Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.38.847ON56656629360.0
ZYRO0G14322g8.847ON5504916985e-84
TDEL0B005108.847ON5504956916e-83
TPHA0I002908.847ON5694696561e-77
SAKL0D01298g8.847ON5514906411e-75
KLTH0C03718g8.847ON5514935773e-66
Kwal_27.102248.847ON5464885432e-61
Smik_13.4958.847ON5765355261e-58
YMR282C (AEP2)8.847ON5804034857e-53
Suva_13.4718.847ON5814554849e-53
Skud_13.4548.847ON5804434724e-51
Ecym_46188.847ON5274784467e-48
TBLA0B033108.847ON6134374271e-44
KAFR0B039708.847ON4744454174e-44
NCAS0C003708.847ON4955533454e-34
KLLA0D01408g8.847ON5184293233e-31
NDAI0K003408.847ON6244903141e-29
KNAG0J002308.847ON4744212932e-27
CAGL0M03069g8.847ON5484272924e-27
ABL119C8.847ON5374141751e-12
TBLA0E020207.324ON493129820.22
KLLA0F11121g3.94ON29286751.1
Suva_8.4007.46ON98578733.3
KLLA0F26499g2.616ON709136723.7
SAKL0C08492g3.147ON415165714.8
KLLA0D07590g8.64ON68963715.3
Kpol_1036.878.350ON63398715.3
TBLA0C004208.20ON94985706.1
KAFR0A065304.129ON123377716.2
KAFR0B024108.207ON2097127699.0
TBLA0G023402.546ON49953699.3
SAKL0C00242gna 1ON83366699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.3
         (566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...  1135   0.0  
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   273   5e-84
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   270   6e-83
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   257   1e-77
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   251   1e-75
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   226   3e-66
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   213   2e-61
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   207   1e-58
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   191   7e-53
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   191   9e-53
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   186   4e-51
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   176   7e-48
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   169   1e-44
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   165   4e-44
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   137   4e-34
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   129   3e-31
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   125   1e-29
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   117   2e-27
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   117   4e-27
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    72   1e-12
TBLA0E02020 Chr5 complement(490462..491943) [1482 bp, 493 aa] {O...    36   0.22 
KLLA0F11121g Chr6 (1024978..1025856) [879 bp, 292 aa] {ON} simil...    33   1.1  
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    33   3.3  
KLLA0F26499g Chr6 (2456560..2458689) [2130 bp, 709 aa] {ON} simi...    32   3.7  
SAKL0C08492g Chr3 complement(778821..780068) [1248 bp, 415 aa] {...    32   4.8  
KLLA0D07590g Chr4 (652790..654859) [2070 bp, 689 aa] {ON} simila...    32   5.3  
Kpol_1036.87 s1036 (227517..229418) [1902 bp, 633 aa] {ON} (2275...    32   5.3  
TBLA0C00420 Chr3 (76048..78897) [2850 bp, 949 aa] {ON} Anc_8.20 ...    32   6.1  
KAFR0A06530 Chr1 (1320422..1324123) [3702 bp, 1233 aa] {ON} Anc_...    32   6.2  
KAFR0B02410 Chr2 complement(467555..473848) [6294 bp, 2097 aa] {...    31   9.0  
TBLA0G02340 Chr7 complement(603351..604850) [1500 bp, 499 aa] {O...    31   9.3  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    31   9.8  

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score = 1135 bits (2936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/566 (97%), Positives = 552/566 (97%)

Query: 1   MLGQFIGSQKLPYKNVAVQLSKSCFGLTLIKSKRITPISTSRYEKHYSTTSVKYAIESEL 60
           MLGQFIGSQKLPYKNVAVQLSKSCFGLTLIKSKRITPISTSRYEKHYSTTSVKYAIESEL
Sbjct: 1   MLGQFIGSQKLPYKNVAVQLSKSCFGLTLIKSKRITPISTSRYEKHYSTTSVKYAIESEL 60

Query: 61  DSLVHSRNSNTIIKQSDVLPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDL 120
           DSLVHSRNSNTIIKQSDVLPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDL
Sbjct: 61  DSLVHSRNSNTIIKQSDVLPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDL 120

