGKDRCGNI 705

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 115/233 (49%), Gaps = 27/233 (11%)

Query: 566 TSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEA 625
           TS    N   G   +RTVY+GNI      +D+ + VR G ++ IK   +K   F++F++ 
Sbjct: 253 TSTLPNNNTFGNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDE 312

Query: 626 ASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVS-------- 677
           +SA  F++++ +  + +    +++GWG  +   P   +  VT GA+RNVY+         
Sbjct: 313 SSALLFHSDAILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNN 372

Query: 678 --------LPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHC 729
                       +  +   +D E K+  +   L TEE+LR+D   +GE++ V  + D   
Sbjct: 373 NTSSSSSSTSPSSPSNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGF 431

Query: 730 CWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKS 782
            +++  +I SAIK+V ++  +N        Y N+     I YGKDRC  + K+
Sbjct: 432 AFVHMSSILSAIKVVNNLAQTN------PYYQNKR----IFYGKDRCAFITKT 474

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  179 bits (453), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 129/201 (64%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    + E+ICNVVRGG LQ +K   ++ +CFVTFI+  +AAQF+A S + 
Sbjct: 497 GNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSLH 556

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +     +VGWG HSGPL  +++LAV+ GASRN+Y+   ++A  DK  ++P +     
Sbjct: 557 GLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIF----- 610

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                TE+ LRK FS +GEMEQ+NFL + +CC+INF NI +AI  ++ + S+        
Sbjct: 611 -----TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSN-------- 657

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGN+
Sbjct: 658 ---PVFKDLKINFGKDRCGNI 675

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 110/237 (46%), Gaps = 42/237 (17%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      +++ + VR G ++ +K   EK   F++F++  SA  F++++ +
Sbjct: 219 APSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAIL 278

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVS-LPEYAF---KDKFINDPEY 693
             + ++   +++GWG  +   P   +  +  GA+RNV++  L   +F   K K    P  
Sbjct: 279 KRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPS 338

Query: 694 KEYHNKYVLPTEEE----------------------------LRKDFSYFGEMEQVNFLN 725
           + +     +  E +                            LRKD + FG+++ +  + 
Sbjct: 339 RNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVE 398

Query: 726 DGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKS 782
           D    +I+F +I SAIK V ++NS N          + Y    I YGKDRC  + K+
Sbjct: 399 DKGIAFIHFASITSAIKCVHNLNSMN----------DYYSTKKIFYGKDRCAFITKT 445

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  177 bits (448), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 125/201 (62%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICN VRGG LQ +K   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 399 GNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 458

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSG LP +++LAV+ GASRN+YV   ++   D+            
Sbjct: 459 GLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDE-----------T 507

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE+ LR+ F  FGE+EQ+NFL++ +CC+INF NI +AI  ++ +  +        
Sbjct: 508 GETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKCN-------- 559

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L + +GKDRCGNV
Sbjct: 560 ---PYFKNLKVNFGKDRCGNV 577

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 115/209 (55%), Gaps = 23/209 (11%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P   A+ + + VR G ++++K   ++   F++F++ +SA  F++++ +
Sbjct: 158 APSRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAIL 217

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL----PEYAFKDKFINDPEY 693
             + +    ++VGWG  +   P   +   + GA+RNVY+      P+ A   +F  DP  
Sbjct: 218 KRLNIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNE 275

Query: 694 KEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG 753
           +       + +EE+LRKD + FGE+E +  + D    +++F +I SAIK+V ++ S N  
Sbjct: 276 E-------IVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLASVN-- 326

Query: 754 KTFHERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y N+     I YGKDRC  + K+
Sbjct: 327 ----PYYTNKK----IFYGKDRCAFITKT 347

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  172 bits (436), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 121/201 (60%), Gaps = 24/201 (11%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN++ R + E++CNVVRGG LQ +KF  ++ +CFVTF +  +AAQFYA + + 
Sbjct: 263 GNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASLH 322

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +     ++GWG HSGPLP  ++ A++ GASRNVY       F +    DP   E+  
Sbjct: 323 GLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFFE 375

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                 E  LR+  S+FGEMEQVN + +  C ++NF N+ SAI  VE V           
Sbjct: 376 ------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV----------- 418

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
           +   +++ L + YGKDRCGNV
Sbjct: 419 KKWPQFQQLKVNYGKDRCGNV 439

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 115/234 (49%), Gaps = 35/234 (14%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P     ++ + V+ G ++  + F  K   FV+F++  SA  F++++ +
Sbjct: 36  APSRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAIL 95

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVS-LPEYAFKDKFINDPEYKEY 696
           + + + +  +++GW   +   P   +   + GA+RNVY+  LP+                
Sbjct: 96  NRLRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV-------------- 141

Query: 697 HNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTF 756
            ++Y      EL KD S +GE++ V  L+     +++  +I  AI  V ++   N  K +
Sbjct: 142 -SRY------ELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDN--KIY 192

Query: 757 HERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEE 810
            +R         + +GKDRC  V K L   + ++F    ++ +  +R++QL + 
Sbjct: 193 SDRR--------VSFGKDRCAYVTK-LQQSRAAQFLGLPEEDA--VRMEQLRDR 235

