Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.48.846ON29129115760.0
Skud_13.4538.846ON3002975841e-73
YMR281W (GPI12)8.846ON3042995781e-72
Smik_13.4948.846ON3043015623e-70
Suva_13.4708.846ON3032995606e-70
TPHA0I002808.846ON3013015606e-70
NCAS0C003808.846ON2762435472e-68
ZYRO0G14300g8.846ON2802845377e-67
TDEL0B005208.846ON2682785299e-66
TBLA0B033008.846ON3193115312e-65
KAFR0B039608.846ON2782865117e-63
NDAI0K003308.846ON3133095138e-63
KNAG0J002408.846ON2862824701e-56
Kwal_27.102278.846ON2542744418e-53
Ecym_46178.846ON2492784252e-50
ABL120W8.846ON2492764173e-49
KLTH0C03740g8.846ON2542664001e-46
CAGL0M03047g8.846ON3042884031e-46
SAKL0D01320g8.846ON2602863835e-44
KLLA0D01430g8.846ON2632403698e-42
KNAG0C050605.414ON104063760.59
NDAI0C061108.231ON1595101731.4
KNAG0G033108.817ON48696711.7
Ecym_8097na 1ON626165684.8
TDEL0B033108.778ON104981677.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.4
         (291 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   611   0.0  
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   229   1e-73
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   227   1e-72
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   221   3e-70
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   220   6e-70
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   220   6e-70
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   215   2e-68
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   211   7e-67
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   208   9e-66
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   209   2e-65
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   201   7e-63
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   202   8e-63
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   185   1e-56
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   174   8e-53
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   168   2e-50
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   165   3e-49
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   158   1e-46
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   159   1e-46
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   152   5e-44
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   146   8e-42
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    34   0.59 
NDAI0C06110 Chr3 (1409081..1413868) [4788 bp, 1595 aa] {ON}            33   1.4  
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    32   1.7  
Ecym_8097 Chr8 (208496..210376) [1881 bp, 626 aa] {ON} similar t...    31   4.8  
TDEL0B03310 Chr2 complement(589965..593114) [3150 bp, 1049 aa] {...    30   7.2  

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/291 (100%), Positives = 291/291 (100%)

Query: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGSSSVNLVIAHPDDEVM 60
           MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGSSSVNLVIAHPDDEVM
Sbjct: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGSSSVNLVIAHPDDEVM 60

Query: 61  FFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVH 120
           FFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVH
Sbjct: 61  FFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVH 120

Query: 121 QLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHR 180
           QLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHR
Sbjct: 121 QLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHR 180

Query: 181 LIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYV 240
           LIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYV
Sbjct: 181 LIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYV 240

Query: 241 LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLFKGQIIN 291
           LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLFKGQIIN
Sbjct: 241 LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLFKGQIIN 291

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  229 bits (584), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 122/297 (41%), Positives = 180/297 (60%), Gaps = 17/297 (5%)

Query: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGP-GYFSGSSSVNLVIAHPDDEV 59
           +++   V+K  KL  +L   Y++F   I   N   ++    + +  S +NLVIAHPDDEV
Sbjct: 7   VNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEV 66

Query: 60  MFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTV 119
           MFFSP + QL ++ P  V  N+IC SKG N DG   GESR +EL  S ++L++++RPV+V
Sbjct: 67  MFFSPVISQLHSYFPITVPFNIICLSKG-NADG--LGESRVKELNGSAALLLQNERPVSV 123

Query: 120 HQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVH 179
             +D++DG D++WD++S+V  +   I+ S + +   +++TFD +GVSDH NH +CH AV 
Sbjct: 124 QVMDFEDGMDEVWDINSIVSTISQTIDLSNE-QLNQIIVTFDSYGVSDHINHKSCHTAVK 182

Query: 180 RLI-----------EEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTS 228
           RLI           EE P   A  L+S+  N++LKY+ F  EI+K  Y+      K    
Sbjct: 183 RLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQP 242

Query: 229 LNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285
                    + +L NTH++Y++AYA MLNAH+SQVVWFRYGWW  SR  + NE  ++
Sbjct: 243 PTTTTQRS-KLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVY 298