Query: 121 TYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALH 180
           TYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALH
Sbjct: 121 TYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALH 180

Query: 181 LKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLV 240
           LKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLV
Sbjct: 181 LKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLV 240

Query: 241 PQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGIL 300
           PQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGIL
Sbjct: 241 PQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGIL 300

Query: 301 DSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYI 360
           DSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYI
Sbjct: 301 DSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYI 360

Query: 361 YKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMK 420
           YKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMK
Sbjct: 361 YKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMK 420

Query: 421 NWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAEL 480
           NWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAEL
Sbjct: 421 NWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAEL 480

Query: 481 NLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTXXX 540
           NLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLST   
Sbjct: 481 NLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTRDK 540

Query: 541 XXXXXXXXXXXYDEMEEEDMIIGRLW 566
                      YDEMEEEDMIIGRLW
Sbjct: 541 KSQSQKKRQDRYDEMEEEDMIIGRLW 566

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  273 bits (698), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 164/491 (33%), Positives = 264/491 (53%), Gaps = 31/491 (6%)

Query: 80  PENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSNGHD 139
           P +  R YLKN +  K  + L      +++++  LF +G LT +E S+FIN++      D
Sbjct: 87  PNSKIREYLKNGQYTKLLIRLSVDNHLNNEYISGLFTTGGLTKSEYSLFINKLLSEEELD 146

Query: 140 IK--RVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQL 197
           +K   VI +     +TELIY+++E Y   I  +     L  L L DLNLF+  FI EAQL
Sbjct: 147 VKLSNVIPD---TPHTELIYKLYEFYCDHIVDQHN---LTPLQLYDLNLFLKTFIAEAQL 200

Query: 198 SKAQNVLQYII--DAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNS 255
           SKA NVL +I+       +   TD + ++ FLRL+CG L KFW +  AS    ++     
Sbjct: 201 SKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCGALSKFWKIQPAS----QRNSTAI 256

Query: 256 RLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQ 315
            L   + +     SYK      VL ++IN +L +  WK++ S  LD+ I+YSL +  Q  
Sbjct: 257 TLGEKASDCHLAKSYKFQ-NEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTD 315

Query: 316 MMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDK 375
           +++ ++   W  S          K + V + P++++L+A+++SY  K+ N+   +++LD+
Sbjct: 316 LIEKYVNRTWSPS----------KDEGVKTNPNSDLLVAVLTSYCVKEGNMRKGLEVLDR 365

Query: 376 FIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPY 435
           FIR YP++ LD +FWRRL+Q  + LWD K DR+ T  +GCW +MK W+     K   +PY
Sbjct: 366 FIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKATLSHGCWTIMKQWHAQRQRK---IPY 422

Query: 436 DFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLI 495
           D+ I +E Y +F RT N   A E+++        +    ++  EL+LL KYQ   +  + 
Sbjct: 423 DYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIA 482

Query: 496 ERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTXXXXXXXXXXXXXXYDEM 555
            +  + K   F +EWS    N+ +L+  F K + +  ++ ++              YDEM
Sbjct: 483 LKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTS---QSKQKAALQEKYDEM 539

Query: 556 EEEDMIIGRLW 566
           EE+DM++GRLW
Sbjct: 540 EEDDMLLGRLW 550

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  270 bits (691), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 166/495 (33%), Positives = 273/495 (55%), Gaps = 32/495 (6%)

Query: 77  DVLPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSN 136
           D +  N  R YL+  E   F +H++     + +++K+LF++ +L+ +E S FINR+    
Sbjct: 83  DTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSLFETKELSTSEFSTFINRLLLEK 142

Query: 137 GHDI--KRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKE 194
             D+    +I +     +TE+I+ ++++Y + + K+S    L  L + D+N FI  FI E
Sbjct: 143 DLDLKLSNIIPD---TVHTEIIFNLYQIYCTYVIKDSQN-GLTPLQVHDINRFIKRFIDE 198