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  175 bits (443), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 123/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICN VR G LQ +K   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 407 GNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 466

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            +IL     +VGWG HSGPLP  I+LAV+ GASRNVY+   ++    K           N
Sbjct: 467 GLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFEEDSK----------RN 516

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           + V  TE+ LRK F  +GE+EQ+NFL   +CC+IN+ NI +AI  ++ + S+        
Sbjct: 517 ERVF-TEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKSN-------- 567

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGN+
Sbjct: 568 ---PYFKDLKINFGKDRCGNI 585

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 111/206 (53%), Gaps = 17/206 (8%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      +++ + VR G ++ +K   EK   F++F++ +SA  F++++ +
Sbjct: 166 APSRTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAIL 225

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVS-LPEYAFKDKFINDPEYKEY 696
             + +    +++GWG  +   P   +   T GA+RNVY+  L   A   + +N P+  E 
Sbjct: 226 KRLNIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE- 284

Query: 697 HNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTF 756
                + TEE L  D   +G+++ V  + +    +I+F +I SAIK+V ++ +SN     
Sbjct: 285 -----IVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNLAASN----- 334

Query: 757 HERYANRYKGLIIGYGKDRCGNVNKS 782
             RY   Y+   I YGKDRC  + K+
Sbjct: 335 --RY---YQNRKIFYGKDRCAFITKT 355

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  172 bits (437), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 122/201 (60%), Gaps = 26/201 (12%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICNVVRGG LQ IK   ++  CF+TFI+  +AAQFYA S + 
Sbjct: 354 GNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSLH 413

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +  N  +VGWG HSGPL  +++LA++ GASRN+Y+   ++  K+++ N         
Sbjct: 414 GLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFN--------- 464

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                 EE LR+ F  FGE+EQ+NFL +  CC++NF NI  AI  ++ + S         
Sbjct: 465 ------EEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKS--------- 509

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                ++ L I +GKDRCGN+
Sbjct: 510 --LPEFEDLKINFGKDRCGNI 528

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 109/206 (52%), Gaps = 29/206 (14%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      +++ + VR G ++ +K    K   F++FI+   A  F++++ +
Sbjct: 125 APSRTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAIL 184

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVT-VGASRNVYVSLPEYAFKDKFINDPEYKEY 696
             + +    +++GWG  S  +   ++  +T  GA+RNVY+         +  +DP     
Sbjct: 185 KRLNIRGKDIKIGWGK-SNHIDSIVAARITNDGATRNVYIG--------QLNDDP----- 230

Query: 697 HNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTF 756
                + TE+EL KD   FGE++ + FL++    +++F +I  AI +V++++  N     
Sbjct: 231 ----TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLSKLN----- 281

Query: 757 HERYANRYKGLIIGYGKDRCGNVNKS 782
            E+Y N+     I YGKDRC  + K+
Sbjct: 282 -EKYKNKR----IFYGKDRCAFITKT 302

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  174 bits (440), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 122/201 (60%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICN +RGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 470 GNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 529

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSGPLP  I+LAV+ GASRN+Y+          F  D + +E   
Sbjct: 530 GLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLG------NINFEEDAKQEES-- 581

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              +  E+ LR  F  FG +EQ+NFL + +CC+INF NI +AI  ++ + S+        
Sbjct: 582 ---VFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSN-------- 630

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +  L I +GKDRCGNV
Sbjct: 631 ---PHFNNLKINFGKDRCGNV 648

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 106/207 (51%), Gaps = 19/207 (9%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      + + + VR G ++++K   EK   FV+F++   A  F++++ +
Sbjct: 230 APSRTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAIL 289

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL--PEYAFKDKFINDPEYKE 695
             + +    +++GWG      P   +     GA+RNVY+          +K+  DP    
Sbjct: 290 KRLNIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADP---- 345

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
              K +L T+E+L  D S FGE+E +  + D    +++F +I +AIK V ++ S +    
Sbjct: 346 ---KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGSID---- 398

Query: 756 FHERYANRYKGLIIGYGKDRCGNVNKS 782
               Y+N+     + YGKDRC  + K+
Sbjct: 399 --PYYSNKK----VFYGKDRCAFITKT 419

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  170 bits (431), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICNVVRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 401 GNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSLH 460

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            I +     RVGWG H GPLP +I+LAV+ GASRNVY+   ++ ++D    +P +     
Sbjct: 461 GITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIF----- 514

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                T + LRK F  +GE+EQ+NFL + +C ++N+ NI +AI  ++ + S+        
Sbjct: 515 -----TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSN-------- 561

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCG +
Sbjct: 562 ---PLFKNLKINFGKDRCGTI 579

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 108/207 (52%), Gaps = 19/207 (9%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A  +TVY+GNI P     ++ + VR G ++++K   EK   F+TF++ ++A  F++++ +
Sbjct: 160 APRKTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAIL 219

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL--PEYAFKDKFINDPEYKE 695
             + +    +++GWG  +   P   +   + GA+RNVY+ L   +     +   DP  ++
Sbjct: 220 KRLHIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEK 279

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
                   TEE+LR D   FGE++ V  + +    +I+F +I SA+K+V ++   N    
Sbjct: 280 I-------TEEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLAGIN---- 328

