Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.58.844ON1032103244600.0
TPHA0I002708.844ON103947112821e-159
Kwal_27.102398.844ON91450211191e-136
CAGL0B02365g8.844ON105048211121e-134
KAFR0A028508.844ON104248610691e-128
ZYRO0G14256g8.844ON125926510641e-125
KNAG0G034408.844ON105349210231e-121
TDEL0B005408.844ON111525110141e-119
TBLA0B032808.844ON136224710021e-116
Suva_13.268.844ON11222919701e-113
KLTH0C03784g8.844ON9972339591e-112
SAKL0D01364g8.844ON10822359601e-112
NDAI0E002708.844ON11982499551e-110
Skud_13.248.844ON11282919501e-110
Smik_13.178.844ON11312579501e-110
YML117W (NAB6)8.844ON11342919491e-110
NCAS0B002808.844ON10812389131e-105
ABL122C8.844ON10432448801e-101
Ecym_46158.844ON10672248791e-101
KLLA0D01485g8.844ON11512398293e-93
AFL061C6.183ON5232014571e-47
Ecym_22336.183ON5762014564e-47
NCAS0H010406.183ON6292014542e-46
SAKL0A05280g6.183ON5822014493e-46
TBLA0B052106.183ON7103244536e-46
KNAG0M004306.183ON4432014371e-45
NDAI0F022606.183ON6802014491e-45
Kpol_1002.696.183ON5902054414e-45
KAFR0B066906.183ON5332014375e-45
KLLA0E19031g6.183ON6522014411e-44
KLTH0H04906g6.183ON5692014281e-43
TDEL0G016206.183ON5842014282e-43
CAGL0C01419g6.183ON6392014302e-43
Suva_16.1236.183ON5962014273e-43
Kwal_27.111586.183ON5672014253e-43
Skud_16.946.183ON6142014257e-43
YPL184C (MRN1)6.183ON6122014257e-43
Smik_6.3906.183ON6252014249e-43
TPHA0J022106.183ON5932014221e-42
ZYRO0G08140g6.183ON6323434204e-42
ACR135C8.670ON376701020.001
KAFR0A038308.670ON37466940.016
KLTH0D11088g8.670ON42270910.035
ZYRO0A02398g2.306ON41075830.35
AGR390C2.306ON37875810.55
KAFR0D016608.797ON21255790.61
TPHA0D012108.670ON364208800.70
TPHA0C035202.306ON44277800.79
KLLA0F11275g8.670ON38573790.86
AGR010C4.66ON26695790.87
Suva_8.2928.670ON37070790.96
YOR242C (SSP2)8.670ON37170791.0
Smik_15.4268.670ON37169781.2
Ecym_33442.306ON42175781.2
KLLA0E08779g2.306ON47572781.5
Skud_15.4098.670ON37170771.5
KLTH0E14036g8.797ON20996751.7
SAKL0E07128g2.306ON40193762.1
Kpol_1043.342.306ON44285762.3
Suva_15.2525.334ON378180762.3
Suva_14.3302.306ON45775762.6
Smik_14.3132.306ON45175752.7
Skud_14.3122.306ON45975752.7
TDEL0G023602.306ON40275752.7
YNL016W (PUB1)2.306ON45375752.8
Kwal_33.137581.166ON57187753.7
Smik_8.1345.334ON379102743.9
TBLA0B071702.306ON47076744.2
CAGL0H02123g5.382ON55574726.9
Suva_7.1singletonON34353718.1
Ecym_73444.66ON26990708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.5
         (1032 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...  1722   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   498   e-159
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   435   e-136
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   432   e-134
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   416   e-128
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   414   e-125
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   398   e-121
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   395   e-119
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   390   e-116
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   378   e-113
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   374   e-112
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   374   e-112
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     372   e-110
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   370   e-110
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   370   e-110
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   370   e-110
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     356   e-105
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   343   e-101
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   343   e-101
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   323   3e-93
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   180   1e-47
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   180   4e-47
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   179   2e-46
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   177   3e-46
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   179   6e-46
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   172   1e-45
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    177   1e-45
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   174   4e-45
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   172   5e-45
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   174   1e-44
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   169   1e-43
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   169   2e-43
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   170   2e-43
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   169   3e-43
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   168   3e-43
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   168   7e-43
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   168   7e-43
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   167   9e-43
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   167   1e-42
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   166   4e-42
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    44   0.001
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    41   0.016
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    40   0.035
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...    37   0.35 
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...    36   0.55 
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    35   0.61 
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    35   0.70 
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...    35   0.79 
KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weak...    35   0.86 
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    35   0.87 
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    35   0.96 
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    35   1.0  
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    35   1.2  
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...    35   1.2  
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...    35   1.5  
Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {...    34   1.5  
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    33   1.7  
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...    34   2.1  
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...    34   2.3  
Suva_15.252 Chr15 complement(425632..426768) [1137 bp, 378 aa] {...    34   2.3  
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...    34   2.6  
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...    33   2.7  
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...    33   2.7  
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...    33   2.7  
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...    33   2.8  
Kwal_33.13758 s33 (380210..381925) [1716 bp, 571 aa] {ON} YJL172...    33   3.7  
Smik_8.134 Chr8 complement(199313..200452) [1140 bp, 379 aa] {ON...    33   3.9  
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...    33   4.2  
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    32   6.9  
Suva_7.1 Chr7 (1952..2983) [1032 bp, 343 aa] {ON} YNR071C (REAL)       32   8.1  
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    32   8.3  

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score = 1722 bits (4460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 867/1032 (84%), Positives = 867/1032 (84%)

Query: 1    MAGSPRKNSSNSHVTTXXXXXXXXXXXXXXXXXXXXXXXXXHHNGGHLPILXXXXXXXXX 60
            MAGSPRKNSSNSHVTT                         HHNGGHLPIL         
Sbjct: 1    MAGSPRKNSSNSHVTTQYQQSSQFPASQQQAGSYAQLQQQSHHNGGHLPILQQQQHQQQQ 60

Query: 61   XXXXXXXXXXXXXXXPYLNSGYPVYHQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPN 120
                           PYLNSGYPVYHQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPN
Sbjct: 61   HQHQHQHQHQHQHQQPYLNSGYPVYHQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPN 120

Query: 121  APPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPA 180
            APPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPA
Sbjct: 121  APPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPA 180

Query: 181  PPTINLPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTQKNII 240
            PPTINLPP                                             FTQKNII
Sbjct: 181  PPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNII 240

Query: 241  KRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLI 300
            KRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLI
Sbjct: 241  KRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLI 300

Query: 301  NSNGIYXXXXXXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSE 360
            NSNGIY                           TQSILLSFLSRPICLDFYNSVLQRLSE
Sbjct: 301  NSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSE 360

Query: 361  FKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQP 420
            FKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQP
Sbjct: 361  FKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQP 420

Query: 421  ITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMD 480
            ITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMD
Sbjct: 421  ITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMD 480

Query: 481  RIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNSEFENTRLIHLIWM 540
            RIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNSEFENTRLIHLIWM
Sbjct: 481  RIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNSEFENTRLIHLIWM 540

Query: 541  ETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNV 600
            ETINCNLR   MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNV
Sbjct: 541  ETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNV 600

Query: 601  VRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPK 660
            VRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPK
Sbjct: 601  VRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPK 660

Query: 661  SISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQ 720
            SISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQ
Sbjct: 661  SISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQ 720

Query: 721  VNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVN 780
            VNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVN
Sbjct: 721  VNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVN 780

Query: 781  KSLISGKNSKFYRKVKKPSYNIXXXXXXXXXXXXXXXXXXXXXXXXXXFGIQVETPSQNE 840
            KSLISGKNSKFYRKVKKPSYNI                          FGIQVETPSQNE
Sbjct: 781  KSLISGKNSKFYRKVKKPSYNIRLQQLEEERKQEEKNKISNKSINLNSFGIQVETPSQNE 840

Query: 841  SEQEEPKISLDGLGMSLSKPNSENHDLKXXXXXXXXXXXXXXXXXXPPVRENTKGNKNKK 900
            SEQEEPKISLDGLGMSLSKPNSENHDLK                  PPVRENTKGNKNKK
Sbjct: 841  SEQEEPKISLDGLGMSLSKPNSENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKK 900

Query: 901  QNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQN 960
            QNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQN
Sbjct: 901  QNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQN 960

Query: 961  DMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE 1020
            DMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE
Sbjct: 961  DMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE 1020

Query: 1021 FYDENVINAGNS 1032
            FYDENVINAGNS
Sbjct: 1021 FYDENVINAGNS 1032

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  498 bits (1282), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 260/471 (55%), Positives = 314/471 (66%), Gaps = 42/471 (8%)

Query: 563  QFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTF 622
            QFATSAE+A+ MGGG GNRT++IGNINPRSK EDICNV RGG +QQ+K+ +EK ICFV F
Sbjct: 602  QFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIF 661

Query: 623  IEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYA 682
            I+  +AAQFYANSFIDPIILHNNTL++GWGDH GPLPK+I LAVT GASRNVYVSLPE+A
Sbjct: 662  IDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFA 721

Query: 683  FKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIK 742
            FKDK+INDP YKEYHNKY+LP+E++LR+DFS FGEMEQ+NFL D HCCWINF NIRSAIK
Sbjct: 722  FKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIK 781

Query: 743  LVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802
            LVE V + +    FHERY NRYKGLIIGYGKDRCGNVNKSL+S KNS+++RKVKKPSYNI
Sbjct: 782  LVELVKNEDNN-NFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNI 840

Query: 803  X-XXXXXXXXXXXXXXXXXXXXXXXXXFGIQVETPSQNESEQEEPKISLDGLGMSLSK-- 859
                                        GI   T S N++ QE+  +SL  L ++     
Sbjct: 841  RLQQLEEERKRNDEIKQIDNKRINLDSLGI---TTSPNQNIQEDETLSLAKLKLTSDTGF 897

Query: 860  PNSENH-DLKXXXXXXXXXXXXXXXXXXPPVRENTKGNKNKKQNHRKNDMNNNLNFGNPP 918
             NSEN  D+                        N+ GN  K   +RK    NNL+ G  P
Sbjct: 898  KNSENESDIDDSASNSSTDVELII---------NSPGNGFKSHRNRK-PKPNNLDLGERP 947

Query: 919  PVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKR 978
             V   + ++  P+AP  LS D+ ++                        NT   N   +R
Sbjct: 948  KVDAIVFKADGPMAPNKLSHDYHRT-----------------------HNTRVDNPRSER 984

Query: 979  SSKK-NKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDENVIN 1028
            + K+ +KK++PGSDVMSQYLAQ+QHSTFMYAAN+L AS +EPEFYDEN I+
Sbjct: 985  TRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDENDID 1035

 Score =  243 bits (619), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 223/440 (50%), Gaps = 68/440 (15%)

Query: 86  HQGLAGRDAVAAINMINSQLSNSPGVYYTNQHIPNAPPTP-FDSAYGASLLPSHLLMGSP 144
           HQGL+  D+   IN   SQ  + P  Y++ Q     PP   FD AYG +LLPSH+LM SP
Sbjct: 75  HQGLSQLDS--PINSSYSQYESHP--YHSQQTPLPNPPPTPFDYAYGTTLLPSHILMNSP 130

Query: 145 FVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSAYPAPPTINLPPXXXXXXXXXXXXXXXX 204
           FVSTP   +SY    A PS     N        +P PP I  P                 
Sbjct: 131 FVSTP--NKSYLSFQASPSRGISYNRRNSNQMVFPNPPIITSPHLVGDKSERAKSDNYEK 188

Query: 205 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTQKNIIKRFQENSLNRFTISYKVLPKGNDE 264
                                          +K   + F+E S   + ISY++LPKG+D 
Sbjct: 189 VDTLD-------------------------DEKRNREVFEEESAIAYKISYQILPKGDDT 223

Query: 265 YQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXXXXXXXXXXXXXXXX 324
           Y TRSLLFEN+++S+DLH FI+KFVN+G IESVY++ S   +                  
Sbjct: 224 YHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNS--------------- 268

Query: 325 XXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKY----- 379
                     +SILLSF SR ICLDFYNSVLQ+LSE+KTQLNS +L LSFV L Y     
Sbjct: 269 ---------VKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNI 319

Query: 380 -----KNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSF 434
                K        E+DF   L   ++Y +   GATRS+ +EF++ +   + F+ + L F
Sbjct: 320 NKGNGKISVESQKNETDFE--LTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPF 377

Query: 435 LLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKC 494
           L S  NKRYIIES+ I+N   +D   P + VIL+FLNISM ++V+  IR +     I  C
Sbjct: 378 LSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNC 437

Query: 495 VFVTFNKENPTVPNMKRLSL 514
           ++V+F++    V N  R SL
Sbjct: 438 LYVSFDRTKHAVSNSNRQSL 457

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  435 bits (1119), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 238/502 (47%), Positives = 306/502 (60%), Gaps = 48/502 (9%)

Query: 561  KHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFV 620
            + Q+  +A++A  MGGGAGNRTVYIGNI+PRSK EDICNVVRGG LQ +K+ + K ICFV
Sbjct: 418  QQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFV 477

Query: 621  TFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPE 680
            TFIEAASA QF+ANS I+PI+LH + L+VGWG HSG LP+SISLAVT+GASRNVYVSLPE
Sbjct: 478  TFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPE 537

Query: 681  YAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSA 740
            YAFKDKFI DPEY+ +  K+ LP++++L  DFS FG++E +NFL DGHCCWINFMNI +A
Sbjct: 538  YAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNA 597

Query: 741  IKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSY 800
            IKLVE  N+SN  ++FHE++ NRY+GL IGYGKDRCGNVNK+L+S KNSK+++KVKK SY
Sbjct: 598  IKLVEDANNSN-NESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASY 656

Query: 801  NIXXXXXXXXXXXXXXXXX-----XXXXXXXXXFGIQVETPSQNESEQEEPKISLDGLGM 855
            NI                               FGI V +        EE KI  + L +
Sbjct: 657  NIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQKIEENEL-L 715