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  227 bits (578), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 183/299 (61%), Gaps = 19/299 (6%)

Query: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRG--PGYFSGSSSVNLVIAHPDDE 58
           +++   ++K  KL  +L   Y++F   I   N   ++   P  + G   +NLVIAHPDDE
Sbjct: 9   VNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKY-GDYEINLVIAHPDDE 67

Query: 59  VMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVT 118
           VMFFSP + QL+++ P  V  N+IC SKG N +G   GE+R REL +S ++L+ ++R V+
Sbjct: 68  VMFFSPIISQLNSYFPRTVPFNIICLSKG-NAEG--LGETRVRELNESAALLLHNERAVS 124

Query: 119 VHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAV 178
           V  +D++DG D+IWD+DS+   L   I+  K++    +++TFD +GVS+H NH +C+ AV
Sbjct: 125 VQVMDFQDGMDEIWDIDSITSSLSQKID-IKNHNLNQIIVTFDSYGVSNHINHKSCYAAV 183

Query: 179 HRLI-----------EEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQT 227
            +L+           E+ P   A  L S+  N++LKY+ F  EI+K  Y+      +   
Sbjct: 184 KKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQ 243

Query: 228 SLNKNMDVPYEYV-LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285
           +L  N     + + L NTH++Y++A+ATMLNAHESQVVWFRYGWW FSR  + NE  ++
Sbjct: 244 ALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVY 302

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  221 bits (562), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 178/301 (59%), Gaps = 23/301 (7%)

Query: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRG--PGYFSGSSSVNLVIAHPDDE 58
           +++   ++K  KL  +L   Y++F   I   N   ++   P  +S    +NL+IAHPDDE
Sbjct: 9   VNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYS-DYQINLIIAHPDDE 67

Query: 59  VMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVT 118
           VMFFSP + QL ++ PN V  N+IC SKG N +G   G++R REL  S ++L+ ++R V+
Sbjct: 68  VMFFSPMISQLHSYFPNTVPFNIICLSKG-NAEG--LGQTRVRELNDSAALLLHNERAVS 124

Query: 119 VHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAV 178
           V  +D++DG +++WD+DS+   L   I  + + +   +++TFD +GVS H NH +CH AV
Sbjct: 125 VQVMDFQDGMNEVWDIDSITSTLSQTIGINNN-ELNQIIVTFDSYGVSGHINHKSCHTAV 183

Query: 179 HRLIEE-----------EPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQT 227
            +LI +            PL  A  L S+  N++LKY+ F  EI++  Y       K   
Sbjct: 184 RKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQ 243

Query: 228 SLNKNMDVPYE---YVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKL 284
           +L    DV  E    +L NTH++YI+A+A MLNAH+SQVVWFRYGWW  SR  + NE  +
Sbjct: 244 ALPS--DVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301

Query: 285 F 285
           +
Sbjct: 302 Y 302

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  220 bits (560), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 119/299 (39%), Positives = 170/299 (56%), Gaps = 28/299 (9%)

Query: 6   FVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGP-GYFSGSSSVNLVIAHPDDEVMFFSP 64
            +FK  KL  +L   Y++F   I   N   ++    +   +S +NLVIAHPDDEVMFFSP
Sbjct: 12  LLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSP 71

Query: 65  TLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLDY 124
            + QL  + P+ V  N++C SKG   D    GE+RA+EL  S  +L+ ++RPV+V  +D+
Sbjct: 72  VISQLHAYFPDTVPFNILCLSKG---DAEGLGETRAKELNDSAVLLLRNERPVSVQVMDF 128

Query: 125 KDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIE- 183
           +DG D++WD+DS+   L   I+ + + K   +++TFD +GVS+H NH +CH AV + I+ 
Sbjct: 129 EDGMDEVWDIDSITSTLSQTIDVNNE-KVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDD 187

Query: 184 ----------EEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYC-------HQRIKGQ 226
                     E     A  L S+  N+ LKY+ F  EI+K  Y                 
Sbjct: 188 YVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPS 247

Query: 227 TSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285
           T+  KN       +L NTHS+YI+A+A MLNAH+SQVVWFRYGWW  SR  + NE  +F
Sbjct: 248 TTTEKN-----GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIF 301