Query: 756 FHERYANRYKGLIIGYGKDRCGNVNKS 782
               Y N+     I YGKDRC  + K+
Sbjct: 329 --PYYENKK----IYYGKDRCAFITKT 349

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  171 bits (432), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 119/201 (59%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 456 GNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSLY 515

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVY+   ++    K            
Sbjct: 516 GFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK-----------K 564

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           +  +  E  LR  F  +GE+EQ+NFL +  CC+INF NI +AI  ++ + S+        
Sbjct: 565 EQPIFNETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKSN-------- 616

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 617 ---PHFKSLKINFGKDRCGNV 634

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 110/205 (53%), Gaps = 21/205 (10%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P    +++ + VR G +++ K   EK   F++F+E +SA  F++++ +
Sbjct: 221 APSRTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAIL 280

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + N  ++VGWG  +   P   S  +  GA+RNVY+            ND   KE  
Sbjct: 281 KRLNIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKE-- 330

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
           NK  L TEE+LR+D   +GE++ +  + +    +++F +I +AIK+V ++   N      
Sbjct: 331 NKEPL-TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNP----- 384

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y+   I YGKDRC  + K+
Sbjct: 385 -----FYQEKKIFYGKDRCAFITKT 404

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  169 bits (428), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQ YA + + 
Sbjct: 386 GNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLH 445

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSG L  +++LAV+ GASRN+Y+   ++   D   + P +     
Sbjct: 446 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSERDVPVF----- 499

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                TE+ LRK F  +GE+EQ+NFL +  CC++NF NI +AI  ++ + S+        
Sbjct: 500 -----TEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSN-------- 546

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
               ++K L I +GKDRCGNV
Sbjct: 547 ---EQFKDLKINFGKDRCGNV 564

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 118/208 (56%), Gaps = 21/208 (10%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P  +  ++ + VR G ++ ++  +EK   F++F++ +SA  F++++ +
Sbjct: 145 APSRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAIL 204

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVT-VGASRNVYVSL--PEYAFKDKFINDPEYK 694
             + +    ++VGWG  + P+   ++ AV+  GA+RNVY+     +     +F  DP   
Sbjct: 205 KRLNIGGRDIKVGWGKPT-PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP--- 260

Query: 695 EYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGK 754
               + ++ TEE+LR D  ++GE+E V  + +    +++F +I SAIK+V S+ + N   
Sbjct: 261 ----RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSLATVN--- 313

Query: 755 TFHERYANRYKGLIIGYGKDRCGNVNKS 782
                Y+N+     I YGKDRC  V K+
Sbjct: 314 ---PYYSNKK----IFYGKDRCAFVTKT 334

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  169 bits (428), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 123/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+G++    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 413 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 472

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVYV   ++A     +ND        
Sbjct: 473 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--SDSLNDER------ 524

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE  LR  F  +GE+EQ+NFL + +CC+IN+ NI +AI  ++ + S+        
Sbjct: 525 ---IFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSN-------- 573

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 574 ---PYFKDLKINFGKDRCGNV 591

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 106/205 (51%), Gaps = 25/205 (12%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A  RTVY+GN+ P    +++ + VR G ++ +K   EK   F++F++ ++A  F++++ +
Sbjct: 182 APTRTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 241

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + +  +++GWG  +   P   +   T GA+RNVY+               E +E H
Sbjct: 242 KRLNIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTV----------EGEESH 291

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
                 +EE+LR D   +GE++ +  + +    +I+F +I +AIK+V ++   N      
Sbjct: 292 -----LSEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRN------ 340

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
             Y N+     I YGKDRC  + K+
Sbjct: 341 PYYQNKR----IFYGKDRCAFITKT 361

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  169 bits (427), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+G++    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 431 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 490

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVYV   +Y      ++D    E   
Sbjct: 491 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDY------VSDSVRDER-- 542

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE +LR  F  +GE+EQ+NFL + +CC+IN+ NI +AI  ++ + S+        
Sbjct: 543 ---IFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSN-------- 591

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 592 ---PYFKDLKINFGKDRCGNV 609

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 106/205 (51%), Gaps = 25/205 (12%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P    +++ + VR G ++ +K   EK   F++F++ ++A  F++++ +
Sbjct: 200 AQSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 259

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + +  +++GWG  +   P   +   T GA+RNVY+               E +E H
Sbjct: 260 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTI----------EGEESH 309

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
                 + E+LR D   +GE++ +  + +    +I+F +I +AIK+V ++   N      
Sbjct: 310 -----LSGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRN------ 358

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
             Y N+     I YGKDRC  + K+
Sbjct: 359 LYYQNKR----IFYGKDRCAFITKT 379

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 121/201 (60%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+G++    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 429 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 488

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVYV          F+ D    E   
Sbjct: 489 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGDSLRDER-- 540

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE  LR  F  +GE+EQ+NFL + +CC+IN+ NI +AI  ++ + S+        
Sbjct: 541 ---VFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSN-------- 589

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 590 ---PYFKDLKINFGKDRCGNV 607