Query: 856  SLSKPNSENHDLKXXXXXXXXXXX--------------------------------XXXX 883
             LSKPNS    L                                                
Sbjct: 716  LLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGSSEVDILVSAPGSANTSQL 775

Query: 884  XXXPPVRENTKGNKNKKQNHRKNDMNNNLNFGN-PPPVSKTLLESSPPLAPATLSRDFQK 942
                P +  T  +  KK+  R + ++    F    P VSK  L++ PPLAPA L+  +  
Sbjct: 776  EGGGPTQRTTAASNGKKE--RSSGVSKLHCFSEIAPRVSKASLDAVPPLAPAALNCHYNS 833

Query: 943  SSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHK--RSSKKNKKLLPGSDVMSQYLAQL 1000
            + ++  S   N    D N +S + S+  SK+   K  +S ++N + +PGS+VM+QYLAQL
Sbjct: 834  APRR--SARKNGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQL 891

Query: 1001 QHSTFMYAANILGASSDEPEFY 1022
            QHSTFMYAA+ILG   D+P  +
Sbjct: 892  QHSTFMYAADILGV--DDPNLH 911

 Score =  122 bits (306), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 132/252 (52%), Gaps = 49/252 (19%)

Query: 251 FTISYKVLPK-GN---DEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIY 306
           + +++ +LP+ GN   D+++TRSL F N++  V LH F+  F  F  IESVY+++     
Sbjct: 63  YKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDRE--- 119

Query: 307 XXXXXXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLN 366
                                       QS+L+SFL++  CLDFYN +LQ+LSEFK +L 
Sbjct: 120 ---------------------------QQSVLVSFLTKETCLDFYNGILQKLSEFKKELR 152

Query: 367 SNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEG 426
           S +L+LSF          P   ES   P L   +++++++ GATRS+ +EF   I     
Sbjct: 153 SKELSLSFA--------SPQKVES--GPTLQ-EIKFEVLRAGATRSLGLEFKDEIDFAS- 200

Query: 427 FMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLER 486
            +  K  F       RY+IES++ +N  +       N  I+ F++I+M V+ M+ ++++ 
Sbjct: 201 -LLKKFDF-FDNSGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQT 258

Query: 487 KDS-GISKCVFV 497
            +S G++K  +V
Sbjct: 259 PESFGLTKVSYV 270

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  432 bits (1112), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 234/482 (48%), Positives = 302/482 (62%), Gaps = 52/482 (10%)

Query: 566  TSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEA 625
            TSA IA  MGG A NRTVYIGNINPRSK EDICNVVRGG LQ +KF ++K ICFVTFIEA
Sbjct: 589  TSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEA 648

Query: 626  ASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKD 685
            ++AAQF ANSFIDPI+LH NTLRVGWG+ SGPLPKSI+LAVTVGA+RNVYVSLPEYAFKD
Sbjct: 649  SAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKD 708

Query: 686  KFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVE 745
            KFINDP+YKEYH +Y LP++E+LRKDF+ +GE+EQ+N+L D HCCW+NF+NI SAI+LVE
Sbjct: 709  KFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVE 768

Query: 746  SVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYN--IX 803
             +N +NG + FH+++ NRY+GLII YGKDRCGN+NK+LI+GK SKFY+KVKKPSY+  I 
Sbjct: 769  DINHNNG-EEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIK 827

Query: 804  XXXXXXXXXXXXXXXXXXXXXXXXXFGIQVETPSQNESE--------------------- 842
                                      GI V+    NES+                     
Sbjct: 828  KMEEKRKMQEDNLLSQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQDLESN 887

Query: 843  ---QEEPKISLDG-LGMSLSKPNSENHDLKXXXXXXXXXXXXXXXXXXPPVRENTKGNKN 898
                + P+IS +G +G+ LS   S   D                       +E +  ++ 
Sbjct: 888  DYKSDHPQISSNGPIGIGLSSKKSPIFD-----DISGSDESVISDFENSASKETSSSDRK 942

Query: 899  KKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMD 958
             +  + + D            V KT L  +PP AP+T++  ++K        ++ +  ++
Sbjct: 943  YQTTNSRGDTF----------VPKTNLSHAPPRAPSTINMTYKK--------ISYVPPLN 984

Query: 959  QNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018
                 + D     K   +   +++  + +PGSDVM+QYLAQLQHSTFMYAANILGAS + 
Sbjct: 985  -GQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVET 1043

Query: 1019 PE 1020
             E
Sbjct: 1044 EE 1045

 Score =  147 bits (371), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 146/283 (51%), Gaps = 40/283 (14%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVD-LHCFIKKFVNFGPIESVYLINSNGIYXXX 309
            +I+Y+VLP G+D Y+TRSLLFENV K+ + L  F++  +N+  +ESVY+          
Sbjct: 170 ISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTD----- 224

Query: 310 XXXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSND 369
                                   T  + LSFLSR   LDFYN+ LQRL +FK +L+S  
Sbjct: 225 -------------TPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPK 271

Query: 370 LTLSFVLLKYKNQDRP----------DDEESDFSPALPL----SLEYDIIKRGATRSIAV 415
           L++SFV   Y   +            + E+ +   +  L    +L  +I    ATRSIA+
Sbjct: 272 LSVSFVSFSYVTDEDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAI 331

Query: 416 EFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMT 475
           EF   +     F   KL FL   +NKRYI+E+VDII+A +   + P N VILTF+NI M 
Sbjct: 332 EFYSQVEQDALF--EKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMA 389

Query: 476 VDVMDRIRLERKDSGISKCVFVTF-----NKENPTVPNMKRLS 513
           ++V+D ++       +++C FV+       +E+ T P +  +S
Sbjct: 390 IEVLDYLKANLMTYSVNECFFVSLPGCKSQRESSTTPVLGHIS 432

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (87%)

Query: 120 NAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM 151
           N PPTPFD+AYGASLLPSHLLMGSP +ST  +
Sbjct: 48  NVPPTPFDTAYGASLLPSHLLMGSPMISTTNL 79

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
            Anc_8.844 YML117W
          Length = 1042

 Score =  416 bits (1069), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 229/486 (47%), Positives = 307/486 (63%), Gaps = 35/486 (7%)

Query: 547  LRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTL 606
             R    +H +  + ++Q +TSA++A+ MG  AGNRT+YIGNINPRSKAEDICNVVRGG L
Sbjct: 575  FRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGIL 634

Query: 607  QQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAV 666
            Q IKF + K ICFVTFIEAA+A QFYAN+FIDPI+LH NTL++GWG++SGPLPKSI+LAV
Sbjct: 635  QSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAV 694

Query: 667  TVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLND 726
            T+GASRNVYVSLPE+AFKDK+INDPE+KEYH K+ LP  E+LR DFS +G  EQ+N+L+D
Sbjct: 695  TIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSD 754

Query: 727  GHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISG 786
             HCCW+NFMNI SAIKLVE   ++N    F+E++  RY GL+I YGKDRCGN+NK+LI+G
Sbjct: 755  SHCCWVNFMNISSAIKLVEE--ATNDFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAG 812

Query: 787  KNSKFYRKVKKPSYNIXXXXXXXXXXXXXXXX-XXXXXXXXXXFGIQVETPSQNESEQEE 845
            KNS+FY+  +  ++ +                           +   +ET +Q+  E +E
Sbjct: 813  KNSRFYKIRQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEESKE 872

Query: 846  PK---ISLDGLGMSLSKPNSENHDLKXXXXXXXXXXXXXXXXXXPPVRENTKGNKNKKQN 902
                 + LD LG+SL   N    D+                         T      +++
Sbjct: 873  NDGKFLQLDSLGISLESKNEIADDINDAL---------------------TVDQFENEKS 911

Query: 903  HRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMD---- 958
              KN+   N +F +       L+ +SP  +  T   D   S K ++S  T   T +    
Sbjct: 912  ITKNNGFENTSFHSDSSSDIELIINSPN-SLRTKDNDVLDSEKIINSANTTNRTGNANGY 970

Query: 959  QNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018
            +ND ++N ++      +  R+  +  + +PGSDVM+QYLAQLQHSTFMYAANILGAS +E
Sbjct: 971  KNDYTKNRND--GMRNNRSRNRSRYSRTIPGSDVMAQYLAQLQHSTFMYAANILGASGEE 1028

Query: 1019 PEFYDE 1024
             E+YDE
Sbjct: 1029 -EYYDE 1033

 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 117/282 (41%), Positives = 158/282 (56%), Gaps = 46/282 (16%)

Query: 253 ISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLI-NSNGIYXXXXX 311
           ISY +LPKG+D Y+TRSLLFENVD +++LH FI  FV    IES+YL+ N N        
Sbjct: 183 ISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKND------- 235

Query: 312 XXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLT 371
                                 T  I+LSFLSR ICLDFYN+VLQRL EFK  LNS  L 
Sbjct: 236 --------------------SNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLN 275

Query: 372 LSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEF-----NQPITSKEG 426
           L+FV LKY    R +       P    SLE++I+ R ATRS+A+E      +  I  KE 
Sbjct: 276 LNFVSLKYNKTTRDNQ-----GP----SLEFNIVTRDATRSLAIELCSNENDSLILEKEQ 326

Query: 427 FMNSKLSFLL-SPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLE 485
                L+ +L + ENKRY++ES+D+++  + +    KN  IL+FLNI+M +++MD I++ 
Sbjct: 327 LFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVI 386

Query: 486 RKDSGISKCVFVTFNK--ENPTVPNMKRL-SLVDITSDISNQ 524
                I KC FVT     EN  + N   L S  +I S +S++
Sbjct: 387 SSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNIQSSVSSE 428

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 29/41 (70%), Positives = 35/41 (85%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM 151
            YY    +PNAPPTPFD+AYGA+LLPSHLLMGSPF+S+P +
Sbjct: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  414 bits (1064), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/265 (69%), Positives = 225/265 (84%), Gaps = 3/265 (1%)

Query: 538 IWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDI 597
           I+ME      R   M+  + ++ + QFATSAE+AN+MGGG GNRTVYIGNI+PRSK EDI
Sbjct: 628 IYMEPFG--RRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDI 685

Query: 598 CNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGP 657
           CNVVRGG LQ I+F ++K ICFVTFIEA++A QFY N+FIDPI+LH N L+VGWG HSGP
Sbjct: 686 CNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGP 745

Query: 658 LPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGE 717
           LPKS+SLAVTVGASRNVYVSLP++AFKDK+INDP+Y+ Y ++Y LP EE+LR DF+ FG+
Sbjct: 746 LPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGD 805

Query: 718 MEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCG 777
           +EQ+NFL+DGHCCW+NFMNI SAIKLVE +   N G+ FH+ + NRY+GLIIGYGKDRCG
Sbjct: 806 IEQINFLSDGHCCWVNFMNISSAIKLVEEI-KYNDGEAFHKSFDNRYRGLIIGYGKDRCG 864

Query: 778 NVNKSLISGKNSKFYRKVKKPSYNI 802
           NVNK+LISGKNS+FY+KVKKPSYNI
Sbjct: 865 NVNKNLISGKNSRFYKKVKKPSYNI 889

 Score =  200 bits (508), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 158/279 (56%), Gaps = 58/279 (20%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
           F ++Y++LPKG+DEY+TRSLLFENV+ SVDL+ F+ K+  +GP+ES+Y+           
Sbjct: 215 FVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRN------ 268

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                    S+LLSFLSR ICLD YNSVLQRL+EFKT L S  L
Sbjct: 269 --------------------DKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSL 308

Query: 371 TLSFVLLKY-KNQDRPDDEESDFSPALPL-----------------------------SL 400
           T+SFV LKY K+ D  + +++D S + P+                             SL
Sbjct: 309 TVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASL 368

Query: 401 EYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANL 460
           +YDI+ RGATRS+A+E +     K   ++ +L FL    N+RY++ES+ +INA E   + 
Sbjct: 369 QYDIVNRGATRSVALELDGEY-DKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHF 427

Query: 461 PKNTVILTFLNISMTVDVMDRIR-LERKDSGISKCVFVT 498
           PKN  ILTFLNISM V+V+D +R  E   S   KC FV+
Sbjct: 428 PKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVS 466

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 73/150 (48%), Gaps = 41/150 (27%)

Query: 920  VSKTLLESSPPLAPATLSRDF---------QKSSKQLSSDLTNL---------------- 954
            VS   +  +PP+AP+T+SR++             ++ SSD  N                 
Sbjct: 1110 VSNPSISMNPPIAPSTISRNYSLMMKTQNGHPHPRRDSSDRQNQQQQQQQQQQQQQQQQQ 1169

Query: 955  ---------------STMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQ 999
                           S+ +  D   +    S       R+ ++N K +PGSDVM+QYLAQ
Sbjct: 1170 QQQHQQQQQQQPNPSSSHNSGDRMSSHVGNSRGQQGKGRNKRRNAKAIPGSDVMAQYLAQ 1229

Query: 1000 LQHSTFMYAANILGASSD-EPEFYDENVIN 1028
            LQHSTFMYAANILGA+++ + ++Y++N  N
Sbjct: 1230 LQHSTFMYAANILGATAEGDVDYYEDNTEN 1259

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%)

Query: 126 FDSAYGASLLPSHLLMGSPFVSTPTM 151
           FD+AYG +LLPSHLL+GSPFVS+P +
Sbjct: 87  FDTAYGITLLPSHLLIGSPFVSSPDL 112

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  398 bits (1023), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 217/492 (44%), Positives = 305/492 (61%), Gaps = 36/492 (7%)

Query: 554  HQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFK 613
            H +  + + Q  TS ++A  MG    NRT+YIGNINPRS+AEDICNVVRGG LQ IKF +
Sbjct: 576  HPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIE 635