Query: 195 AQLSKAQNVLQYIIDAEG--SIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTK 252
           AQL KAQ  LQ++ID +G  +I +  D +T+  FL+LRCG L KFW V   S  V     
Sbjct: 199 AQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKV----- 253

Query: 253 KNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTF 312
               L  +S + + P SY + +      E++N +L  K W+ + S I+DS IVYSL++  
Sbjct: 254 ----LGEDSKHFKSPKSY-NLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLG 308

Query: 313 QKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKI 372
           Q +++D +I+  WGIS  G    + +K + V   P +E+LI I+S+Y  K+ +    ++I
Sbjct: 309 QTKLIDQYIQLKWGISEDGH---VAVKNEAV---PGHEVLINIVSAYCLKNGDTGKGLRI 362

Query: 373 LDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVV 432
           LD+F++ YP   L+ +FWRRL+Q     WD + D++    +GCWN+MK W+     K V 
Sbjct: 363 LDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQ---KGVS 419

Query: 433 LPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMN 492
           + YD       Y+LFK T NG+ AAE+V        +++   + K E++LL  +Q LA+ 
Sbjct: 420 ITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALK 479

Query: 493 WLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLS-TXXXXXXXXXXXXXX 551
            +  + ++ +    I+EW++D+ N+  L + F + +    RK   T              
Sbjct: 480 TMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHR----RKYDLTRDKARAKQQQQQAQ 535

Query: 552 YDEMEEEDMIIGRLW 566
           YD MEEEDM++GRLW
Sbjct: 536 YDNMEEEDMLLGRLW 550

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  257 bits (656), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 151/469 (32%), Positives = 259/469 (55%), Gaps = 24/469 (5%)

Query: 110 FVKNLFKSGDLTYNELSIFINRIYKSNGHDIKR-VIQNHHSLSYTELIYEIFELYTSTIP 168
           F++ L +S  LT+NE SIF+NR+    G      V++   +  ++E+++++F+LY + I 
Sbjct: 113 FLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAI- 171

Query: 169 KESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLR 228
              G  KL+ L L+D+NLFI  FI E  L +A+ VL ++++   SI  + D DT+ ++L+
Sbjct: 172 ---GSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQ 228

Query: 229 LRCGGLPKFWLVPQASYAVT-------KQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFE 281
           LRCG LP++W+    S  +        + +K  +RL   +   +  + YK   P  VL +
Sbjct: 229 LRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVL-K 287

Query: 282 VINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGIS---SHGDPLDLFI 338
           + N I+    WKS HS  LD+T+VYSL ++ Q   +  +I   W +    S G+  D+  
Sbjct: 288 IANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNS-DVGT 346

Query: 339 KKKKVASAP-SNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWC 397
           +    AS P  +E++ AI+SSY Y D++I+ A+ I+DK +  YP++ L+  FWRRL+QW 
Sbjct: 347 QISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWS 406

Query: 398 NRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAA 457
              WD K+DR+G+  YGC+  +K ++     + + + +D  + +E Y L   T N +IAA
Sbjct: 407 VLCWDHKLDRKGSLVYGCFKTLKKYHEM---RSIRINFDEGLLQELYTLVYYTKNSRIAA 463

Query: 458 EIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNR 517
           E+VS  +     +++  +   E  LL  +Q  +++ ++ ++ +  A+ FIE+WS+D  N+
Sbjct: 464 EVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNK 523

Query: 518 IQLREAFKKRKQLMLRKLSTXXXXXXXXXXXXXXYDEMEEEDMIIGRLW 566
               E FK  K  + +KL                 D  +E+D ++GRLW
Sbjct: 524 ---EELFKYYKDSIAKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  251 bits (641), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 149/490 (30%), Positives = 260/490 (53%), Gaps = 28/490 (5%)

Query: 79  LPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSNGH 138
           LP N  R +L++NE  KF + LL   + D+ F   +F    +T  E S+F+N++  +   
Sbjct: 88  LPRNNLRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSNT-- 145

Query: 139 DIKRVIQNH-HSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQL 197
           ++K  + N      +TE++++++E+Y  ++    G   L  + L DLN FI  F  +AQL
Sbjct: 146 NLKSELTNLIPGTVHTEVLFKLYEIYRDSV---VGNATLTPVQLYDLNQFIKRFTGDAQL 202