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 106/205 (51%), Gaps = 25/205 (12%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P    +++ + VR G ++ +K   EK   FV+FI+ ++A  F++++ +
Sbjct: 198 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAIL 257

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + +  +++GWG  +   P   +   T GA+RNVY+               E +E H
Sbjct: 258 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTI----------EGEESH 307

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
                 +EE+LR D   +GE++ +  + +    +I+F +I +AIK+V ++   N      
Sbjct: 308 -----LSEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP----- 357

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y+   I YGKDRC  + K+
Sbjct: 358 -----YYQNKRIFYGKDRCAFITKT 377

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  169 bits (427), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 122/201 (60%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+G++    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 442 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 501

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVYV          F++D    E   
Sbjct: 502 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDER-- 553

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE  LR  F  +GE+EQ+NFL + +CC++N+ NI +AI  ++ + S+        
Sbjct: 554 ---IFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKSN-------- 602

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 603 ---PYFKDLKINFGKDRCGNV 620

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 108/205 (52%), Gaps = 25/205 (12%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P    +++ + VR G ++ +K   EK   F++F++ ++A  F++++ +
Sbjct: 211 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAIL 270

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + +  +++GWG  +   P   +   T GA+RNVY+         +   D E  E H
Sbjct: 271 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIDGE--ESH 320

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
                 +EE+LR D   +GE++ +  + +    +I+F +I +AIK+V ++   N      
Sbjct: 321 -----LSEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIRN------ 369

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
             Y N+     I YGKDRC  + K+
Sbjct: 370 PYYQNKR----IFYGKDRCAFITKT 390

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  167 bits (424), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICNVVRGG LQ IK   ++ +CFVTFI+  +AAQ YA + + 
Sbjct: 384 GNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASLH 443

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSG L  +++LAV+ GASRN+Y+          F  D E      
Sbjct: 444 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLG------NIDFKADSE-----T 492

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           ++ + TE+ LR  F  FGE+EQ+NFL + +CC++NF NI +AI  ++ + ++        
Sbjct: 493 EHPIFTEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNN-------- 544

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
               ++  L I +GKDRCGNV
Sbjct: 545 ---PQFSDLKINFGKDRCGNV 562

 Score =  114 bits (284), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 114/207 (55%), Gaps = 19/207 (9%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P  +A  + + VR G ++ I+  +EK   F++F++ +SA  F++++ +
Sbjct: 143 APSRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAIL 202

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL--PEYAFKDKFINDPEYKE 695
             + +    +++GWG  +   P   S     GA+RNVY+     + +F  +   DP  + 
Sbjct: 203 KRLNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDE- 261

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
                 + TE++LR D S++GE+E V  + +    +++F +I SAIK+V S+ + N    
Sbjct: 262 ------VVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVN---- 311

Query: 756 FHERYANRYKGLIIGYGKDRCGNVNKS 782
               YAN+     I YGKDRC  + K+
Sbjct: 312 --PYYANKK----IFYGKDRCAFITKT 332

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  167 bits (423), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 122/201 (60%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    + EDICN +R G LQ IK   ++ +CFVTFI+  SAAQFYA S I 
Sbjct: 413 GNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIY 472

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
             +L     +VGWG HSGPL   ++LAV+ GASRNVY+   +      F  D   +E   
Sbjct: 473 GFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNID------FTADGTKRE--- 523

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           +Y   T+  LR+ FS +GE+EQ+NFL   +CC++N+ NI +AI  ++ + ++        
Sbjct: 524 RYF--TDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNN-------- 573

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGN+
Sbjct: 574 ---PTFKNLKINFGKDRCGNI 591

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 117/209 (55%), Gaps = 16/209 (7%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P   A D+ + VR G ++++K   EK   F++F++  S+  F++++ +
Sbjct: 165 APSRTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAIL 224

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAV-TVGASRNVYVSLPEYAFKDKFINDPEYKEY 696
             + +    +++GWG  S PL   I+ +V T GA+RN+++        +K   D +   Y
Sbjct: 225 KRLNIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNK-QKDNDATIY 282

Query: 697 HNK---YVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG 753
           H       + TEE+LRKD   +G+++ +    +    +++F +I SAIK+V ++++SN  
Sbjct: 283 HGSDDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSN-- 340

Query: 754 KTFHERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y ++ K   I YGKDRC  + K+
Sbjct: 341 -----PYYSKKK---IYYGKDRCAFITKT 361

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  165 bits (418), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 114/343 (33%), Positives = 173/343 (50%), Gaps = 51/343 (14%)

Query: 461 PKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSD 520
           PK +  ++ ++++  V   D++RL+ ++ G   C+ +   K    V     L+ +   ++
Sbjct: 312 PKLSSQVSPVDVTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVAN 371

Query: 521 ISNQLNSEFENTRLIHLIWMETINCNLRXXXMLH---QLLRASKH-----QFATSAEIAN 572
           ++N +N  + N +    I+     C        H   Q L          QF+ S  I+N
Sbjct: 372 LAN-INPYYRNKK----IFYGKDRCAFITKTQQHNAAQFLGVQPGMERLVQFSDSELISN 426

Query: 573 TMG-------------GGA---GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKG 616
            +              GG    GNRTVY+GN+    K E+ICNVVRGG LQ +K   ++ 
Sbjct: 427 ALLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRH 486