Query: 614  EKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRN 673
             K ICF+TFIEA++A QFYAN+FIDPI+LH NTL++GWG ++GPLPK I+LAVT+GASRN
Sbjct: 636  AKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRN 695

Query: 674  VYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWIN 733
            VY+SLPE AFKDK+I DP++K YH  + LP +E LRKDF ++G +EQ+N LND HCCW+N
Sbjct: 696  VYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVN 755

Query: 734  FMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYR 793
            FMNI SAI+LVE  ++S     F++ + +RY+GL+I YGKDRCGN+N++L++GK SK+++
Sbjct: 756  FMNISSAIRLVE--DASTKQDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHK 813

Query: 794  KVKKPSYNIXXXXXXXXXXXXXXXXXXXXXXXXXXFGIQVETPSQ-----NESEQEEPKI 848
            KVKK + ++                            I  E P         S +++ ++
Sbjct: 814  KVKKHTRDVRLSQLEEKRRNQDAERREMVNGT-----IPEENPFDAFAINTGSAEKKDEL 868

Query: 849  SLDGLGMSLSKPNSENHDLKXXXXXXXXXXXXXXXXXXPPVR-ENTKGNKNKKQ--NHRK 905
            SLD LG+S+ +  S +                       P+   N  G+ +  +   +  
Sbjct: 869  SLDSLGISIMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINPP 928

Query: 906  NDMNNNLNF--GNP----PPVSKTLLES-------SPPLAPATLSRDFQKSSKQLSSDLT 952
            ND N ++    G+P    PP  K  L +        PPLAP T+SR + ++S    ++L 
Sbjct: 929  NDPNRSVGVLEGDPSTLSPPSDKRKLVALHEVSSPPPPLAPDTISRQYAEASYH--NEL- 985

Query: 953  NLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANIL 1012
             ++  D  D         ++N  H++   +N + +PGSDVM+QYLAQLQHSTFMYAAN+L
Sbjct: 986  -VTGNDHPDTGYG----KAENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVL 1040

Query: 1013 GASSDEPEFYDE 1024
            GAS++  E YD+
Sbjct: 1041 GASNEGTEQYDD 1052

 Score =  150 bits (379), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 132/257 (51%), Gaps = 41/257 (15%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
           F ISYK+LPKG+D Y+TRSLL  N+D  VDLH F+ KFV    +ESVY+           
Sbjct: 160 FEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEG------- 212

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                      LLSFLS  ICL+FYN+VLQRL EFK QL ++ L
Sbjct: 213 -------------------QQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSL 253

Query: 371 TLSFVLLKYKNQDRPDDEESDFSPALP-------LSLEYDIIKR-GATRSIAVEF--NQP 420
            LSFV ++     RP   E                +L +D+  + GATRSIA+EF     
Sbjct: 254 ELSFVSMR----QRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDV 309

Query: 421 ITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMD 480
           I +++  +N KL F LS  N RYI+E + +           KN  I+TFL+I M +++MD
Sbjct: 310 ILTRDELLNKKLKF-LSEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMD 368

Query: 481 RIRLERKDSGISKCVFV 497
            ++L  K   ++K  +V
Sbjct: 369 YLKLNIKQLHLTKFFYV 385

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 44/72 (61%), Gaps = 5/72 (6%)

Query: 119 PNAP-----PTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGR 173
           PN+P     PTPFD+AYGA+LLPSHLLMGSPFVSTP + Q+      + S +   N  G 
Sbjct: 82  PNSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQRKGSHTGMANGTGS 141

Query: 174 LSSAYPAPPTIN 185
           ++     P  IN
Sbjct: 142 MNYYRTDPQIIN 153

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  395 bits (1014), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 172/251 (68%), Positives = 213/251 (84%), Gaps = 1/251 (0%)

Query: 552 MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKF 611
           M   + ++ + Q+ATSAE+A++MGGG GNRTVYIGNI+PRS+ EDICNVVRGG LQ +KF
Sbjct: 563 MTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKF 622

Query: 612 FKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGAS 671
             EK ICFVTF+EA++A QFY N+FIDPI+LH N L+VGWG HSGPLPKSI+LAVTVGAS
Sbjct: 623 LAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGAS 682

Query: 672 RNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCW 731
           RNVYVSLPE+AFKDK+I DP+Y+EY+ K+ LP EE+LR DFS++G++EQ+N+LNDGHCCW
Sbjct: 683 RNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCW 742

Query: 732 INFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKF 791
           +NF NI +AIKLVE V    GG  F++    RY GL+IGYGKDRCGNVNK+ I+GKNS+F
Sbjct: 743 VNFTNISAAIKLVEEVKYEGGG-NFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRF 801

Query: 792 YRKVKKPSYNI 802
           Y+KVKKPS+NI
Sbjct: 802 YKKVKKPSFNI 812

 Score =  300 bits (769), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 179/432 (41%), Positives = 234/432 (54%), Gaps = 86/432 (19%)

Query: 104 QLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM------------ 151
           Q  NS  +YY    + NAPPTPFD+AYG +LLPSHLLMGSPFVS+P +            
Sbjct: 39  QFMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQ 98

Query: 152 -GQSYSQQFARPSPSKGGNSMGRLSSAYPAPPTINLPPXXXXXXXXXXXXXXXXXXXXXX 210
             Q YS      S S  G S G+L++AYP PP++N PP                      
Sbjct: 99  RLQQYSHN---QSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKS--- 152

Query: 211 XXXXXXXXXXXXXXXXXXXXXXXFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSL 270
                                      +  KRF++     F ++Y+VLPKGNDE++TRSL
Sbjct: 153 -----------------------IQSSDASKRFKD----PFILTYRVLPKGNDEFRTRSL 185

Query: 271 LFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXXXXXXXXXXXXXXXXXXXXXX 330
           LFENVD S+DLH F+  F N+GP+ESVYL  S G +                        
Sbjct: 186 LFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDHV----------------------- 222

Query: 331 XXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYK-------NQD 383
                SILLSF S+ ICLDFYNSVLQRLSE+K+ L+S  LTLSFV L+YK       + D
Sbjct: 223 -----SILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDID 277

Query: 384 RPDDEESD-FSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKR 442
           + DD + D F+     SL YD+I RGATRSI + F  P  SK+  ++ KL FL    N R
Sbjct: 278 KEDDSKPDAFNITAAGSLRYDVINRGATRSIMITFKTPC-SKDELIDKKLEFLKKENNTR 336

Query: 443 YIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKE 502
           Y++ES+D++ A E   + P+N  +LTFLNI M V+++D IRL  +   ISKC F++    
Sbjct: 337 YVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISI--- 393

Query: 503 NPTVPNMKRLSL 514
            P +P+ KRLS+
Sbjct: 394 QPQIPDGKRLSV 405

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 71/108 (65%), Gaps = 7/108 (6%)

Query: 926  ESSPPLAPATLSRDFQKSSKQL--SSDLTNLSTMDQNDMSENDSN----TSSKNASHKRS 979
            E++PP+APAT+SR++    KQ      L +      +D S+ +SN    ++ +    +  
Sbjct: 1006 EANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQTRRRRYP 1065

Query: 980  SKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSD-EPEFYDENV 1026
            ++++ K +PGSDVM+QYLAQLQHSTF+YAANILGAS+D +  + DEN 
Sbjct: 1066 NRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDENA 1113

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  390 bits (1002), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 172/247 (69%), Positives = 211/247 (85%), Gaps = 1/247 (0%)

Query: 556  LLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEK 615
            L +  ++ F TS E++  +GGG GNRTVYIGNINPRSK ED+CNVVRGG LQ+I F ++K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 616  GICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVY 675
             ICFVTFIEA +AAQF+AN++IDPI+LH N L+VGWG+HSGPLPKSISLAVT+GA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 676  VSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFM 735
            VSLPE+AFKDKFIN+P+Y++YH  Y LP E +LRKDFS +GE+EQ+N+LNDGHCCWINFM
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 736  NIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKV 795
            NI SAI LVE VN  +G + FH ++  RY GLIIGYGKDRCGNVNK+L++ KNSKF++KV
Sbjct: 981  NINSAITLVEEVNEDDGIR-FHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKV 1039

Query: 796  KKPSYNI 802
            KKP+Y I
Sbjct: 1040 KKPAYQI 1046

 Score =  150 bits (380), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 150/317 (47%), Gaps = 96/317 (30%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
             +SYK+LPKG DE++TRSLL EN+++S+D    +K F+NFGPIESVYLI  N       
Sbjct: 261 LVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLNP------ 314

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                    SILLSF+SR ICLDFYN+VLQRL EFKT+L+S  L
Sbjct: 315 --------------------GSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSL 354

Query: 371 TLSFVLLKYKNQD----------------------------------------------- 383
           TLSFV+LKY+  D                                               
Sbjct: 355 TLSFVILKYEFTDYNHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIED 414

Query: 384 -RPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSK-LSFLLSPENK 441
            R D  + +F      +L+ D++KRGATRS+ ++FN  + SK+  +N K   F+ +  N 
Sbjct: 415 IRNDLNKENFPLTFASALQSDLVKRGATRSLLLKFNG-VVSKDQLINEKLNLFINNNLNN 473

Query: 442 RYIIESVDIINAAE-----------------RDANLPK---NTVILTFLNISMTVDVMDR 481
           RYI+ES+ ++N                     D  + K   N  +LTF NI M ++  D 
Sbjct: 474 RYILESISLVNIENNTKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDY 533

Query: 482 IRLERKDSGISKCVFVT 498
            + +  +  I  C FV+
Sbjct: 534 FKAKLNELNIFDCFFVS 550

 Score = 75.1 bits (183), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 7/102 (6%)

Query: 924  LLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQND--MSEN-----DSNTSSKNASH 976
            +L   PP+A +TL+R ++K+  +  +D     T D  D  +S+      D     +   +
Sbjct: 1248 VLNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKNPFRGPRN 1307

Query: 977  KRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018
            K  ++  +K +PGSDVMSQYL QLQHSTFMYAANILG S+++
Sbjct: 1308 KNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAED 1349

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 3/53 (5%)

Query: 99  NMINSQLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM 151
           NMI+   + +P  Y     IP+APPTPFD +YGA+LLPSHLLMGSPFVSTP +
Sbjct: 85  NMIDHTSALNPTYY---SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNI 134

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  378 bits (970), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 175/291 (60%), Positives = 220/291 (75%), Gaps = 10/291 (3%)

Query: 522 SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581
           SNQ N    + +LI     ++ N  +    + + + ++ +  F  SA++A++MG   GNR
Sbjct: 585 SNQSNGTIVSQQLITAPSPQSPNPQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNR 644

Query: 582 TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641
           T+YIGNINPRS+AEDICNVVRGG LQ IK+  EK ICFVTFIEAASA QFYANSFIDPI+
Sbjct: 645 TIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIV 704

Query: 642 LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701
           LH N LRVGWG +SGPLPKSISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 705 LHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLA 764

Query: 702 LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGK------- 754
           LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N    G        
Sbjct: 765 LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELI 824

Query: 755 ---TFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802
                 E++  RYKGL+I YGKDRCGN+NK+L++GKNS+FY+KVK+PSYNI
Sbjct: 825 PKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNI 875

 Score =  188 bits (478), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 109/262 (41%), Positives = 145/262 (55%), Gaps = 33/262 (12%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
           F I+YK+LP G+D Y+TRSLL ENVD S DLH  +K FV    +ES Y++ S        
Sbjct: 199 FRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIVGSK------- 251

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                    SIL+SFL+R  CL+FYN++LQRLSEFKT L S  L
Sbjct: 252 ------------ETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSL 299

Query: 371 TLSFVLLKYKNQDRP---DDEE----------SDFSPALPLSLEYDIIKRGATRSIAVEF 417
            L FV L Y ++  P   +DEE           D S  +  SL +D+  + ATRSI +EF
Sbjct: 300 NLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEF 359

Query: 418 NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVD 477
             P+   E F   KL FL   +NKRYI+ES+DI++        P+N V+LTFLNI M ++
Sbjct: 360 KSPLEKAELF-KEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIE 418

Query: 478 VMDRIRLERKDSGISKCVFVTF 499
           V+D ++   K  GISKC +V+ 
Sbjct: 419 VLDYLKKYSKKLGISKCFYVSL 440

 Score = 79.3 bits (194), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 4/60 (6%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSY----SQQFARPSPSK 166
            YYTN  +PN PPTPFD+AYGASLLPSHLLMGSPFVS+P M   Y    S +F R + S+
Sbjct: 53  AYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSR 112

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 64/106 (60%), Gaps = 19/106 (17%)

Query: 922  KTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSK---NASHKR 978
            ++ L+ +PP AP+TLS +  K                +N M   D+  +++   N + KR
Sbjct: 1033 RSSLKQAPPRAPSTLSHNHSK----------------KNQMPIQDAGINAEVTDNKTKKR 1076

Query: 979  SSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024
             S    + +PGSDVM+QYLAQ+QHSTFMYAANILGAS+++  + DE
Sbjct: 1077 GSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  374 bits (959), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 167/233 (71%), Positives = 199/233 (85%), Gaps = 1/233 (0%)

Query: 570 IANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAA 629
           +A  MGGG GNRTVYIGNI+PRSK EDICNVVRGG LQ +K+ + K ICFVTFIEAASA 
Sbjct: 504 VATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAV 563

Query: 630 QFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFIN 689
           QF+ANS I+PI+LH N L+VGWG HSG LP+SISLAVT+GASRNVYVSLPE+AFKDKFI 
Sbjct: 564 QFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIK 623

Query: 690 DPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNS 749
           DPEY+E+  K+ LP++E+L +DFS FG++E VNFL DGHCCWINFMNI +AIKLVE  N+
Sbjct: 624 DPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANN 683

Query: 750 SNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802
            N   +FHE++ NRYKGL IGYGKDRCGNVNK+L++ KNSK+++KVKK SYNI
Sbjct: 684 PN-NDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNI 735

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 135/252 (53%), Gaps = 49/252 (19%)