Query: 198 SKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRL 257
           +KAQ VL ++++  GSI +  D  T++N+L L+CG +P+ W +P +   + K       L
Sbjct: 203 AKAQQVLGFVLENYGSIPR--DPQTLINYLELKCGAMPRNWSIPLSRPELGKT------L 254

Query: 258 SSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQMM 317
            S S  +    SYK  +    L  +I+ ++  + W  K +  L++ ++YSL +  Q  ++
Sbjct: 255 GSQSFMSNLAHSYK-VLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALL 313

Query: 318 DGFIKEHWGIS-SHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDKF 376
           + +IK  WG+S S     ++ + K      P++ +LI+I+S Y  K  N+  A++I+D F
Sbjct: 314 ERYIKHTWGVSVSSNTSTEVEVPKNLY---PTSNLLISIVSCYAMKG-NLHQALQIIDSF 369

Query: 377 IRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYD 436
           +  +P I L+ +FWRRL QW  RLW+ K D +G    GCW +MK W+     +   LP D
Sbjct: 370 LSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNK---QKRSLPID 426

Query: 437 FQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIE 496
             I  E Y + KRTNN   A  I    L     ++N+     E++++ K+Q L +  +  
Sbjct: 427 LGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLI--DPEVDVIKKFQKLILKKMAG 484

Query: 497 RRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTXXXXXXXXXXXXXXYDEME 556
           R  + K   +I EW +++ N +++RE F + ++  + ++                +D  E
Sbjct: 485 RGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIE---QRKQKQETAQVTFDAEE 541

Query: 557 EEDMIIGRLW 566
           E+DM++GRLW
Sbjct: 542 EDDMLLGRLW 551

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  226 bits (577), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 150/493 (30%), Positives = 248/493 (50%), Gaps = 36/493 (7%)

Query: 80  PENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSNG-- 137
           P N  R++L + +   F + L    R D++F   +F++ DL+  E S FI  +   N   
Sbjct: 89  PCNKLRSFLHSRDYMAFLVELTLQSRMDENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLL 148

Query: 138 HDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQL 197
           H +   + N   +S TE+++ +++LY  T+        L+ L L D N FI  FI+ AQL
Sbjct: 149 HKLSATLPN---VSGTEMVFSLYQLYLKTVTPG----PLSPLQLHDFNKFIRFFIRSAQL 201

Query: 198 SKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRL 257
            KAQ VL  I+ +  + +   D  T  ++L+LRCG LP+ W V      + +   +++RL
Sbjct: 202 RKAQTVLDCILKSNNN-QLPCDSATATHYLQLRCGALPRNWKV------LDENLGRSTRL 254

Query: 258 SSNSPNTRFPS-SYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQM 316
            +     +  S SYK+    +VL  +  +   K VW  + S  L+S +VYSL    Q ++
Sbjct: 255 GARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKL 314

Query: 317 MDGFIKEHWGIS--SHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILD 374
           ++  +  +WGIS   H    D         ++PS+E+L+A+++SY   ++NI  A+ ++D
Sbjct: 315 LEEHVWRNWGISLQEHNQVTDASF------TSPSSEVLVAVLTSYA-SNKNISSALHLID 367

Query: 375 KFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLP 434
            F+  YP + LD++FWRRL QW  R+W  K D +G    GCW +M+ W+ A   ++  LP
Sbjct: 368 GFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAA---RNRQLP 424

Query: 435 YDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWL 494
            D  +  E + +  RTNN + A E+V         + N++  + E  L  K+  L +  +
Sbjct: 425 ADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLS--RHEAVLFQKFAKLILKNM 482

Query: 495 IERRQFKKAAFFIEEWSIDRNNRIQLREAFKK-RKQLMLRKLSTXXXXXXXXXXXXXXYD 553
                + K   FI+EWS ++     LR  F+K R     RK                 +D
Sbjct: 483 AHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARK----QRRTEAAQKAQKRFD 538