Query: 617 ICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYV 676
           +CFVTFI+  +AAQFYA S +  I +     RVGWG H G L  +++LAV+ GASRNVYV
Sbjct: 487 VCFVTFIDPTAAAQFYAMSSLHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYV 546

Query: 677 SLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMN 736
               +  +D    DP +          TE  LR  F  +GE+EQ+N+L + +CC++N+ N
Sbjct: 547 GNINFD-EDSKREDPIF----------TESSLRSIFQQWGEVEQINYLPERNCCFVNYTN 595

Query: 737 IRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNV 779
           I +AI  ++ +    G   F        K L I +GKDRCGNV
Sbjct: 596 ISNAILAIDKI---KGHPVF--------KDLKINFGKDRCGNV 627

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 108/212 (50%), Gaps = 28/212 (13%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A ++TVY+GN       +++ + VR G ++ ++   +K   FV+F++ ++A  F++++ +
Sbjct: 207 APSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAIL 266

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVG---ASRNVYV----SLPEYAFKDKFIND 690
             + +    +++GWG    P P    +A  V    A+RNVY+    + P+ + +   ++ 
Sbjct: 267 KRLHIDGRDIKIGWGK---PTPIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPVDV 323

Query: 691 PEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSS 750
            E         + TE++LR D   FGE++ +  + +    +++F +I +AIK V ++ + 
Sbjct: 324 TE--------PVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANI 375

Query: 751 NGGKTFHERYANRYKGLIIGYGKDRCGNVNKS 782
           N            Y+   I YGKDRC  + K+
Sbjct: 376 N----------PYYRNKKIFYGKDRCAFITKT 397

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           +EL+KDFS FG +  ++  ++   C  INF +I+SA+  ++S  ++N     + +YA  +
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNANS--PLNRKYAESW 360

Query: 765 KGLIIGYGKD 774
               IGYGKD
Sbjct: 361 ---TIGYGKD 367

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 708 LRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKG 766
           + +DF  FG +++V   ++   C  +N+ NI SA+K +ES    N     H +Y   YK 
Sbjct: 303 IVEDFGQFGRIQEVTPIISRKLCVAVNYYNILSALKAIESYEDPNS--ELHRKY---YKS 357

Query: 767 LIIGYGKD 774
             I +GKD
Sbjct: 358 WAIWFGKD 365

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           ++LRKDF  FGE+ +++  ++   C  ++F ++RSAI  +ES    +     H++Y   +
Sbjct: 348 KDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALESFGEPDS--FMHKKYNRDW 405

Query: 765 KGLIIGYGKD 774
               + YG+D
Sbjct: 406 ---TMAYGRD 412

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 34/75 (45%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  +++  G +   K + EKG CFV   T  +AA      AN F 
Sbjct: 313 TSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFF- 371

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 372 ----FQGRNLRTGWG 382

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   ++  D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 272 TAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTHDQAALCIVALAN--- 328

Query: 638 DPIILHNNTLRVGWG 652
                   TLR GWG
Sbjct: 329 --FPFQGRTLRTGWG 341

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 13/77 (16%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPI 640
           TVYIGNI   +   D+  +++  G +   K++ EKG CF+ +     AA       +  +
Sbjct: 326 TVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAA-------VCIV 378

Query: 641 ILHN-----NTLRVGWG 652
           +L N       L+ GWG
Sbjct: 379 VLANYPFQGRNLKTGWG 395

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           +EL KDF  FGE+ ++   ++   C  I F +I SA++ +E       G   + +Y   +
Sbjct: 297 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQK--GSYLYNKY---F 351

Query: 765 KGLIIGYGKD 774
           K   I YGKD
Sbjct: 352 KTWTIWYGKD 361

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   ++  D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 315 TAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 371

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 372 --FPFQGRNLRTGWG 384

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 7/50 (14%)

Query: 581 RTVYIGNINPRSKAEDICNV-VRGGTLQQIKFFKEK------GICFVTFI 623
           RTVY+GNI+PR   ED+  + V+ G +++I + ++K      G  F+ F+
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDKVLDTHQGYAFIEFL 56

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
           Anc_8.670 YOR242C
          Length = 364

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 89/208 (42%), Gaps = 29/208 (13%)

Query: 581 RTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGI------CFVTFIEAASAAQFYAN 634
           R +YI +I      + I + + GG L+ +K  K            + F++ A A  F   
Sbjct: 163 RVIYIRDIPSNVSMKSIISQIYGGPLESLKLIKHDESRSRNQDMELVFLKKADATNFLRY 222

Query: 635 SFIDPIILHNNTLRV----GWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFIND 690
           S     + H N  R+    G  ++     K+    +    SR + +         ++   
Sbjct: 223 SRTH--LFHINGKRLYSEPGSNNNLLNSNKAFDSTINNNISRTLIMK--------RYNKT 272

Query: 691 PEYKEYHNKYVLPTE---EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVES 746
            E +E  +K  L      EE+RKDF  FG +  +   ++   C  I++ NI++A+  +++
Sbjct: 273 TEKQEQVSKEFLIDYFDIEEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMKA 332