Query: 251 FTISYKVLPK----GNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIY 306
           + + + +LP+    G DEY TRSLLF N++    LH F+ KF  F  +ESVYL++S    
Sbjct: 136 YEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQ--- 192

Query: 307 XXXXXXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLN 366
                                       QS+L+SFL++  CLDFYN VLQ+LSEFK +L 
Sbjct: 193 ---------------------------QQSVLVSFLTKETCLDFYNGVLQKLSEFKKELK 225

Query: 367 SNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEG 426
           S +LTL+F  L+          +    P L   ++ ++++ GATRS+ +EF   +     
Sbjct: 226 SKELTLNFASLR----------DVKTGPTLQ-EIKIEVLRAGATRSLILEFQDKV--DLA 272

Query: 427 FMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLER 486
            ++  L F+++ E  RY++E+++I+NA     +   +  I+ F++I+M ++ ++ ++ + 
Sbjct: 273 LLSKSLGFIVN-EGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQS 331

Query: 487 -KDSGISKCVFV 497
            K +G+ K  +V
Sbjct: 332 NKLAGLIKFRYV 343

 Score = 99.0 bits (245), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 918  PPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSEND-SNTSSKNASH 976
            P VS   L++ PPLAP+TLSR +  +SK  S   +   T +++    ND  +  SK   H
Sbjct: 883  PRVSSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLH 942

Query: 977  KRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDEN 1025
             R  ++  K +PGSDVM+QYLAQLQHSTFMYAANILG    E  FYDEN
Sbjct: 943  PR--RRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDEN 989

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 47/82 (57%), Gaps = 13/82 (15%)

Query: 112 YYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSK-GGNS 170
           YY    +P AP TPFD++YG SLLPSHLLM SPF++TP MG +        SP + GG+ 
Sbjct: 39  YYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSA--------SPHRAGGSR 90

Query: 171 MGRLSSAYPAP----PTINLPP 188
                S+Y  P      + +PP
Sbjct: 91  SSHAQSSYHTPNFGSTQLRMPP 112

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  374 bits (960), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 165/235 (70%), Positives = 201/235 (85%), Gaps = 1/235 (0%)

Query: 568 AEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAAS 627
           A++A+ MGGG GNRTVY+GNINPRSK EDICNVVRGG LQ IKFF+ K +CFVTFIEAA+
Sbjct: 559 AQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAA 618

Query: 628 AAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKF 687
           A QF+AN+ I+PI+LH N L+VGWG H G L +SI+LAVT+GASRNVYVSLPEYAFKDKF
Sbjct: 619 AVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKF 678

Query: 688 INDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESV 747
           I DPE++E+  KY LP++E+LR+DFS FGE+EQ+N+L+DGHCCW+NFMNI SAIKLVE  
Sbjct: 679 IKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDA 738

Query: 748 NSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802
           N ++  K FH  Y +RYKGLIIGYGKDRCGNVNK+L++ K S+F++KVKK SY I
Sbjct: 739 NGAD-NKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYKI 792

 Score =  162 bits (411), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 135/248 (54%), Gaps = 26/248 (10%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
           + I++K+LPKG+DEY TRSLL  NV+ S+ LH FI KFV FGPIESVY++          
Sbjct: 183 YVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEE-----EE 237

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                   QSILLSFL++  CLDFYN+VLQ+LS+FK  LNS  L
Sbjct: 238 EEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSL 297

Query: 371 TLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNS 430
           TL+FV L  ++                  +  D++++GATRSIA+EF    T+K+     
Sbjct: 298 TLNFVSLTSED------------------IRDDVLRKGATRSIALEFKNSFTTKQ---LE 336

Query: 431 KLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSG 490
            +  L +  N R+++E +DI+N    + N   +  I+ F++ISM V+    +    +  G
Sbjct: 337 SIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLG 396

Query: 491 ISKCVFVT 498
           IS+  FVT
Sbjct: 397 ISRLFFVT 404

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 68/114 (59%), Gaps = 8/114 (7%)

Query: 915  GNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNA 974
            G P  VS T L++ PPLAP+T+SR +  +S   ++   N    D +         ++ + 
Sbjct: 967  GFPSMVSSTSLDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTHHG 1026

Query: 975  SHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE---FYDEN 1025
             H++S     K +PGS VM+QYLAQLQHSTFMYAANILG ++ + E    YDEN
Sbjct: 1027 RHRKS-----KAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDEN 1075

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (86%)

Query: 112 YYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTP 149
           YY    +P+AP TPFD++YGA+LLPSHLLMGSPF+STP
Sbjct: 57  YYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTP 94

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  372 bits (955), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 209/249 (83%)

Query: 553 LHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFF 612
           ++ ++R  + +F TSA++A++MG   GNRT+YIGN+NPRSKAED+CNVVRGG LQ IK  
Sbjct: 700 MYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLI 759

Query: 613 KEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASR 672
             K ICFVTFIEA++A QFYANSFIDP+ILH NTL++GWG++  PL KSI+LAVT+GASR
Sbjct: 760 ASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASR 819

Query: 673 NVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWI 732
           NVYVSLPE+AFKDKF+NDPEYKE+H KY LP+E++LR DF+ +G +EQ+N+L+D HCCW+
Sbjct: 820 NVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWV 879

Query: 733 NFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFY 792
           NFMNI SAIKLVE VN++    TF +++ +RY GLII YGKDRCGNVN++LIS KNS+ Y
Sbjct: 880 NFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHY 939

Query: 793 RKVKKPSYN 801
           RKVKK S N
Sbjct: 940 RKVKKFSDN 948

 Score =  150 bits (378), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 104/308 (33%), Positives = 149/308 (48%), Gaps = 79/308 (25%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
           F ISYK+LP G+D Y+TRSLLF NV  S+DLH FI  FV +  IES+YLI++        
Sbjct: 185 FVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTD------ 238

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                   +SILLSFLSR ICL FYN+VLQRL+EFKT L S  L
Sbjct: 239 -----------DEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSL 287

Query: 371 TLSFVLLKY---------------------KNQDRPDDEESDFSPALPL--SLEYDIIKR 407
           TL+FV+L Y                     +N++  +  E D+  ++    +L++D+I  
Sbjct: 288 TLNFVILNYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNALKFDLINP 347

Query: 408 GATRSIAVEFNQPITSKEGFMNSKLSFLL-SPENKRYIIESVDIIN-------------- 452
            ATR I +E  +    KE  +N  LSFL+ + +N RYI+ES+D+ N              
Sbjct: 348 DATRFIMIEL-KTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSII 406

Query: 453 -----------AAERDA------------NLPKNTVILTFLNISMTVDVMDRIRLERKDS 489
                        E+D               P +  +L+F+NI M +++ D ++L     
Sbjct: 407 EAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKH 466

Query: 490 GISKCVFV 497
           GI+   +V
Sbjct: 467 GITNASYV 474

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 47/78 (60%), Gaps = 7/78 (8%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPT----MGQSYSQQF---ARPS 163
            YY    +PNAPPTPFD+AYGA+LLPSHLLMGSP+VSTP       Q  SQ F     P+
Sbjct: 72  AYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPA 131

Query: 164 PSKGGNSMGRLSSAYPAP 181
            +    S  +L+S    P
Sbjct: 132 GTPNRKSFSQLNSMLNQP 149

 Score = 72.0 bits (175), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (83%)

Query: 976  HKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024
            H  S+ K ++++PG+DVM+QYL QLQHSTFMYAANILG S+++  +YDE
Sbjct: 1146 HLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDE 1194

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  370 bits (950), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 174/291 (59%), Positives = 219/291 (75%), Gaps = 10/291 (3%)

Query: 522 SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581
           SNQ N      +LI      + N  +    + + + ++ +  F  SA++A++MG   GNR
Sbjct: 591 SNQSNGAVIPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNR 650

Query: 582 TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641
           T+YIGNINPRS+AEDICNVVRGG LQ IK+  EK I FVTFIEA SA QFYANSFIDPI+
Sbjct: 651 TIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIV 710

Query: 642 LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701
           LH N LRVGWG +SGPLPKSISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 711 LHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLA 770

Query: 702 LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSS-----NGGKTF 756
           LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N       +GG+  
Sbjct: 771 LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVI 830

Query: 757 -----HERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802
                 E++  RYKGL+I YGKDRCGN+NK+L++GKNS+FY+KVK+PSYNI
Sbjct: 831 VKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNI 881

 Score =  176 bits (447), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 152/280 (54%), Gaps = 36/280 (12%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
           F I+YK+LP G+D Y+TRSLL ENVD+S DLH  +K FV F  +ES Y ++++       
Sbjct: 196 FRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDND------- 248

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                    S+L+SFL+R  CL+FYN++LQRLSEFK  L S  L
Sbjct: 249 ------------KNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSL 296

Query: 371 TLSFVLLKYKNQ--------DRPDDEESDFSPA-----LPLSLEYDIIKRGATRSIAVEF 417
            L FV L Y+++        ++P + +     A     +  SL +D+  + ATRSI +EF
Sbjct: 297 NLKFVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEF 356

Query: 418 NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVD 477
              +   E F   +L FL   +NKRYI+ES+D++N        P+N  +LTFLNI M V+
Sbjct: 357 KSALEKTELF-RKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVE 415

Query: 478 VMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDI 517
           V+D ++   K   ISKC +V+     P + +  R S+ +I
Sbjct: 416 VLDYLKKFSKSLEISKCFYVSL---TPLMVSSTRSSVANI 452

 Score = 82.0 bits (201), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 52/83 (62%), Gaps = 9/83 (10%)

Query: 95  VAAINMINSQLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQS 154
           V  IN +    S+    YYTN  +PN PPTPFD+AYGASLLPSHLLMGSPFVS+P M   
Sbjct: 37  VDFINGVGQYGSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGG 96

Query: 155 YS---------QQFARPSPSKGG 168
           YS         + ++RP  ++ G
Sbjct: 97  YSPARSSNLKRKAYSRPVSNQNG 119

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 60/103 (58%), Gaps = 14/103 (13%)

Query: 922  KTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSK 981
            ++ L  +PP AP+TLS D  K S+    D  N  T              + N   KR S 
Sbjct: 1040 RSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAET--------------ANNRERKRGSL 1085

Query: 982  KNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024
               + +PGSDVM+QYLAQ+QHSTFMYAANILGAS+++  + +E
Sbjct: 1086 PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  370 bits (950), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 166/257 (64%), Positives = 208/257 (80%), Gaps = 10/257 (3%)

Query: 556 LLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEK 615
           + ++ +  F  SA++A++MG   GNRT+YIGNINPRS+AEDICNVVRGG LQ IK+  EK
Sbjct: 626 ITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEK 685

Query: 616 GICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVY 675
            ICFVTFIEA SA QFYANSFIDPI+LH N LRVGWG +SGPLPKSISLAVT+GASRNVY
Sbjct: 686 RICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVY 745

Query: 676 VSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFM 735
           VSLPE+AFK+KFI+DP+YK+ H    LP  E+LR+DFS +G++EQ+N+L+D HCCWINFM
Sbjct: 746 VSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 805

Query: 736 NIRSAIKLVESVNSSN-----GGKTFH-----ERYANRYKGLIIGYGKDRCGNVNKSLIS 785
           NI SAI LVE +N  +      G+  H     +++  RY+GL+I YGKDRCGN+NK+L++
Sbjct: 806 NISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVA 865

Query: 786 GKNSKFYRKVKKPSYNI 802
           GKNS+FY+KVK+PSYNI
Sbjct: 866 GKNSRFYKKVKRPSYNI 882

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 152/280 (54%), Gaps = 36/280 (12%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
           F I+YK+LP G+D Y+TRSLL ENVD+S DLH  +K FV    +ES Y+I +        
Sbjct: 196 FRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGN-------- 247

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                    SIL+SFL+R  CL+FYN++LQRLSEFKT L S  L
Sbjct: 248 -----------EKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESL 296

Query: 371 TLSFVLLKYKNQDR----PDD------EESDF---SPALPLSLEYDIIKRGATRSIAVEF 417
            L FV L Y  +       DD      E+ D    S  +  SL +D+  + ATRSI VEF
Sbjct: 297 NLKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEF 356

Query: 418 NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVD 477
             P+ S E F N KL FL    NKRYI+ES+DI+N        P+N  +LTFLNI M ++
Sbjct: 357 KSPLKSTELF-NKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIE 415

Query: 478 VMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDI 517
           V+D ++   K  GISKC +V+     P V +  R S+ +I
Sbjct: 416 VLDYLKKYSKKLGISKCFYVSL---APLVISSTRSSVANI 452

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/46 (73%), Positives = 38/46 (82%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYS 156
            YY+N  +PN PPTPFD+AYGASLLPSHLLMGSPFVS+P M   YS
Sbjct: 53  AYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYS 98

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 57/97 (58%), Gaps = 13/97 (13%)

Query: 922  KTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSK 981
            K+ L  +PP AP+TLS +  K ++    D+             N   TS  N    R S 
Sbjct: 1042 KSSLRHAPPRAPSTLSYNRSKKNETPIRDIV-----------PNGETTS--NRKKNRGSF 1088

Query: 982  KNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018
               + +PGSDVM+QYLAQ+QHSTFMYAANILGAS+++
Sbjct: 1089 PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAED 1125

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score =  370 bits (949), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 174/291 (59%), Positives = 217/291 (74%), Gaps = 10/291 (3%)

Query: 522 SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581
           SNQ N      +LI      + N  +    + + + ++ +  F  SA++A++MG   GNR
Sbjct: 594 SNQSNGAIIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNR 653

Query: 582 TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641
           T+YIGNINPRSKAEDICNVVRGG LQ IK+  EK ICFVTFIEA SA QFYANSFIDPI+
Sbjct: 654 TIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIV 713

Query: 642 LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701
           LH N LRVGWG +SGPLPK ISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 714 LHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLS 773