Query: 554 EMEEEDMIIGRLW 566
           + EE+ M++GRLW
Sbjct: 539 DEEEDSMLLGRLW 551

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  213 bits (543), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 151/488 (30%), Positives = 238/488 (48%), Gaps = 30/488 (6%)

Query: 82  NIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSNGHDIK 141
           N  R+ L   +  KF + L    + + +F   +F+   LT NE S  +N +        K
Sbjct: 86  NRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIFEDNLLTPNEFSTLLNGLLTERNLSTK 145

Query: 142 --RVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQLSK 199
              V+    S+  TE+I+ +++ Y  TIP  S    LN L L DLN F+  FI+ AQL K
Sbjct: 146 LETVLP---SVQSTEMIFGLYQTYLMTIPAGS----LNPLQLHDLNSFVQYFIETAQLGK 198

Query: 200 AQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRLSS 259
           AQ VL  I+ A  + +   D  T +++L+LRCG LP+ W V         +   + RL S
Sbjct: 199 AQIVLDRIL-ASNNDQLPCDTTTGIHYLQLRCGALPRNWKV------FDSRVGHSCRLGS 251

Query: 260 NSPNTRFPSSYKSTVPNTVLFEVINMILNKKV-WKSKHSGILDSTIVYSLAHTFQKQMMD 318
           +   ++  S     +  + + E +N++ ++   W  K S  L++ ++YSL    Q  ++ 
Sbjct: 252 HRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIYSLGFMGQLTLLK 311

Query: 319 GFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDKFIR 378
             I   WGI+  G  L   + +      PS E+LIAI +S+    + +   ++++D FI 
Sbjct: 312 EHIAVRWGITELGASLATEVNE----VPPSPEVLIAIFTSFA-SHQEVTLGLRLMDAFIT 366

Query: 379 MYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQ 438
            Y +I+LD +FWRRL QW N +WD K D +G    GCW +M  W+  G+ K   L  D  
Sbjct: 367 KYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKK---LQPDTT 423

Query: 439 IYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERR 498
           +  E Y +  +TNN K A  ++S    P L EK     K E+ ++ KY  L +  + E  
Sbjct: 424 LLNERYFVLAQTNNYKEALTVISQSF-PQLYEKPTLSSK-EMAIVQKYSKLVLKSMAELG 481

Query: 499 QFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTXXXXXXXXXXXXXXYDEMEEE 558
            + K   FI EWS ++     LR  FKK +    ++                 YD+ EE+
Sbjct: 482 YYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKR---KERLREESRRKQNTYDDEEED 538

Query: 559 DMIIGRLW 566
           +M++GRLW
Sbjct: 539 NMLLGRLW 546

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  207 bits (526), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 164/535 (30%), Positives = 260/535 (48%), Gaps = 64/535 (11%)

Query: 65  HSRNSNTIIKQSDVLPENIWRNYLKNNEIDKFTLHLLASLRGDD--DFVKNL-------F 115
           H  N NT        P +  +  LK   ID +TL  + S  G    DF K +        
Sbjct: 73  HLNNGNT--------PRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKGISYLFTKTV 124

Query: 116 KSG---DLTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESG 172
            SG    L+  ELS  +N++Y S    I+ + ++   + Y+E  ++IF LY   +  +  
Sbjct: 125 DSGPRNSLSLAELSFLLNKLY-SLRFQIRGICRDI-KVKYSEFWFKIFSLYAEKVDAKRN 182

Query: 173 IIKL-----NALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSI---EKITDHDTMV 224
            I L     +A  + D+NL I  FI+  QL KAQ +L +IID    I       D  TMV
Sbjct: 183 HINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMV 242

Query: 225 NFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVIN 284
           +FL+LRCG L  +W +P  S    KQ +K  RL + + + R  S+YK  + +  L ++ +
Sbjct: 243 HFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYK-VMDHQTLLKIAD 301

Query: 285 MILNKKVWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVA 344
           ++L++K  +  +S  L ST++ S  H  Q Q+++  I+  W I++   P  + IK +   
Sbjct: 302 LVLHEK--RFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPR--G 357