Query: 747 VNSSNGGKTFHERYANRYKGLIIGYGKD 774
            +  +    FH++Y+  +   ++ YGKD
Sbjct: 333 YD--DPYSEFHKKYSEEW---VVWYGKD 355

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           +EL KDF  FGE+ ++   ++   C  I F +I SA++ +E       G   + +Y   +
Sbjct: 298 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQK--GSYLYNKY---F 352

Query: 765 KGLIIGYGKD 774
           K   I YGKD
Sbjct: 353 KTWTIWYGKD 362

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 6/69 (8%)

Query: 707 ELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYK 765
           EL KDF  FGE+ ++   ++   C  I F +I SA++ +E       G   + +Y   +K
Sbjct: 299 ELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSG--LNNKY---FK 353

Query: 766 GLIIGYGKD 774
              I YGKD
Sbjct: 354 TWTIWYGKD 362

>AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL044C
           (RNA15)
          Length = 266

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 572 NTMGGGAGNRTVYIGNINPRSKAE----DICNVVRGGTLQQIKF----FKEKGICFVTFI 623
           N  G G  +RTVY+G+I P  + E    D+C+ V   T  ++ F     K KG  F+ F 
Sbjct: 2   NKSGNGRPSRTVYLGSI-PYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFK 60

Query: 624 EAASAAQFYANSFIDPIILHNNTLRVGWGDHSG 656
           + A+++    N  ++   L N TL+ G+    G
Sbjct: 61  DLATSSSAVRN--LNGYALGNRTLKCGYTTGGG 91

>Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           +EL KDF  FGE+ ++   ++   C  I F +I SA++ +E       G   + +Y   +
Sbjct: 298 QELEKDFRNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYGQK--GSYINTKY---F 352

Query: 765 KGLIIGYGKD 774
           K   I YGKD
Sbjct: 353 KAWTIWYGKD 362

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPI 640
           T YIGNI   ++  D+  +++  G +   K + EKG CF+ +     AA       +   
Sbjct: 360 TAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVA--LTNF 417

Query: 641 ILHNNTLRVGWG 652
                 LR GWG
Sbjct: 418 PFQGRNLRTGWG 429

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 18/92 (19%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 299 TAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 355

Query: 638 DPIILHNNTLRVGWGD---------HSGPLPK 660
                    LR GWG            GP+P+
Sbjct: 356 --FPFQGRNLRTGWGKEKPTFIPQHQQGPVPQ 385

>KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weakly
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 385

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 12/73 (16%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNG---GKTFHERYA 761
           +++  DF+ FG++ +V+  ++   C  I+F +IRSAI+ + S  +SN    GK F     
Sbjct: 312 QQIIDDFNQFGQVLEVSPLISRKICLQISFHDIRSAIEAMRSYETSNSYINGKYF----- 366

Query: 762 NRYKGLIIGYGKD 774
              K   I YGKD
Sbjct: 367 ---KDWSIWYGKD 376

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 12/85 (14%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           TVYIGNI   +   D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 325 TVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTHEQAAVCIVVLAN--- 381

Query: 638 DPIILHNNTLRVGWGDHSG---PLP 659
                    L+ GWG       P+P
Sbjct: 382 --FPFQGRNLKTGWGKEKSTFMPMP 404

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  + +  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 344 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 400

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 401 --FPFQGRNLRTGWG 413

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  + +  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 348 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 404

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 405 --FPFQGRNLRTGWG 417

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  + +  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 342 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 398

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 399 --FPFQGRNLRTGWG 411

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  + +  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 342 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 398

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 399 --FPFQGRNLRTGWG 411

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 294 TAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 350

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 351 --FPFQGRNLRTGWG 363

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 11/76 (14%)

Query: 582 TVYIGNINPRSKAE-DICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSF 636
           T YIGN+ PR   E D+  +++  G +   K + ++GICF+   T  +AA      AN  
Sbjct: 340 TAYIGNL-PRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHEQAAVCIVALAN-- 396

Query: 637 IDPIILHNNTLRVGWG 652
                L    L+ GWG
Sbjct: 397 ---FPLQGRNLKTGWG 409

>KLLA0C03652g Chr3 (333038..335155) [2118 bp, 705 aa] {ON} some
            similarities with uniprot|Q03388 Saccharomyces cerevisiae
            YDR485C VPS72 Protein of unknown function component of
            the Swr1p complex that incorporates Htz1p into chromatin
            required for vacuolar protein sorting
          Length = 705

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 99/194 (51%), Gaps = 15/194 (7%)

Query: 839  NESEQEEPKISLDGLGMSLSKPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKN 898
            NE+E+E    S+D +  S + PN+EN     +++S  + S+   +++  P RE    N+ 
Sbjct: 300  NENEKES---SVDVINKSETIPNAENELTASSENSSREDSSCPPIVMSTPERE----NEI 352

Query: 899  KKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAP-ATLSRDFQKSSKQLSSDLTNLSTM 957
            +++   K D+ NN    + P + K+L E+S   +P A LS +  +S ++     T   + 
Sbjct: 353  QEETSAKVDVENNTVTTDTPTLDKSLKEASSTESPTAALSVETIESVER-----TQFGSQ 407