Query: 702 LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNG--------- 752
           LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N  +          
Sbjct: 774 LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVT 833

Query: 753 -GKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802
             +   E++  RYKGL+I YGKDRCGN+NK+LI+GKNS+FY+KVK+PSYNI
Sbjct: 834 LKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNI 884

 Score =  186 bits (473), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 152/280 (54%), Gaps = 36/280 (12%)

Query: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYXXXX 310
           F I+YKVLP G+D Y+TRSLL ENVD S+DLH  +K FV    +ES YLI          
Sbjct: 197 FCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGG------- 249

Query: 311 XXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370
                                    SIL+SFL++  CL+FYN++LQRLSEFKT L S  L
Sbjct: 250 ------------KSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEAL 297

Query: 371 TLSFVLLKYKNQDRP----------DDEESDF---SPALPLSLEYDIIKRGATRSIAVEF 417
            L FV L Y  +  P          + EE+D    S  +  SL ++I  + ATRSI +EF
Sbjct: 298 NLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEF 357

Query: 418 NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVD 477
             P+  K      KL FL   +NKRYI+ES+D++N        P+N  +LTFLNISM ++
Sbjct: 358 KSPV-EKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIE 416

Query: 478 VMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDI 517
           V+D ++   K+ GISKC +V+     P V +  R S+ +I
Sbjct: 417 VLDYLKKYSKNLGISKCFYVSL---APLVVSSARSSVANI 453

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%)

Query: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSY 155
            YYTN  +PN PPTPFD+AYGASL PSHLLMGSPFVS+P M   Y
Sbjct: 53  AYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGY 97

 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (59%), Gaps = 15/104 (14%)

Query: 922  KTLLESSPPLAPATLSRDFQKSSKQLSSDL-TNLSTMDQNDMSENDSNTSSKNASHKRSS 980
            ++ L  +PP AP+TLS +  K+++    D+ TN  T              + N   KR S
Sbjct: 1045 RSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET--------------ANNRKKKRGS 1090

Query: 981  KKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024
                + +PGSDVM+QYLAQ+QHSTFMYAANILGAS+++    DE
Sbjct: 1091 FARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  356 bits (913), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 156/238 (65%), Positives = 198/238 (83%), Gaps = 1/238 (0%)

Query: 565 ATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIE 624
            T++++ N++G  AGNRT+YIGNIN RSK EDICNVVRGG LQ +K+ + K ICF+TFIE
Sbjct: 605 TTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIE 664

Query: 625 AASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFK 684
           A++A  FYANSFIDPI+LHN+TL++GWG++  PLPK+++LAVTVGASRNVYVSLPE+AFK
Sbjct: 665 ASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFK 724

Query: 685 DKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLV 744
           DKFINDPEY+EYH KY LP  ++LR DFS +G +EQ+N+L D HCCW+NF+NI +AI+LV
Sbjct: 725 DKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLV 784

Query: 745 ESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNI 802
           E  ++    K F E++ NRY GLII YGKDRCGNVNKSL+S KNS+FY+KVK  S N+
Sbjct: 785 EDAHNPVESK-FSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNV 841

 Score =  193 bits (491), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 162/277 (58%), Gaps = 27/277 (9%)

Query: 248 LNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYX 307
           L  F +SYK+LP G+D Y+TRSLLFENV  S++LH F+ +FV F PIESVYLIN +    
Sbjct: 174 LQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHD--- 230

Query: 308 XXXXXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNS 367
                                      +SILLSFL+R +CL FYN+VLQRL EFK +L S
Sbjct: 231 -----------------SDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKS 273

Query: 368 NDLTLSFVLLKYKNQDRPDDEESDF--SPAL--PLSLEYDIIKRGATRSIAVEFNQPITS 423
            +L LSFV +KY  QD  ++EE++    P+     S+ +++    ATRSI ++F  P + 
Sbjct: 274 ENLRLSFVSIKY--QDENEEEETNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSE 331

Query: 424 KEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIR 483
           +E F + KL FL    N RYI+ES+D++N  + +   PK+  ILTF+NI M +++ D ++
Sbjct: 332 QELF-DKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLK 390

Query: 484 LERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSD 520
           +     GI  C+FV    +  +  + KR S++   +D
Sbjct: 391 IHGPRYGIQDCMFVQVIPKAVSCVSSKRASIISKDND 427

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/51 (68%), Positives = 40/51 (78%)

Query: 112 YYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARP 162
           YY    +PN PPTPFD+AYGA+LLPSHLLMGSPFV+TPT G S S  F +P
Sbjct: 69  YYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQP 119

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%)

Query: 972  KNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024
            KN     ++ K  +++PGSDVM+QYLAQLQHSTFMYAANILGAS+++  +YDE
Sbjct: 1026 KNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  343 bits (880), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 194/244 (79%), Gaps = 6/244 (2%)

Query: 561 KHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFV 620
           + Q+   A  AN    G  NRTVYIGNI+PRSK EDICNVVRGG LQ IK+   K ICFV
Sbjct: 540 QRQYLAGASQAN----GINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFV 595

Query: 621 TFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPE 680
           TFIE A+A QFYAN+ ++PI+LH N LRVGWG  SG LPK+I+LAVT+GASRNVYVSLPE
Sbjct: 596 TFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPE 655

Query: 681 YAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSA 740
           Y+FK+K+IN+PE+K YH KY LPTEE+LR+DF+ +G++EQ+N+L DGHCCW+NFMNI  A
Sbjct: 656 YSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHA 715

Query: 741 IKLVESVNS--SNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKP 798
           I+LVE  NS      + FH ++  RYK LIIGYGKDRCGNVNK+L + KNS+FY+K+KK 
Sbjct: 716 IRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQ 775

Query: 799 SYNI 802
           SY++
Sbjct: 776 SYSM 779

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/398 (32%), Positives = 194/398 (48%), Gaps = 117/398 (29%)

Query: 118 IPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSA 177
           +P  P TPFD  YGASLLPSH+LMGSPF+STP   Q++   F   +P    +S+    SA
Sbjct: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAH---FHPSTPGHSSHSLHHAQSA 112

Query: 178 ------YPAPPTIN-LPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 230
                 YP PP +  +PP                                          
Sbjct: 113 RSSFLYYPQPPMLKPIPP------------------------------------------ 130

Query: 231 XXXFTQKNIIKRFQENSLNR---FTISYKVLPKGNDEYQTRSLLFENVD--KSVDLHCFI 285
                     +R +  +LN    + I++K+LPKG DEY TRSLL  N++  + +D+H F+
Sbjct: 131 ----------RRKKSVTLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFL 180

Query: 286 KKFVNFGPIESVYLINSNGIYXXXXXXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRP 345
             FV FGP+ES+YL++ N                                SILLSFL++ 
Sbjct: 181 NSFVKFGPVESIYLMDDN-------------------------------HSILLSFLTKA 209

Query: 346 ICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDII 405
            CLDFYN++LQR SEFKT+L+S  L++SFV           DE S F       L+ +++
Sbjct: 210 TCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC---------QDESSWFK-----YLQMNVV 255

Query: 406 KRGATRSIAVEFNQPITS-KEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNT 464
            RGATRS+ VEF   +    E F+  K  +L    ++R+++E +D+INA   + +     
Sbjct: 256 TRGATRSLTVEFEDSVKELNEDFVRLKFPWLFC--SQRFVLERIDLINATTVNQHFGTRY 313

Query: 465 VILTFLNISMTVDVMDRIRL--ERKDSGISKCVFVTFN 500
           +IL F++ISM ++V D ++   +++   IS+  FV  N
Sbjct: 314 MILHFISISMALEVDDFLQQPSQKRQLNISRIQFVNVN 351

 Score = 65.1 bits (157), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 8/105 (7%)

Query: 925  LESSPPLAPATLSRDF-QKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKN 983
            L++ PPLAP+++ +    +  +      T+ S    N  +  ++N  S+    +R   K 
Sbjct: 938  LDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQYNSQTPTNANYKSR----RRRQAKF 993

Query: 984  KKLLPGSDVMSQYLAQLQHSTFMYAANILGASS-DEP--EFYDEN 1025
             K + G DVMSQYL QL HSTF+YA NILGA++  EP   +YD N
Sbjct: 994  SKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSN 1038

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  343 bits (879), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/224 (67%), Positives = 189/224 (84%), Gaps = 2/224 (0%)

Query: 576 GGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANS 635
           GG+ NRTVYIGNI+PRSK EDICNVVRGG LQ IK+   K ICFVTFIEAA+A QFYAN+
Sbjct: 564 GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANA 623

Query: 636 FIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKE 695
            ++PI+LH N LRVGWG  SG LPK+I+LAVT+GASRNVYVSLPEY+FK+K+IN+PE+KE
Sbjct: 624 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKE 683

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVN--SSNGG 753
           YH KY LP+EE+LR+DF+ +G++EQ+N+L+DGHCCW+NFMNI  AI+LVE  N  S    
Sbjct: 684 YHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNL 743

Query: 754 KTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKK 797
           + FH ++  RYK LIIGYGKDRCGNVNK+L + KNS+F++K+KK
Sbjct: 744 EKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKK 787

 Score =  185 bits (470), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 190/390 (48%), Gaps = 108/390 (27%)

Query: 118 IPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSA 177
           +P  P TPFD  YGASLLPSH+LMGSPFVSTP   Q +      PS S   N   R    
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGH----FHPSASSHSNH-SRSFLY 133

Query: 178 YPAPPTIN-LPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTQ 236
           YP PP +  +PP                                                
Sbjct: 134 YPQPPILKPIPPRRR--------------------------------------------- 148

Query: 237 KNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDK--SVDLHCFIKKFVNFGPI 294
               K F  N    + +++K+LPKG DEY TRSLLF N+++  + D+H F+  F+ FGPI
Sbjct: 149 ----KSFSLNHSEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPI 204

Query: 295 ESVYLINSNGIYXXXXXXXXXXXXXXXXXXXXXXXXXXXTQSILLSFLSRPICLDFYNSV 354
           ES+YL++                                + SILLSFL++  CLDFYN++
Sbjct: 205 ESIYLLDD-------------------------------SHSILLSFLTKATCLDFYNNL 233

Query: 355 LQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIA 414
           LQR SEFK++L+S  L++SFV           DE + F       L+ +++ RG TRS+ 
Sbjct: 234 LQRFSEFKSKLHSTKLSVSFVC---------QDETNWFR-----LLQMNVVTRGVTRSLC 279

Query: 415 VEF-NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAE-RDANLPKNTVILTFLNI 472
           +EF +Q +      ++ K+ +L    + R++IE +D++NAA  ++ N     +++ F+ I
Sbjct: 280 IEFEDQSMELTSDLIHEKIPWLFF--SHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICI 337

Query: 473 SMTVDVMDRIRL--ERKDSGISKCVFVTFN 500
           SM ++V + ++   ++K  GISK  FV  N
Sbjct: 338 SMALEVEEYLQQASQKKQLGISKIQFVNVN 367

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 61/111 (54%), Gaps = 5/111 (4%)

Query: 921  SKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNL---STMDQNDMSENDSNTSSKNASHK 977
            S T L+S PPL P+ +++ F   S    S   N    +    N+ S N   +++ N + +
Sbjct: 954  SNTYLDSIPPLVPSPINQHFHDKSLCRGSAHVNDNNNALGGFNNYSYNCGGSNNGNRTRR 1013

Query: 978  RSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASS--DEPEFYDENV 1026
            R   K  K + G DVMSQYL QL HSTF+Y+ NILGA++  D   FYD N 
Sbjct: 1014 RRQAKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVNA 1064

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  323 bits (829), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 183/239 (76%), Gaps = 4/239 (1%)

Query: 552 MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKF 611
           M  Q+ +  ++Q++ S +  N    G  +RTVYIGNINPRSKAEDICNVVRGG LQ IK+
Sbjct: 620 MPPQITQTIQNQYSKSIQAVN---AGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKW 676

Query: 612 FKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGAS 671
              K ICFVTFIE A+A QFYAN+ ++PIILH N L+VGWG + GPLPK+I+LAVTVGAS
Sbjct: 677 VSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGAS 736

Query: 672 RNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCW 731
           RNVYVSLP+ AFKDKFINDP++KEY N+Y +P   +L+ DF  +G MEQVNF +DGHCCW
Sbjct: 737 RNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCW 796

Query: 732 INFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSK 790
           INFMNI SAIKLVE   S      FH++   RY GLIIGYGKDRCGN+N++L+  KN K
Sbjct: 797 INFMNISSAIKLVEEY-SDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854

 Score =  101 bits (251), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 140/302 (46%), Gaps = 44/302 (14%)

Query: 250 RFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLI--------- 300
           +    Y +LPKGND Y++RSLLF NV+  +D+  F++K     PIES+YLI         
Sbjct: 214 KIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDI 273

Query: 301 -----NSNGIYXXXXXXXXXXXXXXXXXXXXXXXXXXXTQSILLS------------FLS 343
                ++N                              T+ I +S            F +
Sbjct: 274 ENLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFT 333

Query: 344 RPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYD 403
           +  CLDFYN++LQR +E K  + S+ L ++FV ++       DDEE         +L+ +
Sbjct: 334 KESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQ-------DDEE------WMANLKMN 380

Query: 404 IIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKN 463
           +I  GATRS+ VEF     + +   ++ L FL +  + +Y++  VD++   ER  N   +
Sbjct: 381 VISLGATRSLYVEFADDSVTSDTIWDT-LPFLKN--SGKYVVIDVDVVTTDERRKNFGLH 437

Query: 464 TVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISN 523
             +L FL+++M ++V +   LE  D  +S+  FVT           +R S + +  + S 
Sbjct: 438 YCLLHFLSVTMALEVKE--LLETGDEAVSRVSFVTPANSADKEMRRRRSSAISLKQEASP 495

Query: 524 QL 525
           Q+
Sbjct: 496 QM 497

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 1/45 (2%)