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  220 bits (560), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 122/301 (40%), Positives = 175/301 (58%), Gaps = 23/301 (7%)

Query: 4   MSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGSS----SVNLVIAHPDDEV 59
           M  +FK  K Y +L   Y+W    I   N +        + S     SVNL+IAHPDDEV
Sbjct: 1   MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEV 60

Query: 60  MFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEH-----D 114
           MFF+PTL+QLD+ LP  V  NVIC SKGV+VDG   G+ R+ E+  S++ML+ H     +
Sbjct: 61  MFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120

Query: 115 RPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYK-RKDLLITFDEHGVSDHPNHIA 173
           R V +HQ +Y+DG D+ WD+  +V D++  I+   +    K  L+TFD  GVS+HPNHIA
Sbjct: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIA 180

Query: 174 CHNAVHRLIEEEPL---FMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIK------ 224
           C++A+  L ++      ++   L S+ +N+ILKYS F   + K   N  + + +      
Sbjct: 181 CYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQ 240

Query: 225 -GQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELK 283
               S++K  D   +    NT   YIMA ++MLN+H SQ+VWFRYGWW FSR  + N+L 
Sbjct: 241 VPFLSMHKEHD---QIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLH 297

Query: 284 L 284
           +
Sbjct: 298 I 298

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  215 bits (547), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 151/243 (62%), Gaps = 17/243 (6%)

Query: 42  FSGSSSVNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRAR 101
           F   +++NLVIAHPDDEVMFF+PTL+QLDN +P  + INVICFS G   D    GE R  
Sbjct: 49  FHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNG---DAQGLGEKRQH 105

Query: 102 ELKKSVSMLIEHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFD 161
           EL+ S+  LI++ R   V  L ++DG DQIWD+D M   L     P  D++     +TFD
Sbjct: 106 ELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYL-----PQNDHQA---FLTFD 157

Query: 162 EHGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQ 221
            HGVS H NHIACHNAV  L           L+S   +++ KY+FF  ++VK ++N    
Sbjct: 158 SHGVSGHKNHIACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKD 217

Query: 222 RIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANE 281
           + + Q   +  +        FN +S+YI+AY+TMLNAH+SQVVWFRYGWW FSR  ++N 
Sbjct: 218 QQQPQWESHDKI------TFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNH 271

Query: 282 LKL 284
           LK+
Sbjct: 272 LKI 274

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  211 bits (537), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 176/284 (61%), Gaps = 10/284 (3%)

Query: 4   MSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVR-GPGYFSGSSSVNLVIAHPDDEVMFF 62
           M    K  K+YFLLW  ++ F+  I+  N         +     S++LV+AHPDDEVMFF
Sbjct: 1   MVVAIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFF 60

Query: 63  SPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHD-RPVTVHQ 121
           +PT+++LD+ LP +V  NV+C SKG        G++R +ELK+SV++L+ +  R   + Q
Sbjct: 61  APTILELDSRLPPNVEFNVVCLSKG---GADELGDTRVQELKESVNLLLANSKRQYQLQQ 117

Query: 122 LDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRL 181
            DY DG ++ WD +S+     T+ +     +R  +L+TFD+ GVS H NHIACH AV  L
Sbjct: 118 HDYPDGHEETWDQESV---QSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNL 174

Query: 182 IEEEP-LFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYV 240
           +++E  +  A  L+S+  N++LKYS F  EI K   ++   R+   +S N+N     E  
Sbjct: 175 VQDESNVKAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPAT-EIT 233

Query: 241 LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKL 284
           L + +S YI+++A+ML++H+SQ+VWFRYGWW FSR  + N+LK+
Sbjct: 234 LMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  208 bits (529), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 165/278 (59%), Gaps = 22/278 (7%)

Query: 9   KAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGS-SSVNLVIAHPDDEVMFFSPTLM 67
           K  KL F L   YV     I G N  Q +      G+  S+ L+IAHPDDEVMFFSP+L+
Sbjct: 9   KVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPSLL 68

Query: 68  QLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHD-RPVTVHQLDYKD 126
           QLD  LP  V  N +C SKG   D    GE+R  EL++S+++L  +  R   ++Q DY D
Sbjct: 69  QLDRLLPQSVRFNFVCLSKG---DADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPD 125