Query: 958  DQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSD 1017
             ++D  +  + + + +++  RS+ K   L   +D+ +Q +  ++H TF     I   +S+
Sbjct: 408  -EDDCKQICTESPTLSSAESRSNDKI-VLKEAADISNQNIETVKHITFAETDQISLINSE 465

Query: 1018 EPEFYDENVINAGN 1031
            +P  + ++ + A +
Sbjct: 466  DPPIFVQSSMEATD 479

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 580 NRTVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           N TV++G ++P    +++ +     GT+  +K    KG  FV ++E +SA    A + + 
Sbjct: 326 NTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAET--AITKMQ 383

Query: 639 PIILHNNTLRVGWG 652
              + N+ +R+ WG
Sbjct: 384 GFPIANSRVRLSWG 397

>NDAI0B00760 Chr2 (171634..172377) [744 bp, 247 aa] {ON} Anc_5.30
           YGR272C
          Length = 247

 Score = 33.1 bits (74), Expect = 3.1,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 17/94 (18%)

Query: 234 FTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGP 293
           F +K  ++R+++ +LN  T +     K  DE + ++   +  ++ +DL C++   VNF  
Sbjct: 89  FERKKALRRYKK-ALNELTSA-----KDKDEKKIKATELQ--ERKIDL-CYV---VNFPK 136

Query: 294 IESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDD 327
            E         +Y N KN DD + D+DN  +ND+
Sbjct: 137 TEKYI-----ALYPNTKNEDDSESDSDNKKENDE 165

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 40/96 (41%), Gaps = 18/96 (18%)

Query: 749 SSNGGKTFHER-YANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQL 807
           SS G +   E+     Y  L+   G+ + GN    LISG NS  Y K+KK      L  L
Sbjct: 7   SSAGVEVAEEKPLMKSYGSLLAQLGQQQSGN---GLISGNNSDVYLKLKKLEKEYELLTL 63

Query: 808 EEE--------------RKQEEKNKISNKSINLNSF 829
           +EE              R QEE  +I +  + +  F
Sbjct: 64  QEEYIKDEQRHLKRELLRAQEEVKRIQSVPLVIGQF 99

>TDEL0D04500 Chr4 (825355..826758) [1404 bp, 467 aa] {ON} Anc_3.173
           YDL020C
          Length = 467

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 864 NHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKKQNHRKNDMNNNLNFGNPPPV-SK 922
           N+D KE   S  +I++DI ++ D    +N     +  +   +ND   ++ + NPP   S+
Sbjct: 247 NYDDKE---SSHNITSDIAVVDDEEEDDNMIDEDDLYEPSLRNDRKESVVYNNPPTAESR 303

Query: 923 TLLESSPPLAPATLSRDFQKSSKQ 946
           T  ES+PP+ P   S+  + ++++
Sbjct: 304 TKSESTPPILPVVKSQSSKAATRR 327

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 52/96 (54%), Gaps = 9/96 (9%)

Query: 582 TVYIGNINPRSKAEDICNV-VRGGTLQQIKFFKEK------GICFVTFIEAASAAQFYAN 634
           TVY+GN++P+   E +  + ++ G + +I++ K+K      G  FV F  +   A++ + 
Sbjct: 11  TVYVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQGFAFVEF-NSPQDAEYASK 69

Query: 635 SFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGA 670
              + + L++ TL+V   + +   P S + A+ VGA
Sbjct: 70  CLNNTVRLYDRTLKVRKANGASSSPTSQN-ALDVGA 104

>Skud_11.286 Chr11 (509095..512028) [2934 bp, 977 aa] {ON} YJL129C
           (REAL)
          Length = 977

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 12/110 (10%)

Query: 239 IIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVD-----KSVDLHCFIKKFVNFGP 293
           II  F    + +    Y+ L        TR+  F  VD      S+ +   +  +V+  P
Sbjct: 703 IILDFNSAVVKQVAKGYRALMGLFQSVCTRTAGFNVVDLSKLHPSIQVSYMLMMYVSVLP 762

Query: 294 IE------SVYLINSNGIYDNNKNNDDYDDDNDN-NNDNDDNANNHDTQS 336
           +       +VY   S G+YDN +N  D  D+N   ++D  D ++  DT S
Sbjct: 763 LAISIRRTNVYEEQSLGLYDNGQNGSDATDENGAMDDDRGDESDQSDTAS 812

>SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|P39001 Saccharomyces
           cerevisiae YDR207C UME6 Regulator of both repression and
           induction of early meiotic genes. Ume6p requires Ume4
           for mitotic repression and interacts with and requires
           Ime1p and Rim11p for induction of meiosis-specific
           transcription Ume6p is a C6 zinc finger URS1-binding
           protein.
          Length = 608

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%)

Query: 50  ILQQQQHQQQQHQHQHQHQHQHQHQ 74
           +LQQ    QQ HQ+QH+ QHQH+ +
Sbjct: 303 LLQQTPQMQQAHQNQHKTQHQHRQK 327

>Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to
           Ashbya gossypii AGR010C
          Length = 269

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 11/88 (12%)