Query: 981  KKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDEN 1025
            K + K + GSDVM++YL QL H+TF+YAANILGA+ D P FYDE+
Sbjct: 1106 KSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQD-PVFYDED 1149

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 122 PPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQ-QFARPSPSKGGNSMGRLSSAYPA 180
           P TPFD  YG +LLPSHLL+GSPFV+TP  G   S    A   P    N M   +S+Y +
Sbjct: 69  PQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYKS 128

Query: 181 --PPTINLPP 188
             PP   L P
Sbjct: 129 FYPPAPKLRP 138

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  180 bits (457), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 125/201 (62%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 340 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 399

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSGPLP  ++LAV+ GASRN+Y+   ++A   K           +
Sbjct: 400 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKK-----------S 448

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           ++ + TE  LR  F  FGE+EQ+NFL + +CC+INF NI SAI  ++ + S         
Sbjct: 449 QHPIFTEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKS--------- 499

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 500 --IPTFKDLKINFGKDRCGNV 518

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 112/207 (54%), Gaps = 19/207 (9%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P    +++ + VR G ++++K   EK   F++F+E  SA  F++++ +
Sbjct: 100 APSRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAIL 159

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL--PEYAFKDKFINDPEYKE 695
             + + +  +++GWG  +   P   +     GA+RNVY+           ++  DP    
Sbjct: 160 KRLNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLNTNKDICAQWGVDP---- 215

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
             N+ V+ TEE+LR D S FGE+E V  + +    +++F +I +AIK+V ++ + N    
Sbjct: 216 --NEEVI-TEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANIN---- 268

Query: 756 FHERYANRYKGLIIGYGKDRCGNVNKS 782
               YA +     I YGKDRC  + K+
Sbjct: 269 --PYYAQKK----IFYGKDRCAFITKT 289

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  180 bits (456), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 393 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 452

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSGPLP  ++LAV+ GASRN+Y+   ++   D+ +  P +     
Sbjct: 453 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF----- 506

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                TE  LR  F  FGE+EQ+NFL + +CC+INF NI SAI  ++ + S         
Sbjct: 507 -----TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKS--------- 552

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 553 --IPTFKDLKINFGKDRCGNV 571

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 110/209 (52%), Gaps = 23/209 (11%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P     ++ + VR G ++ +K   EK   F++F++  SA  F++++ +
Sbjct: 153 APSRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAIL 212

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDP----EY 693
             + + +  +++GWG  +   P   +     GA+RNVY+         K   +P    ++
Sbjct: 213 KRLNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLG--------KLNTNPKMCAQW 264

Query: 694 KEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG 753
               N+  + TEE+LR D + FGE+E V  + +    +++F +I SAIK+V ++ + N  
Sbjct: 265 GADPNEETI-TEEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANVN-- 321

Query: 754 KTFHERYANRYKGLIIGYGKDRCGNVNKS 782
                 YA +     I YGKDRC  + K+
Sbjct: 322 ----PYYAQKK----IFYGKDRCAFITKT 342

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  179 bits (454), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 126/201 (62%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICNVVRGG LQ +K   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 446 GNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSLH 505

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +     +VGWG HSGPLP +++LAV+ GASRNVY+      F+   + DP       
Sbjct: 506 GLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPR------ 557

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE+ LRK F  +GE+EQ+NFL + +CC+INF NI +AI  ++ + S+        
Sbjct: 558 ---IFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIKSN-------- 606

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                ++ L I +GKDRCGNV
Sbjct: 607 ---PHFEDLKINFGKDRCGNV 624

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 106/206 (51%), Gaps = 23/206 (11%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      +++ + VR G ++ +K   EK   F++F++ +SA  F++++ +
Sbjct: 211 APSRTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAIL 270

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + +    +++GWG  +   P   +  +   A+RNV++        +K  ND   KE  
Sbjct: 271 KRLNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFI-----GHLNKTDNDSCTKE-- 323

Query: 698 NKYVLP-TEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTF 756
                P TE +LR+D   FGE+E V  + +    +++F +I SAIK V ++ S N     
Sbjct: 324 -----PITEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMNP---- 374

Query: 757 HERYANRYKGLIIGYGKDRCGNVNKS 782
                  Y+   I YGKDRC  + K+
Sbjct: 375 ------YYENKKIAYGKDRCAFITKT 394

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  177 bits (449), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 125/201 (62%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICN VRGG LQ +K   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 399 GNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 458

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSG LP +++LAV+ GASRN+YV   ++   D+            
Sbjct: 459 GLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDE-----------T 507

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE+ LR+ F  FGE+EQ+NFL++ +CC+INF NI +AI  ++ +  +        
Sbjct: 508 GETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKCN-------- 559

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L + +GKDRCGNV
Sbjct: 560 ---PYFKNLKVNFGKDRCGNV 577

 Score =  105 bits (263), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 115/209 (55%), Gaps = 23/209 (11%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P   A+ + + VR G ++++K   ++   F++F++ +SA  F++++ +
Sbjct: 158 APSRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAIL 217

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL----PEYAFKDKFINDPEY 693
             + +    ++VGWG  +   P   +   + GA+RNVY+      P+ A   +F  DP  
Sbjct: 218 KRLNIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNE 275

Query: 694 KEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG 753
           +       + +EE+LRKD + FGE+E +  + D    +++F +I SAIK+V ++ S N  
Sbjct: 276 E-------IVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLASVN-- 326

Query: 754 KTFHERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y N+     I YGKDRC  + K+
Sbjct: 327 ----PYYTNKK----IFYGKDRCAFITKT 347

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  179 bits (453), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 168/324 (51%), Gaps = 50/324 (15%)

Query: 480 DRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSDISNQLNSEFENTRLIHLIW 539
           +++R + KD G   CV +  +K    V     LS + + ++++ Q N  ++N R    I+
Sbjct: 408 EKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVVNNLA-QTNPYYQNKR----IF 462

Query: 540 METINCNLRXXXMLH---QLLRAS---KH--QFATSAEIANTM--------------GG- 576
                C        H   Q L      +H  QF+    I+NT+              GG 
Sbjct: 463 YGKDRCAFITKTQQHNAAQFLGVQPGMEHLVQFSDREFISNTLLQQSAAAAAIATSAGGP 522

Query: 577 -GAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANS 635
              GNRTVY+GN+    K ++ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S
Sbjct: 523 NNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMS 582

Query: 636 FIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKE 695
            +  + +     +VGWG HSGPLP  I+LAV+ GASRNVY+   ++    K  N P +  
Sbjct: 583 SLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIF-- 640

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
                   TE  LR  F  +G++EQ+NFL + +CC+INF NI +AI  +E + ++     
Sbjct: 641 --------TELSLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKNNPD--- 689

Query: 756 FHERYANRYKGLIIGYGKDRCGNV 779
                   +K L I +GKDRCGN+
Sbjct: 690 --------FKDLKINFGKDRCGNI 705

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 114/233 (48%), Gaps = 27/233 (11%)

Query: 566 TSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEA 625
           TS    N   G   +RTVY+GNI      +D+ + VR G ++ IK   +K   F++F++ 
Sbjct: 253 TSTLPNNNTFGNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDE 312

Query: 626 ASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVS-------- 677
           +SA  F++++ +  + +    +++GWG  +   P   +  VT GA+RNVY+         
Sbjct: 313 SSALLFHSDAILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNN 372

Query: 678 --------LPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHC 729
                       +  +   +D E K+  +   L TEE+LR+D   +GE++ V  + D   
Sbjct: 373 NTSSSSSSTSPSSPSNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGF 431

Query: 730 CWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKS 782
            +++  +I SAIK+V ++  +N            Y+   I YGKDRC  + K+
Sbjct: 432 AFVHMSSILSAIKVVNNLAQTNP----------YYQNKRIFYGKDRCAFITKT 474

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  172 bits (437), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 121/201 (60%), Gaps = 24/201 (11%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN++ R + E++CNVVRGG LQ +KF  ++ +CFVTF +  +AAQFYA + + 
Sbjct: 263 GNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASLH 322

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +     ++GWG HSGPLP  ++ A++ GASRNVY       F +    DP   E+  
Sbjct: 323 GLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFFE 375

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                 E  LR+  S+FGEMEQVN + +  C ++NF N+ SAI  VE V           
Sbjct: 376 ------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV----------- 418

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
           +   +++ L + YGKDRCGNV
Sbjct: 419 KKWPQFQQLKVNYGKDRCGNV 439

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 100/205 (48%), Gaps = 32/205 (15%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P     ++ + V+ G ++  + F  K   FV+F++  SA  F++++ +
Sbjct: 36  APSRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAIL 95

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVS-LPEYAFKDKFINDPEYKEY 696
           + + + +  +++GW   +   P   +   + GA+RNVY+  LP+                
Sbjct: 96  NRLRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV-------------- 141

Query: 697 HNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTF 756
            ++Y      EL KD S +GE++ V  L+     +++  +I  AI  V ++   N  K +
Sbjct: 142 -SRY------ELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDN--KIY 192

Query: 757 HERYANRYKGLIIGYGKDRCGNVNK 781
            +R         + +GKDRC  V K
Sbjct: 193 SDRR--------VSFGKDRCAYVTK 209

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  177 bits (449), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 129/201 (64%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    + E+ICNVVRGG LQ +K   ++ +CFVTFI+  +AAQF+A S + 
Sbjct: 497 GNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSLH 556

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +     +VGWG HSGPL  +++LAV+ GASRN+Y+   ++A  DK  ++P +     
Sbjct: 557 GLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIF----- 610

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                TE+ LRK FS +GEMEQ+NFL + +CC+INF NI +AI  ++ + S+        
Sbjct: 611 -----TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSN-------- 657

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGN+
Sbjct: 658 ---PVFKDLKINFGKDRCGNI 675

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 110/237 (46%), Gaps = 42/237 (17%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      +++ + VR G ++ +K   EK   F++F++  SA  F++++ +
Sbjct: 219 APSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAIL 278

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVS-LPEYAF---KDKFINDPEY 693
             + ++   +++GWG  +   P   +  +  GA+RNV++  L   +F   K K    P  
Sbjct: 279 KRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPS 338

Query: 694 KEYHNKYVLPTEEE----------------------------LRKDFSYFGEMEQVNFLN 725
           + +     +  E +                            LRKD + FG+++ +  + 
Sbjct: 339 RNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVE 398

Query: 726 DGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKS 782
           D    +I+F +I SAIK V ++NS N          + Y    I YGKDRC  + K+
Sbjct: 399 DKGIAFIHFASITSAIKCVHNLNSMN----------DYYSTKKIFYGKDRCAFITKT 445

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  174 bits (441), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 124/205 (60%), Gaps = 22/205 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICN VR G LQ +K   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 407 GNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 466

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            +IL     +VGWG HSGPLP  I+LAV+ GASRNVY+   ++    K           N
Sbjct: 467 GLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFEEDSK----------RN 516

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           + V  TE+ LRK F  +GE+EQ+NFL   +CC+IN+ NI +AI  ++ + S+        
Sbjct: 517 ERVF-TEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKSN-------- 567

Query: 759 RYANRYKGLIIGYGKDRCGNVNKSL 783
                +K L I +GKDRCGN+   L
Sbjct: 568 ---PYFKDLKINFGKDRCGNIPHQL 589

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 111/206 (53%), Gaps = 17/206 (8%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      +++ + VR G ++ +K   EK   F++F++ +SA  F++++ +
Sbjct: 166 APSRTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAIL 225

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVS-LPEYAFKDKFINDPEYKEY 696
             + +    +++GWG  +   P   +   T GA+RNVY+  L   A   + +N P+  E 
Sbjct: 226 KRLNIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE- 284

Query: 697 HNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTF 756
                + TEE L  D   +G+++ V  + +    +I+F +I SAIK+V ++ +SN     
Sbjct: 285 -----IVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNLAASN----- 334

Query: 757 HERYANRYKGLIIGYGKDRCGNVNKS 782
             RY   Y+   I YGKDRC  + K+
Sbjct: 335 --RY---YQNRKIFYGKDRCAFITKT 355

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  172 bits (437), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 122/201 (60%), Gaps = 26/201 (12%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICNVVRGG LQ IK   ++  CF+TFI+  +AAQFYA S + 
Sbjct: 354 GNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSLH 413

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +  N  +VGWG HSGPL  +++LA++ GASRN+Y+   ++  K+++ N         
Sbjct: 414 GLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFN--------- 464

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                 EE LR+ F  FGE+EQ+NFL +  CC++NF NI  AI  ++ + S         
Sbjct: 465 ------EEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKS--------- 509

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                ++ L I +GKDRCGN+
Sbjct: 510 --LPEFEDLKINFGKDRCGNI 528

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 109/206 (52%), Gaps = 29/206 (14%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      +++ + VR G ++ +K    K   F++FI+   A  F++++ +
Sbjct: 125 APSRTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAIL 184

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVT-VGASRNVYVSLPEYAFKDKFINDPEYKEY 696
             + +    +++GWG  S  +   ++  +T  GA+RNVY+         +  +DP     
Sbjct: 185 KRLNIRGKDIKIGWGK-SNHIDSIVAARITNDGATRNVYIG--------QLNDDP----- 230

Query: 697 HNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTF 756
                + TE+EL KD   FGE++ + FL++    +++F +I  AI +V++++  N     
Sbjct: 231 ----TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLSKLN----- 281

Query: 757 HERYANRYKGLIIGYGKDRCGNVNKS 782
            E+Y N+     I YGKDRC  + K+
Sbjct: 282 -EKYKNKR----IFYGKDRCAFITKT 302

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  174 bits (441), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 122/201 (60%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICN +RGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 470 GNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 529

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSGPLP  I+LAV+ GASRN+Y+          F  D + +E   
Sbjct: 530 GLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLG------NINFEEDAKQEE--- 580

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              +  E+ LR  F  FG +EQ+NFL + +CC+INF NI +AI  ++ + S+        
Sbjct: 581 --SVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSN-------- 630