Query: 127 GKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIEEEP 186
           G D+ W+++S+V  +++ +     +   +LL+TFD HGVS+HPNH+ACHNAV RLIE+  
Sbjct: 126 GFDEKWEIESVVSIVESKVFIGSGF---NLLLTFDAHGVSNHPNHVACHNAVARLIEKG- 181

Query: 187 LFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFNTHS 246
              A  L SHS N+ LKYS F  E+++   +   +  +  T L             N+  
Sbjct: 182 -HKALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLER--TGLT----------FMNSFP 228

Query: 247 EYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKL 284
           +YI+A+A M NAHESQ+VWFRYGWW  SR  + N+L++
Sbjct: 229 QYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  209 bits (531), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 178/311 (57%), Gaps = 37/311 (11%)

Query: 9   KAIKLYFLLWCGYVWFAGAIRGENAR---------QVRGPGYFSGSSSVNLVIAHPDDEV 59
           + +KL  + W  Y++ + +I+  N +         Q+         +S++L+IAHPDDE+
Sbjct: 9   RTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEI 68

Query: 60  MFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLI------EH 113
           MFFSPTL+QL+N+L  D+  NV+C S+G++  GS     R  EL  S+++L       EH
Sbjct: 69  MFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEH 128

Query: 114 DRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIA 173
           +R   + QLDY DG  +IW++D +V DL   +N + +    +LL+TFD+ GVS+H NH+A
Sbjct: 129 NRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDN--GINLLLTFDKSGVSNHKNHLA 186

Query: 174 CHNAVHRLIE---EEPLFMAYQLESHSTNVILKYSFFAREI-----------VKYFYNYC 219
           C+ AV +L++    +   +   L SHS N  LKYSFF  ++           +  FY++C
Sbjct: 187 CNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFC 246

Query: 220 H------QRIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFF 273
                  Q  +  +  + N      +  FN  ++Y+++Y+TMLNAHESQ+VWFRY WW F
Sbjct: 247 FPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIF 306

Query: 274 SRLTYANELKL 284
           SR  + N+L +
Sbjct: 307 SRFAFINDLTI 317

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  201 bits (511), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 170/286 (59%), Gaps = 22/286 (7%)

Query: 6   FVFKAIKLYFLLWCGYVWFAGAIRGENARQVRG--PGYF---SGSSSVNLVIAHPDDEVM 60
            +FK  KL  + WC Y+  +  I+  N + +    P      S   S+ LV+AHPDDEVM
Sbjct: 7   LIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVM 66

Query: 61  FFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVH 120
           FFSPTL+QLD+ LP +   N+I +S G   D    G  R+ EL  S+ MLI   R   + 
Sbjct: 67  FFSPTLLQLDSHLPPNCKFNIISYSDG---DAEGLGSLRSNELAHSIDMLIPR-RNKEIF 122

Query: 121 QLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHR 180
             ++ DG +++WD   M+  L+++++ S    + ++L+TFD+ GVS+H NH ACH  V  
Sbjct: 123 IFNHTDGMNEVWDNKLMLHQLESILSDS----QTNILLTFDQFGVSNHINHKACHQVVTS 178

Query: 181 LIEEEPLF-MAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEY 239
            I+       A  L+S+S+N++ KY+ FA ++V    NY    I G+T    N+D     
Sbjct: 179 YIQSHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKNYW---IHGKTL--PNLD---HL 230

Query: 240 VLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285
            LFN +S+YI AYATML AH+SQ+VWFRYGWWFFSR  Y N+LKL+
Sbjct: 231 ALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLY 276

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  202 bits (513), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 117/309 (37%), Positives = 177/309 (57%), Gaps = 44/309 (14%)

Query: 6   FVFKAIKLYFLLWCGYVW------------FAGAIRGENARQVRGPGYFSGS-SSVNLVI 52
           F +K+ KL+ LLW  Y+             F  ++  +  RQ       S   + ++LVI
Sbjct: 8   FTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVI 67