Query: 577 GAGNRTVYIGNINPRSKAE----DICNVVRGGTLQQIKF----FKEKGICFVTFIEAASA 628
           G  +RTVY+G+I P  + E    D+C+ V   T  ++ F     K KG  F+ F + A++
Sbjct: 7   GRPSRTVYLGSI-PYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATS 65

Query: 629 AQFYANSFIDPIILHNNTLRVGWGDHSG 656
           +    N  ++   L N TL+ G+    G
Sbjct: 66  SSAVRN--LNGYSLGNRTLKCGYTTGGG 91

>Skud_4.597 Chr4 (1063921..1065417) [1497 bp, 498 aa] {ON} YDR330W
           (REAL)
          Length = 498

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 51  LQQQQHQQQQHQHQH-QHQHQHQHQQPYLNSGYPVYHQGLAGR 92
           LQ++ +QQQQH   + +   + +H+    NSG+P  ++G+ G+
Sbjct: 79  LQREAYQQQQHDEDYVRPPDEARHEVLTENSGFPTSYRGIGGQ 121

>Suva_7.1 Chr7 (1952..2983) [1032 bp, 343 aa] {ON} YNR071C (REAL)
          Length = 343

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 9/58 (15%)

Query: 759 RYANR-YKGLII------GYGKDRCGNVNKSLISGKNSKFYRK--VKKPSYNIRLQQL 807
           RYANR YKG+ +          D CGN N S ISG N K Y    V+ PS ++ + + 
Sbjct: 66  RYANRIYKGVYMLEDGPHKLTVDNCGNANHSSISGFNRKKYTASPVENPSKDVYIAKF 123

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 3/82 (3%)

Query: 572 NTMGGGAGNRTVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFVTFIEAASAAQ 630
           N M  G  + TV++G +NP      +  + +  GT+  +K    K   FV + E   A  
Sbjct: 436 NAMNAGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEA 495

Query: 631 FYANSFIDPIILHNNTLRVGWG 652
             A + +   I+  + +R+ WG
Sbjct: 496 --AINGLQGFIIMGSPIRLSWG 515

>Smik_8.134 Chr8 complement(199313..200452) [1140 bp, 379 aa] {ON}
           YHR063C (REAL)
          Length = 379

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 5/102 (4%)

Query: 606 LQQIKFFKEKGICFVTFIEA--ASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSIS 663
           L + KF KE GI   T+ E       +F  N+ I+P+    + L     D  GP+  SI 
Sbjct: 198 LTEPKFAKEFGIEHTTYQEMLFGQLFKFLVNACINPVTAILDCLNGEMKDDCGPVFTSI- 256

Query: 664 LAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTE 705
           +   +   R  Y   P + ++DKF  + EY E     +L T+
Sbjct: 257 IDECLQILRLAYK--PLFDYRDKFNGNEEYPEMDINSILTTD 296

>Suva_15.252 Chr15 complement(425632..426768) [1137 bp, 378 aa] {ON}
           YHR063C (REAL)
          Length = 378

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 72/169 (42%), Gaps = 14/169 (8%)

Query: 606 LQQIKFFKEKGICFVTFIEAASAA--QFYANSFIDPIILHNNTLRVGWGDHSGPLPKSIS 663
           L + KF KE G+   T+ E  S    +F  N+ I+P+    + +     D  GP+ +SI 
Sbjct: 197 LMEPKFAKEFGMEHSTYQEMLSGQLFKFLVNACINPVTAILDCVNGEMKDSCGPIFRSI- 255

Query: 664 LAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVN- 722
           +   +   R  Y  L EY  ++KF  + EY + +   VL T+  + +      ++   N 
Sbjct: 256 IDECLQILRLAYKPLFEY--REKFGKNDEYPDMNINEVLTTDNMVSEVTRIGCDINARNS 313

Query: 723 --------FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANR 763
                   FL D    +IN   +  A KL    NSS   KT  E  + R
Sbjct: 314 SSMRQDSLFLRDIEIEFINGYVVGLASKLNLDPNSSKVNKTIQEMASLR 362

>Kwal_33.13758 s33 (380210..381925) [1716 bp, 571 aa] {ON} YJL172W
           (CPS1) - 1:1 [contig 112] FULL
          Length = 571

 Score = 32.0 bits (71), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 417 FNQPITSKEGFMNSKLSFLLSPENKRYII---ESVDIINAAERDANLPKNTVILTFLNIS 473
            N P   KE  M   + F+ S    R ++   ++VDIIN   +   LP+ T  L    I 
Sbjct: 356 LNAPFDQKE--MQKMIDFVASDRRTREMLRTSQAVDIINGGVKANALPEVTSFLVNHRID 413

Query: 474 MTVDVMDRIRLERKDSGISKCVFVTFN 500
           +T  V + I    +D GI K +   FN
Sbjct: 414 ITSSVNETI---ERDLGIIKAIAQKFN 437

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 129,684,778
Number of extensions: 7262555
Number of successful extensions: 282860
Number of sequences better than 10.0: 4885
Number of HSP's gapped: 180554
Number of HSP's successfully gapped: 13404
Length of query: 1032
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 912
Effective length of database: 39,721,479
Effective search space: 36225988848
Effective search space used: 36225988848
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)