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +  L I +GKDRCGNV
Sbjct: 631 ---PHFNNLKINFGKDRCGNV 648

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 106/207 (51%), Gaps = 19/207 (9%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI      + + + VR G ++++K   EK   FV+F++   A  F++++ +
Sbjct: 230 APSRTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAIL 289

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL--PEYAFKDKFINDPEYKE 695
             + +    +++GWG      P   +     GA+RNVY+          +K+  DP    
Sbjct: 290 KRLNIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADP---- 345

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
              K +L T+E+L  D S FGE+E +  + D    +++F +I +AIK V ++ S +    
Sbjct: 346 ---KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGSID---- 398

Query: 756 FHERYANRYKGLIIGYGKDRCGNVNKS 782
               Y+N+     + YGKDRC  + K+
Sbjct: 399 --PYYSNKK----VFYGKDRCAFITKT 419

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  169 bits (428), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQ YA + + 
Sbjct: 386 GNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLH 445

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSG L  +++LAV+ GASRN+Y+   ++   D   + P +     
Sbjct: 446 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSERDVPVF----- 499

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                TE+ LRK F  +GE+EQ+NFL +  CC++NF NI +AI  ++ + S+        
Sbjct: 500 -----TEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSN-------- 546

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
               ++K L I +GKDRCGNV
Sbjct: 547 ---EQFKDLKINFGKDRCGNV 564

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 118/208 (56%), Gaps = 21/208 (10%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P  +  ++ + VR G ++ ++  +EK   F++F++ +SA  F++++ +
Sbjct: 145 APSRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAIL 204

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVT-VGASRNVYVSL--PEYAFKDKFINDPEYK 694
             + +    ++VGWG  + P+   ++ AV+  GA+RNVY+     +     +F  DP   
Sbjct: 205 KRLNIGGRDIKVGWGKPT-PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP--- 260

Query: 695 EYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGK 754
               + ++ TEE+LR D  ++GE+E V  + +    +++F +I SAIK+V S+       
Sbjct: 261 ----RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL------A 310

Query: 755 TFHERYANRYKGLIIGYGKDRCGNVNKS 782
           T +  Y+N+     I YGKDRC  V K+
Sbjct: 311 TVNPYYSNKK----IFYGKDRCAFVTKT 334

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  169 bits (428), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICNVVRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 401 GNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSLH 460

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            I +     RVGWG H GPLP +I+LAV+ GASRNVY+   ++ ++D    +P +     
Sbjct: 461 GITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIF----- 514

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
                T + LRK F  +GE+EQ+NFL + +C ++N+ NI +AI  ++ + S+        
Sbjct: 515 -----TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSN-------- 561

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCG +
Sbjct: 562 ---PLFKNLKINFGKDRCGTI 579

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 108/207 (52%), Gaps = 19/207 (9%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A  +TVY+GNI P     ++ + VR G ++++K   EK   F+TF++ ++A  F++++ +
Sbjct: 160 APRKTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAIL 219

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL--PEYAFKDKFINDPEYKE 695
             + +    +++GWG  +   P   +   + GA+RNVY+ L   +     +   DP  ++
Sbjct: 220 KRLHIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEK 279

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
                   TEE+LR D   FGE++ V  + +    +I+F +I SA+K+V ++   N    
Sbjct: 280 I-------TEEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLAGIN---- 328

Query: 756 FHERYANRYKGLIIGYGKDRCGNVNKS 782
               Y N+     I YGKDRC  + K+
Sbjct: 329 --PYYENKK----IYYGKDRCAFITKT 349

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  170 bits (430), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 119/201 (59%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 456 GNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSLY 515

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVY+   ++    K            
Sbjct: 516 GFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK-----------K 564

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           +  +  E  LR  F  +GE+EQ+NFL +  CC+INF NI +AI  ++ + S+        
Sbjct: 565 EQPIFNETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKSN-------- 616

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 617 ---PHFKSLKINFGKDRCGNV 634

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 110/205 (53%), Gaps = 21/205 (10%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P    +++ + VR G +++ K   EK   F++F+E +SA  F++++ +
Sbjct: 221 APSRTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAIL 280

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + N  ++VGWG  +   P   S  +  GA+RNVY+            ND   KE  
Sbjct: 281 KRLNIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKE-- 330

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
           NK  L TEE+LR+D   +GE++ +  + +    +++F +I +AIK+V ++   N      
Sbjct: 331 NKEPL-TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNP----- 384

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y+   I YGKDRC  + K+
Sbjct: 385 -----FYQEKKIFYGKDRCAFITKT 404

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  169 bits (427), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 123/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+G++    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 413 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 472

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVYV   ++A     +ND        
Sbjct: 473 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--SDSLNDER------ 524

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE  LR  F  +GE+EQ+NFL + +CC+IN+ NI +AI  ++ + S+        
Sbjct: 525 ---IFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSN-------- 573

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 574 ---PYFKDLKINFGKDRCGNV 591

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 105/205 (51%), Gaps = 25/205 (12%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A  RTVY+GN+ P    +++ + VR G ++ +K   EK   F++F++ ++A  F++++ +
Sbjct: 182 APTRTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 241

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + +  +++GWG  +   P   +   T GA+RNVY+               E +E H
Sbjct: 242 KRLNIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTV----------EGEESH 291

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
                 +EE+LR D   +GE++ +  + +    +I+F +I +AIK+V ++   N      
Sbjct: 292 -----LSEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP----- 341

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y+   I YGKDRC  + K+
Sbjct: 342 -----YYQNKRIFYGKDRCAFITKT 361

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  168 bits (425), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRT+Y+GN+    K E+ICNVVRGG LQ IK   ++ +CFVTFI+  +AAQ YA + + 
Sbjct: 384 GNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASLH 443

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
            + +HN   ++GWG HSG L  +++LAV+ GASRN+Y+          F  D E      
Sbjct: 444 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLG------NIDFKADSE-----T 492

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           ++ + TE+ LR  F  FGE+EQ+NFL + +CC++NF NI +AI  ++ + ++        
Sbjct: 493 EHPIFTEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNN-------- 544

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
               ++  L I +GKDRCGNV
Sbjct: 545 ---PQFSDLKINFGKDRCGNV 562

 Score =  112 bits (280), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 114/207 (55%), Gaps = 19/207 (9%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P  +A  + + VR G ++ I+  +EK   F++F++ +SA  F++++ +
Sbjct: 143 APSRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAIL 202

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSL--PEYAFKDKFINDPEYKE 695
             + +    +++GWG  +   P   S     GA+RNVY+     + +F  +   DP  + 
Sbjct: 203 KRLNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDE- 261

Query: 696 YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKT 755
                 + TE++LR D S++GE+E V  + +    +++F +I SAIK+V S+ + N    
Sbjct: 262 ------VVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVN---- 311

Query: 756 FHERYANRYKGLIIGYGKDRCGNVNKS 782
               YAN+     I YGKDRC  + K+
Sbjct: 312 --PYYANKK----IFYGKDRCAFITKT 332

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  168 bits (425), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 124/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+G++    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 431 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 490

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVYV   +Y      ++D    E   
Sbjct: 491 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDY------VSDSVRDER-- 542

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE +LR  F  +GE+EQ+NFL + +CC+IN+ NI +AI  ++ + S+        
Sbjct: 543 ---IFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSN-------- 591

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 592 ---PYFKDLKINFGKDRCGNV 609

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 105/205 (51%), Gaps = 25/205 (12%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P    +++ + VR G ++ +K   EK   F++F++ ++A  F++++ +
Sbjct: 200 AQSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 259

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + +  +++GWG  +   P   +   T GA+RNVY+               E +E H
Sbjct: 260 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTI----------EGEESH 309

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
                 + E+LR D   +GE++ +  + +    +I+F +I +AIK+V ++   N      
Sbjct: 310 -----LSGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRN------ 358

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y+   I YGKDRC  + K+
Sbjct: 359 ----LYYQNKRIFYGKDRCAFITKT 379

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  168 bits (425), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 121/201 (60%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+G++    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 429 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 488

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVYV          F+ D    E   
Sbjct: 489 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGDSLRDER-- 540

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE  LR  F  +GE+EQ+NFL + +CC+IN+ NI +AI  ++ + S+        
Sbjct: 541 ---VFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSN-------- 589

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 590 ---PYFKDLKINFGKDRCGNV 607

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 106/205 (51%), Gaps = 25/205 (12%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P    +++ + VR G ++ +K   EK   FV+FI+ ++A  F++++ +
Sbjct: 198 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAIL 257

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + +  +++GWG  +   P   +   T GA+RNVY+               E +E H
Sbjct: 258 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTI----------EGEESH 307

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
                 +EE+LR D   +GE++ +  + +    +I+F +I +AIK+V ++   N      
Sbjct: 308 -----LSEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP----- 357

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y+   I YGKDRC  + K+
Sbjct: 358 -----YYQNKRIFYGKDRCAFITKT 377

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  167 bits (424), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 122/201 (60%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+G++    K E+ICN VRGG LQ IK   ++ +CFVTFI+  +AAQFYA S + 
Sbjct: 442 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 501

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
              +     +VGWG HSGPLP +++LAV+ GASRNVYV          F++D    E   
Sbjct: 502 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDER-- 553

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
              + TE  LR  F  +GE+EQ+NFL + +CC++N+ NI +AI  ++ + S+        
Sbjct: 554 ---IFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKSN-------- 602

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                +K L I +GKDRCGNV
Sbjct: 603 ---PYFKDLKINFGKDRCGNV 620

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 107/205 (52%), Gaps = 25/205 (12%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GN+ P    +++ + VR G ++ +K   EK   F++F++ ++A  F++++ +
Sbjct: 211 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAIL 270

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYH 697
             + + +  +++GWG  +   P   +   T GA+RNVY+         +   D E  E H
Sbjct: 271 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIDGE--ESH 320

Query: 698 NKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFH 757
                 +EE+LR D   +GE++ +  + +    +I+F +I +AIK+V ++   N      
Sbjct: 321 -----LSEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIRNP----- 370

Query: 758 ERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y+   I YGKDRC  + K+
Sbjct: 371 -----YYQNKRIFYGKDRCAFITKT 390

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  167 bits (422), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 123/201 (61%), Gaps = 22/201 (10%)

Query: 579 GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           GNRTVY+GN+    + EDICN +R G LQ IK   ++ +CFVTFI+  SAAQFYA S I 
Sbjct: 413 GNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIY 472

Query: 639 PIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHN 698
             +L     +VGWG HSGPL   ++LAV+ GASRNVY+   +      F  D   +E   
Sbjct: 473 GFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNID------FTADGTKRE--- 523

Query: 699 KYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHE 758
           +Y   T+  LR+ FS +GE+EQ+NFL   +CC++N+ NI +AI  ++ + ++    TF  
Sbjct: 524 RYF--TDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNN---PTF-- 576

Query: 759 RYANRYKGLIIGYGKDRCGNV 779
                 K L I +GKDRCGN+
Sbjct: 577 ------KNLKINFGKDRCGNI 591

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 117/209 (55%), Gaps = 16/209 (7%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A +RTVY+GNI P   A D+ + VR G ++++K   EK   F++F++  S+  F++++ +
Sbjct: 165 APSRTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAIL 224

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAV-TVGASRNVYVSLPEYAFKDKFINDPEYKEY 696
             + +    +++GWG  S PL   I+ +V T GA+RN+++        +K   D +   Y
Sbjct: 225 KRLNIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNK-QKDNDATIY 282

Query: 697 HNK---YVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG 753
           H       + TEE+LRKD   +G+++ +    +    +++F +I SAIK+V ++++SN  
Sbjct: 283 HGSDDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNP- 341

Query: 754 KTFHERYANRYKGLIIGYGKDRCGNVNKS 782
                 Y ++ K   I YGKDRC  + K+
Sbjct: 342 ------YYSKKK---IYYGKDRCAFITKT 361

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  166 bits (420), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 114/343 (33%), Positives = 173/343 (50%), Gaps = 51/343 (14%)

Query: 461 PKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSD 520
           PK +  ++ ++++  V   D++RL+ ++ G   C+ +   K    V     L+ +   ++
Sbjct: 312 PKLSSQVSPVDVTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVAN 371

Query: 521 ISNQLNSEFENTRLIHLIWMETINCNLRXXXMLH---QLLRASKH-----QFATSAEIAN 572
           ++N +N  + N +    I+     C        H   Q L          QF+ S  I+N
Sbjct: 372 LAN-INPYYRNKK----IFYGKDRCAFITKTQQHNAAQFLGVQPGMERLVQFSDSELISN 426

Query: 573 TMG-------------GGA---GNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKG 616
            +              GG    GNRTVY+GN+    K E+ICNVVRGG LQ +K   ++ 
Sbjct: 427 ALLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRH 486

Query: 617 ICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYV 676
           +CFVTFI+  +AAQFYA S +  I +     RVGWG H G L  +++LAV+ GASRNVYV
Sbjct: 487 VCFVTFIDPTAAAQFYAMSSLHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYV 546

Query: 677 SLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMN 736
               +  +D    DP +          TE  LR  F  +GE+EQ+N+L + +CC++N+ N
Sbjct: 547 GNINFD-EDSKREDPIF----------TESSLRSIFQQWGEVEQINYLPERNCCFVNYTN 595

Query: 737 IRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNV 779
           I +AI  ++ +    G   F        K L I +GKDRCGNV
Sbjct: 596 ISNAILAIDKI---KGHPVF--------KDLKINFGKDRCGNV 627

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 108/212 (50%), Gaps = 28/212 (13%)

Query: 578 AGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFI 637
           A ++TVY+GN       +++ + VR G ++ ++   +K   FV+F++ ++A  F++++ +
Sbjct: 207 APSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAIL 266

Query: 638 DPIILHNNTLRVGWGDHSGPLPKSISLAVTVG---ASRNVYV----SLPEYAFKDKFIND 690
             + +    +++GWG    P P    +A  V    A+RNVY+    + P+ + +   ++ 
Sbjct: 267 KRLHIDGRDIKIGWGK---PTPIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPVDV 323