Query: 53  AHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIE 112
           AHPDDE+MFF+PTL+QL+ +LP  +  N+ICFS G   D    G  R +EL  S+++L+ 
Sbjct: 68  AHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDG---DAEGLGYLRRKELHDSINLLLS 124

Query: 113 --HDRPVTVHQLDYKDGKDQIWDLDSMVWDLKT--LINPSKDYKRKDLLITFDEHGVSDH 168
             ++R + +  LD+ DG DQ+WD   ++  L+   L+N     K  ++L+TFD +G+S+H
Sbjct: 125 SSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKN-NILLTFDANGISNH 183

Query: 169 PNHIACHNAVHRLI------EEEPLFMAYQLESHS------TNVILKYSFFAREIVKYFY 216
           PNHIAC+ AVH LI      ++E   +   L S S       N++ KY+FF  ++VK ++
Sbjct: 184 PNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYW 243

Query: 217 NYCH---QRIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFF 273
           N        I    SL        E    NT+S+YI++YA+MLN H+SQ+VWFRYGWW+F
Sbjct: 244 NLATGTFNTIPNSASL--------ELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWF 295

Query: 274 SRLTYANEL 282
           SR  ++N+L
Sbjct: 296 SRFVFSNDL 304

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  185 bits (470), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 166/282 (58%), Gaps = 14/282 (4%)

Query: 6   FVFKAIKLYFLLWCGYVWFAGAIRGE-NARQVRGPGYFSGSSSVNLVIAHPDDEVMFFSP 64
           F++K  KL  LL   Y++ + +  G  N   +   G     +SVNLVIAHPDDEVMFF+P
Sbjct: 9   FIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHD-INSVNLVIAHPDDEVMFFAP 67

Query: 65  TLMQLDNWLPNDVAI-NVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLD 123
           +L+ L+  + +   + N+ICFS G   DG   G  R +EL  S++ML+   R  ++  LD
Sbjct: 68  SLINLNEQIRDPSTVFNIICFSNG-GADG--LGNVREQELSDSIAMLLP-TRNTSIVVLD 123

Query: 124 YKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAV---HR 180
           +KDG  + WD+  M+  L+ ++ P   +   ++L+TFD  GVS H NHIAC+ A    + 
Sbjct: 124 FKDGMKEKWDVKEMIAKLRNIV-PKLGH---NVLLTFDGKGVSGHLNHIACYRAALGYYN 179

Query: 181 LIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYV 240
             + +       L+S+S N++ KYS +  E++K  Y+       G     +  +V  +  
Sbjct: 180 EFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKIT 239

Query: 241 LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANEL 282
           +F+T+ +Y+++ A MLNAH++QVVWFRYGWWFFSRL + N+L
Sbjct: 240 IFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  174 bits (441), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 148/274 (54%), Gaps = 28/274 (10%)

Query: 12  KLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGSSSVNLVIAHPDDEVMFFSPTLMQLDN 71
           K+  +LW  Y+  +  I   N R +      S  +S+NLVIAHPDDEVMFF+PTL+Q+D 
Sbjct: 9   KVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFAPTLLQIDE 68

Query: 72  WLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLDYKDGKDQI 131
           WLP  + +NVI  + G   DG   G+ R +EL+  V +L+   R  +V  LD+ DG D  
Sbjct: 69  WLPGSIEVNVISLTDG-GADG--LGDLRTKELQDCVRLLLRK-RKASVEVLDFLDGMDVE 124

Query: 132 WDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIEEEPLFMAY 191
           WDL+  V  L+  I          L +TFDE+G+S H NHI+C+ AV ++ +       +
Sbjct: 125 WDLERAVKALQERI-----LDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCF 179

Query: 192 QLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFNTHSEYIMA 251
           +L S    +  KYS F   +        H  I    S            L N+  +Y++A
Sbjct: 180 KLVSKRY-LFEKYSGFIPALF-------HSFISSSPS-----------TLINSFRQYLLA 220

Query: 252 YATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285
            ++M+NAH SQ+VWFRYGWW FS   YANEL+ F
Sbjct: 221 LSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  168 bits (425), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 105/278 (37%), Positives = 149/278 (53%), Gaps = 39/278 (14%)