Query: 691 PEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSS 750
            E         + TE++LR D   FGE++ +  + +    +++F +I +AIK V ++ + 
Sbjct: 324 TE--------PVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANI 375

Query: 751 NGGKTFHERYANRYKGLIIGYGKDRCGNVNKS 782
           N            Y+   I YGKDRC  + K+
Sbjct: 376 N----------PYYRNKKIFYGKDRCAFITKT 397

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           +EL+KDFS FG +  ++  ++   C  INF +I+SA+  ++S  ++N     + +YA  +
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNANS--PLNRKYAESW 360

Query: 765 KGLIIGYGKD 774
               IGYGKD
Sbjct: 361 ---TIGYGKD 367

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 710 KDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLI 768
           +DF  FG +++V   ++   C  +N+ NI SA+K +ES    N     H +Y   YK   
Sbjct: 305 EDFGQFGRIQEVTPIISRKLCVAVNYYNILSALKAIESYEDPNS--ELHRKY---YKSWA 359

Query: 769 IGYGKD 774
           I +GKD
Sbjct: 360 IWFGKD 365

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           ++LRKDF  FGE+ +++  ++   C  ++F ++RSAI  +ES    +     H++Y   +
Sbjct: 348 KDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALESFGEPDS--FMHKKYNRDW 405

Query: 765 KGLIIGYGKD 774
               + YG+D
Sbjct: 406 ---TMAYGRD 412

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 34/75 (45%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  +++  G +   K + EKG CFV   T  +AA      AN F 
Sbjct: 313 TSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFF- 371

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 372 ----FQGRNLRTGWG 382

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   ++  D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 272 TAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTHDQAALCIVALAN--- 328

Query: 638 DPIILHNNTLRVGWG 652
                   TLR GWG
Sbjct: 329 --FPFQGRTLRTGWG 341

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 7/55 (12%)

Query: 581 RTVYIGNINPRSKAEDICNV-VRGGTLQQIKFFKEK------GICFVTFIEAASA 628
           RTVY+GNI+PR   ED+  + V+ G +++I + ++K      G  F+ F+  ++ 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDKVLDTHQGYAFIEFLNDSTV 61

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
           Anc_8.670 YOR242C
          Length = 364

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 89/208 (42%), Gaps = 29/208 (13%)

Query: 581 RTVYIGNINPRSKAEDICNVVRGGTLQQIKFFK------EKGICFVTFIEAASAAQFYAN 634
           R +YI +I      + I + + GG L+ +K  K            + F++ A A  F   
Sbjct: 163 RVIYIRDIPSNVSMKSIISQIYGGPLESLKLIKHDESRSRNQDMELVFLKKADATNFLRY 222

Query: 635 SFIDPIILHNNTLRV----GWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFIND 690
           S     + H N  R+    G  ++     K+    +    SR + +         ++   
Sbjct: 223 SRTH--LFHINGKRLYSEPGSNNNLLNSNKAFDSTINNNISRTLIMK--------RYNKT 272

Query: 691 PEYKEYHNKYVLPTE---EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVES 746
            E +E  +K  L      EE+RKDF  FG +  +   ++   C  I++ NI++A+  +++
Sbjct: 273 TEKQEQVSKEFLIDYFDIEEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMKA 332

Query: 747 VNSSNGGKTFHERYANRYKGLIIGYGKD 774
            +  +    FH++Y+  +   ++ YGKD
Sbjct: 333 YD--DPYSEFHKKYSEEW---VVWYGKD 355

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 13/77 (16%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPI 640
           TVYIGNI   +   D+  +++  G +   K++ EKG CF+ +     AA       +  +
Sbjct: 326 TVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAA-------VCIV 378

Query: 641 ILHN-----NTLRVGWG 652
           +L N       L+ GWG
Sbjct: 379 VLANYPFQGRNLKTGWG 395

>KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weakly
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 385

 Score = 35.0 bits (79), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 12/73 (16%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNG---GKTFHERYA 761
           +++  DF+ FG++ +V+  ++   C  I+F +IRSAI+ + S  +SN    GK F     
Sbjct: 312 QQIIDDFNQFGQVLEVSPLISRKICLQISFHDIRSAIEAMRSYETSNSYINGKYF----- 366

Query: 762 NRYKGLIIGYGKD 774
              K   I YGKD
Sbjct: 367 ---KDWSIWYGKD 376

>AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL044C
           (RNA15)
          Length = 266

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 15/95 (15%)

Query: 572 NTMGGGAGNRTVYIGNINPRSKAE----DICNVVRGGTLQQIKFF------KEKGICFVT 621
           N  G G  +RTVY+G+I P  + E    D+C+ V  G +  +K        K KG  F+ 
Sbjct: 2   NKSGNGRPSRTVYLGSI-PYDQTEQQILDLCSNV--GPVTGLKMMFDPQTGKSKGYAFIE 58

Query: 622 FIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSG 656
           F + A+++    N  ++   L N TL+ G+    G
Sbjct: 59  FKDLATSSSAVRN--LNGYALGNRTLKCGYTTGGG 91

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 35.0 bits (79), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           +EL KDF  FGE+ ++   ++   C  I F +I SA++ +E       G   + +Y   +
Sbjct: 297 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQK--GSYLYNKY---F 351

Query: 765 KGLIIGYGKD 774
           K   I YGKD
Sbjct: 352 KTWTIWYGKD 361

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           +EL KDF  FGE+ ++   ++   C  I F +I SA++ +E       G   + +Y   +
Sbjct: 298 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQK--GSYLYNKY---F 352

Query: 765 KGLIIGYGKD 774
           K   I YGKD
Sbjct: 353 KTWTIWYGKD 362

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 6/69 (8%)

Query: 707 ELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYK 765
           EL KDF  FGE+ ++   ++   C  I F +I SA++ +E       G   + +Y   +K
Sbjct: 299 ELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSG--LNNKY---FK 353

Query: 766 GLIIGYGKD 774
              I YGKD
Sbjct: 354 TWTIWYGKD 362

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   ++  D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 315 TAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 371

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 372 --FPFQGRNLRTGWG 384

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPI 640
           T YIGNI   ++  D+  +++  G +   K + EKG CF+ +     AA       +   
Sbjct: 360 TAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVA--LTNF 417

Query: 641 ILHNNTLRVGWG 652
                 LR GWG
Sbjct: 418 PFQGRNLRTGWG 429

>Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 706 EELRKDFSYFGEMEQVN-FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRY 764
           +EL KDF  FGE+ ++   ++   C  I F +I SA++ +E       G   + +Y   +
Sbjct: 298 QELEKDFRNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYGQK--GSYINTKY---F 352

Query: 765 KGLIIGYGKD 774
           K   I YGKD
Sbjct: 353 KAWTIWYGKD 362

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 52/96 (54%), Gaps = 9/96 (9%)

Query: 582 TVYIGNINPRSKAEDICNV-VRGGTLQQIKFFKEK------GICFVTFIEAASAAQFYAN 634
           TVY+GN++P+   E +  + ++ G + +I++ K+K      G  FV F  +   A++ + 
Sbjct: 11  TVYVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQGFAFVEF-NSPQDAEYASK 69

Query: 635 SFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGA 670
              + + L++ TL+V   + +   P S + A+ VGA
Sbjct: 70  CLNNTVRLYDRTLKVRKANGASSSPTSQN-ALDVGA 104

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 18/93 (19%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 299 TAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 355

Query: 638 DPIILHNNTLRVGWGD---------HSGPLPKS 661
                    LR GWG            GP+P+ 
Sbjct: 356 --FPFQGRNLRTGWGKEKPTFIPQHQQGPVPQQ 386

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 12/85 (14%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           TVYIGNI   +   D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 325 TVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTHEQAAVCIVVLAN--- 381

Query: 638 DPIILHNNTLRVGWGDHSG---PLP 659
                    L+ GWG       P+P
Sbjct: 382 --FPFQGRNLKTGWGKEKSTFMPMP 404

>Suva_15.252 Chr15 complement(425632..426768) [1137 bp, 378 aa] {ON}
           YHR063C (REAL)
          Length = 378

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 76/180 (42%), Gaps = 14/180 (7%)

Query: 595 EDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAA--QFYANSFIDPIILHNNTLRVGWG 652
           +D+ N      L + KF KE G+   T+ E  S    +F  N+ I+P+    + +     
Sbjct: 186 QDLANNSLVKLLMEPKFAKEFGMEHSTYQEMLSGQLFKFLVNACINPVTAILDCVNGEMK 245

Query: 653 DHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDF 712
           D  GP+ +SI +   +   R  Y  L EY  ++KF  + EY + +   VL T+  + +  
Sbjct: 246 DSCGPIFRSI-IDECLQILRLAYKPLFEY--REKFGKNDEYPDMNINEVLTTDNMVSEVT 302

Query: 713 SYFGEMEQVN---------FLNDGHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANR 763
               ++   N         FL D    +IN   +  A KL    NSS   KT  E  + R
Sbjct: 303 RIGCDINARNSSSMRQDSLFLRDIEIEFINGYVVGLASKLNLDPNSSKVNKTIQEMASLR 362

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  + +  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 344 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 400

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 401 --FPFQGRNLRTGWG 413

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  + +  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 342 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 398

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 399 --FPFQGRNLRTGWG 411

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  + +  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 348 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 404

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 405 --FPFQGRNLRTGWG 417

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  +++  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 294 TAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 350

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 351 --FPFQGRNLRTGWG 363

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 582 TVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSFI 637
           T YIGNI   +   D+  + +  G +   K + EKG CF+   T  +AA      AN   
Sbjct: 342 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 398

Query: 638 DPIILHNNTLRVGWG 652
                    LR GWG
Sbjct: 399 --FPFQGRNLRTGWG 411

>Kwal_33.13758 s33 (380210..381925) [1716 bp, 571 aa] {ON} YJL172W
           (CPS1) - 1:1 [contig 112] FULL
          Length = 571

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 417 FNQPITSKEGFMNSKLSFLLSPENKRYII---ESVDIINAAERDANLPKNTVILTFLNIS 473
            N P   KE  M   + F+ S    R ++   ++VDIIN   +   LP+ T  L    I 
Sbjct: 356 LNAPFDQKE--MQKMIDFVASDRRTREMLRTSQAVDIINGGVKANALPEVTSFLVNHRID 413

Query: 474 MTVDVMDRIRLERKDSGISKCVFVTFN 500
           +T  V + I    +D GI K +   FN
Sbjct: 414 ITSSVNETI---ERDLGIIKAIAQKFN 437

>Smik_8.134 Chr8 complement(199313..200452) [1140 bp, 379 aa] {ON}
           YHR063C (REAL)
          Length = 379

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 5/102 (4%)

Query: 606 LQQIKFFKEKGICFVTFIEA--ASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSIS 663
           L + KF KE GI   T+ E       +F  N+ I+P+    + L     D  GP+  SI 
Sbjct: 198 LTEPKFAKEFGIEHTTYQEMLFGQLFKFLVNACINPVTAILDCLNGEMKDDCGPVFTSI- 256

Query: 664 LAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTE 705
           +   +   R  Y   P + ++DKF  + EY E     +L T+
Sbjct: 257 IDECLQILRLAYK--PLFDYRDKFNGNEEYPEMDINSILTTD 296

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 11/76 (14%)

Query: 582 TVYIGNINPRSKAE-DICNVVRG-GTLQQIKFFKEKGICFV---TFIEAASAAQFYANSF 636
           T YIGN+ PR   E D+  +++  G +   K + ++GICF+   T  +AA      AN  
Sbjct: 340 TAYIGNL-PRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHEQAAVCIVALAN-- 396

Query: 637 IDPIILHNNTLRVGWG 652
                L    L+ GWG
Sbjct: 397 ---FPLQGRNLKTGWG 409

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 580 NRTVYIGNINPRSKAEDICNVVRG-GTLQQIKFFKEKGICFVTFIEAASAAQFYANSFID 638
           N TV++G ++P    +++ +     GT+  +K    KG  FV ++E +SA    A + + 
Sbjct: 326 NTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAET--AITKMQ 383

Query: 639 PIILHNNTLRVGWG 652
              + N+ +R+ WG
Sbjct: 384 GFPIANSRVRLSWG 397

>Suva_7.1 Chr7 (1952..2983) [1032 bp, 343 aa] {ON} YNR071C (REAL)
          Length = 343

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (56%), Gaps = 9/53 (16%)

Query: 759 RYANR-YKGLII---GYGK---DRCGNVNKSLISGKNSKFYRK--VKKPSYNI 802
           RYANR YKG+ +   G  K   D CGN N S ISG N K Y    V+ PS ++
Sbjct: 66  RYANRIYKGVYMLEDGPHKLTVDNCGNANHSSISGFNRKKYTASPVENPSKDV 118

>Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to
           Ashbya gossypii AGR010C
          Length = 269

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 15/90 (16%)

Query: 577 GAGNRTVYIGNINPRSKAE----DICNVVRGGTLQQIKFF------KEKGICFVTFIEAA 626
           G  +RTVY+G+I P  + E    D+C+ V  G +  +K        K KG  F+ F + A
Sbjct: 7   GRPSRTVYLGSI-PYDQTEQQILDLCSNV--GPVTGLKMMFDPQTGKSKGYAFIEFKDLA 63

Query: 627 SAAQFYANSFIDPIILHNNTLRVGWGDHSG 656
           +++    N  ++   L N TL+ G+    G
Sbjct: 64  TSSSAVRN--LNGYSLGNRTLKCGYTTGGG 91

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,084,572
Number of extensions: 4316870
Number of successful extensions: 21659
Number of sequences better than 10.0: 303
Number of HSP's gapped: 22005
Number of HSP's successfully gapped: 417
Length of query: 1032
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 912
Effective length of database: 39,721,479
Effective search space: 36225988848
Effective search space used: 36225988848
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)