Query: 8   FKAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGS----SSVNLVIAHPDDEVMFFS 63
           F  IKLY +L   Y    G+ +       +   Y  GS    +SV L+IAHPDDEVMFF+
Sbjct: 6   FAVIKLYLVLLAVY---CGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFA 62

Query: 64  PTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLD 123
           PTL+QLD  +   V   V+C + G + DG   GE R REL K++ +L+  +R V +    
Sbjct: 63  PTLLQLDARMAQSVPFRVVCLTDG-DADG--LGEVRRRELHKALRLLVL-ERDVEIQMGG 118

Query: 124 YKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIE 183
           +KDG D+ W ++ +  +L  ++       R+ L++TFDE GVS H NHIAC +A  +L  
Sbjct: 119 FKDGMDEEWKMEVVREELAQVVT-----DRRPLVLTFDERGVSGHRNHIACAHAAAKLGH 173

Query: 184 EEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFN 243
                    L+S   N+I KYSFF  ++ +  + Y                 P   V  +
Sbjct: 174 H-----TLHLDS-GHNLIRKYSFFFVDLFRLLFGY-----------------PMPTVFLS 210

Query: 244 THSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANE 281
           T S+Y+ +  TML AH+SQ+VWFR+GWW  SR  YANE
Sbjct: 211 TFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANE 248

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  165 bits (417), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 146/276 (52%), Gaps = 35/276 (12%)

Query: 8   FKAIKLYFLLWCGYVWFAGAIRGENARQV-RGPGYFSGSSSVNLVIAHPDDEVMFFSPTL 66
           F  +KLY LL   Y W    +   N +   R  G  S  +S+ LVIAHPDDEVMFF+PTL
Sbjct: 6   FAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTL 65

Query: 67  MQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLI-EHDRPVTVHQLDYK 125
           +QLD  LP  +   V+C + G   +G   G+ R  EL+K++ +L+ EHD  VT+   D+ 
Sbjct: 66  LQLDARLPAWMPFRVVCLTDG-GAEG--LGQLRRAELQKALRLLVLEHD--VTLEVADFT 120

Query: 126 DGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIEEE 185
           DG  + WDL  +   L  L+  +     K L++TFDE GVS H NHI C  A  RL   +
Sbjct: 121 DGMKEDWDLAEVRTRLGELVTDA-----KPLVLTFDERGVSGHRNHIGCALAAARL-GHK 174

Query: 186 PLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFNTH 245
            LF+  +      N++ KYSFF  ++ +  +                   P   V  +T 
Sbjct: 175 TLFLRSE-----RNLLRKYSFFVLDVFRVVFG-----------------TPPPTVFVSTL 212

Query: 246 SEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANE 281
           ++Y+ A   M+ AH SQ+VWFR+GWW  SR  YANE
Sbjct: 213 AQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  158 bits (400), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 143/266 (53%), Gaps = 30/266 (11%)

Query: 22  VWFAGAIRGENARQVRGPGYFS--GSSSVNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAI 79
           ++FA + R + + +      FS    +S+NLVIAHPDDEVMFF+PTL+QLD++   D+ +
Sbjct: 17  LYFASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPV 76

Query: 80  NVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLDYKDGKDQIWDLDSMVW 139
           +V   + G   DG   G+ R  EL+ SV +L    R   V  L+++DG    WDL     
Sbjct: 77  SVFSLTDG-GADG--LGKLREEELRDSVHLLFRR-RKAEVTVLNFEDGMKVEWDLQKTSE 132

Query: 140 DLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTN 199
            L+  +        + L +TFD+HGVS H NHI+C+  V  L    P   ++ L S  + 
Sbjct: 133 ALRKQV-----VGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRS- 186

Query: 200 VILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAH 259
           +  KY+ F   ++          ++G            + V  +T  +Y++A + M+NAH
Sbjct: 187 IFQKYTAFVPSLITV--------LRGSR----------QAVFMSTFKQYLLALSVMMNAH 228

Query: 260 ESQVVWFRYGWWFFSRLTYANELKLF 285
            SQ+VWFRYGWWFFS   +ANE++ F
Sbjct: 229 TSQMVWFRYGWWFFSCYVFANEVREF 254

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  159 bits (403), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 159/288 (55%), Gaps = 20/288 (6%)

Query: 6   FVFKAIKLYFLLWCGYVWFAGAIRGENARQVRG--PGYFSGSSSVNLVIAHPDDEVMFFS 63
            +FK  KL  +    Y++F   +   N   +    P +      +NLVIAHPDDE+MFFS
Sbjct: 21  LLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTH-DNFGVLNLVIAHPDDEIMFFS 79

Query: 64  PTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLI--EHDRPVTVHQ 121
           PT++QL + +     +NV+C S G + DG   GE RA+ELK ++  L    + R V+++ 
Sbjct: 80  PTILQLIDHVQE---LNVVCLSNG-DADG--LGELRAKELKDAIGYLTVNRNLRNVSLNI 133

Query: 122 LDYKDGKDQIWDLDSMVWDLKTLINPSK-DYKRKDLLITFDEHGVSDHPNHIACHNAVHR 180
           LDY DG++++W    +  DLK  I  S+   K+KD+++TFD  G+S H NHIAC+  V  
Sbjct: 134 LDYTDGQNEVWS--GVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVIS 191

Query: 181 LIE--EEPLFMAYQLESHST-NVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMD--- 234
            ++  +   F+  +L+S ST  +I KYS    ++++  YN      K   S   N D   
Sbjct: 192 YLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIA 251

Query: 235 VPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANEL 282
                   +T  +Y +++A M  AH+SQ+VWFRY WW FSR  + N+L
Sbjct: 252 TDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  152 bits (383), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 145/286 (50%), Gaps = 32/286 (11%)

Query: 1   MSWMSFVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGSSSVNLVIAHPDDEVM 60
           M  +  V K +K Y LL   Y+  +  I   N +  R        +SVNL++AHPDDE M
Sbjct: 1   MRVVEVVAKLLKAYALLSVLYICVSQRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETM 60

Query: 61  FFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVH 120
           FFSPTL+QL    P  V + VIC + G + DG   G  R +EL+ S+ +L+   R  +V 
Sbjct: 61  FFSPTLLQLHVNYPPSVPLRVICLTNG-DADG--LGAVREQELRLSMQLLLP-ARNTSVI 116

Query: 121 QLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHR 180
              ++DG    WD   +V  +   ++ +       LL+TFDEHGVS H NH++C+ AV  
Sbjct: 117 VEGFEDGMGVEWDTRQVVATINRHVSDA-----SPLLLTFDEHGVSGHVNHVSCNTAVSA 171

Query: 181 LIEE----EPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVP 236
           L+E+    E  F A  L S       KY  FA ++ +         I G+          
Sbjct: 172 LVEQREQREQRFTALYLNSKRY-FPPKYGSFAVDLARI--------ITGRQP-------- 214

Query: 237 YEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANEL 282
              V  +T  +Y+++ A M NAH SQ+VWFR+GWW  SR  + NEL
Sbjct: 215 --PVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  146 bits (369), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 131/240 (54%), Gaps = 26/240 (10%)

Query: 43  SGSSSVNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARE 102
           S  +SV LV+AHPDDEVMFFSPTL Q +  LP  + INV+C + G + DG   G  R +E
Sbjct: 46  SKLTSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAG-DADG--LGHIRKQE 102

Query: 103 LKKSVSMLIEHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDE 162
           L  S+ ++  H R      LD++DG D +WD   +   L++ I  S       L++TFD+
Sbjct: 103 LVDSLRIMF-HGRQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDS-----NPLVLTFDQ 156

Query: 163 HGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQR 222
            GVS H NHI+C     RL+E+ P      L S    + +KYS F   I +         
Sbjct: 157 FGVSGHINHISC----GRLVEKLPYSHKLHLRSDQP-IYVKYSAFIAGIFQL-------- 203

Query: 223 IKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANEL 282
             G +++  +   P  ++  +T  +Y++A + M  AH SQ+VWFR GWW FSR  + NEL
Sbjct: 204 --GISTVYPDYGKPRCFI--STLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259

>KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {ON}
           Anc_5.414 YDR356W
          Length = 1040

 Score = 33.9 bits (76), Expect = 0.59,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 95  AGESRARELKKSV-SMLIEHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINP-SKDYK 152
             ES   + K+ + S  IEH+R +  H+ + K  KDQI+D  + +  L++ ++  S D  
Sbjct: 496 GAESELAKCKEELNSKKIEHERLINSHETNVKSLKDQIYDQTTQIRSLESTVDDLSADIG 555

Query: 153 RKD 155
           RK+
Sbjct: 556 RKE 558

>NDAI0C06110 Chr3 (1409081..1413868) [4788 bp, 1595 aa] {ON} 
          Length = 1595

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 40/101 (39%), Gaps = 8/101 (7%)

Query: 125 KDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIAC-----HNAVH 179
           K GK  +    ++ W  K  +NP +D  R+D   TFD+ G+ +  + +            
Sbjct: 125 KMGKPSVGRAKTLKWATKNFVNPFEDANRED---TFDDGGLMNRASELRTIYYNMQLPKE 181

Query: 180 RLIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCH 220
            L EE    M Y      T      +F  + I+  F N+ +
Sbjct: 182 MLDEEGKPIMEYPRNKIRTTKYTPLTFLPKNIMFQFQNFAN 222

>KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {ON}
           Anc_8.817 YML102W
          Length = 486

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/96 (19%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 160 FDEHGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYC 219
           F     ++  N++ CHN+V+       ++    ++S+S   +   SF  +  +   +N  
Sbjct: 294 FKTQEAAESANNLECHNSVY-------IYSRAAIKSNSNKPVAVLSFLKKPAIAISFNSN 346

Query: 220 HQRIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATM 255
              ++G T  N  +D+PY+ +     +  ++ Y T+
Sbjct: 347 LYTLEGGT--NPYIDLPYKLIFAVATTNEVLVYDTV 380

>Ecym_8097 Chr8 (208496..210376) [1881 bp, 626 aa] {ON} similar to
           Ashbya gossypii AEL117C
          Length = 626

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 65/165 (39%), Gaps = 15/165 (9%)

Query: 64  PTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGES-RARELKKSVSMLIEHDRPVTVHQL 122
           P+  Q+D+    D+ +  +  +  + +  S+     R  ++ K+         PVT   +
Sbjct: 199 PSTRQIDDHGLEDIQLMSVASNSNIPISRSVTHVPLRDSQISKNEKNSSSSTDPVTSSPM 258

Query: 123 DYKDGKDQIWDLDSMVWDLK-------TLINPSKDYKRKDLLITFDEHGVSDHPNHIACH 175
            Y    D+  D  S     +       T+  P+    R    I      VSD   +I C 
Sbjct: 259 LYISSTDRNQDTASSNISFRSGGSKTMTMKPPTPTRTRNSGFIP----RVSDEEKNIYCE 314

Query: 176 NAVHRLIEEEP--LFMAYQLESHSTNVILKYSFFAREIVKYFYNY 218
            AV R I ++   +F    L+ H  ++I    FFA  +  YF+++
Sbjct: 315 RAVTRQIPQQMNLIFTTAMLKEHFHHIIYSLGFFA-SMFSYFFSW 358

>TDEL0B03310 Chr2 complement(589965..593114) [3150 bp, 1049 aa] {ON}
           Anc_8.778 YOR304W
          Length = 1049

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 8/81 (9%)

Query: 159 TFDEHGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNY 218
           T DEH V +    I     +HRL E+    + +   S   +++  Y FF RE     Y Y
Sbjct: 427 TTDEHLVYNAGKMIVLDKLLHRLKEKGSRVLIFSQMSRLLDILEDYCFF-RE-----YEY 480

Query: 219 CHQRIKGQTSLNKNMDVPYEY 239
           C  RI G T+  + ++   E+
Sbjct: 481 C--RIDGSTAHEERIEAIDEF 499

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,397,144
Number of extensions: 1480710
Number of successful extensions: 4811
Number of sequences better than 10.0: 33
Number of HSP's gapped: 4841
Number of HSP's successfully gapped: 33
Length of query: 291
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 182
Effective length of database: 40,982,805
Effective search space: 7458870510
Effective search space used: 7458870510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 65 (29.6 bits)