Query: 345 SAPSNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPK 404
             PS++ILI+I+ S+ Y D ++   + ILD FI+ YP++ LD +FWRRL Q  N  W P 
Sbjct: 358 CYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPA 417

Query: 405 IDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVL 464
            D++ T    CW++MK W+     K + L  D++   + Y + K+T N  +  +++ +  
Sbjct: 418 KDKKATSVIRCWHLMKQWH---VSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFK 474

Query: 465 --IPHLSEKNVAVKKAELNL-LNKYQTLAMNWLIERRQFKKAAFFIEEWSIDR------- 514
             I  L E N      +LN+ L KYQ   +  L++R +      FI ++  DR       
Sbjct: 475 SGIERLRETN----SDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLN 530

Query: 515 ---NNRIQLREAFKKRKQLMLRKLSTXXXXXXXXXXXXXXYDEMEEEDMIIGRLW 566
               NR+ LR   KK K       S               +D+ E++ MIIG LW
Sbjct: 531 IFCTNRLLLRS--KKNK-------SKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  191 bits (485), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 120/403 (29%), Positives = 210/403 (52%), Gaps = 19/403 (4%)

Query: 120 LTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGII----- 174
           L+  +LS  ++++Y +    I+R+ ++ ++  Y+E  +++F LY   +  +   +     
Sbjct: 136 LSLEDLSFLLSKLY-TQRFQIRRICRDINA-KYSEFWFKLFSLYAEKVDAKRNQVNLRNT 193

Query: 175 KLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSI---EKITDHDTMVNFLRLRC 231
           KL+A  + D NL I  FI+  QL KAQ +L +I+D    I    K  D  T+V+FL+LRC
Sbjct: 194 KLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRC 253

Query: 232 GGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKV 291
           G L  +W +P  S       +K  RL + + + R  S+YK+    T+L ++ ++ L +K 
Sbjct: 254 GALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLL-KIADLALQEK- 311

Query: 292 WKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEI 351
            K  +S  L ST++ S  H  Q Q+++  I+  W IS    P  + IK +     PS++I
Sbjct: 312 -KLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHR--GCYPSSKI 368

Query: 352 LIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTF 411
           L++I+ S+ + D ++   + ILD FI+ YPD+ LD +FWRRL Q  +  W P  D++ T 
Sbjct: 369 LVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATS 428

Query: 412 GYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEK 471
              CW++MK W  +   +  V   D++   + Y + K+T N  +  +++ +   P +   
Sbjct: 429 VVRCWHLMKQWYASKRLRPSV---DYETLRQLYDIMKKTGNFPLGIDVLRS-FKPGIERT 484

Query: 472 NVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDR 514
                    N++ KYQ   +  L+ R +F     FI+ +  DR
Sbjct: 485 RAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDR 527

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  191 bits (484), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 139/455 (30%), Positives = 240/455 (52%), Gaps = 35/455 (7%)

Query: 80  PENIWRNYLKNNEIDKFTLHLL--ASLRGDDDFVKN---LFKSG-------DLTYNELSI 127
           P ++++  +K+  ID FTL  +  +S   + DF K+   LF           L+  +LS 
Sbjct: 87  PHDMFK--VKDIPIDMFTLRRIIDSSSMNELDFSKSMTYLFVKAINSEARETLSLEDLSF 144

Query: 128 FINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLK----- 182
            +N +Y S   +IK++ ++ + + Y+E  +++F LY   +  +   I L    L      
Sbjct: 145 LLNNLY-SQRFEIKKICKDIN-VRYSEFWFKLFSLYAEKVDVKRNQINLRNTALDSSEIF 202

Query: 183 DLNLFITIFIKEAQLSKAQNVLQYIIDAEGSI---EKITDHDTMVNFLRLRCGGLPKFWL 239
           D+NL I  FI+  QL KAQ VL +I+D    I    K  D  T+++FL+LRCG L  +W 
Sbjct: 203 DMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRCGALAAYWK 262

Query: 240 VPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGI 299
           +P  S    K ++K  RL + + + R  SSYK+ + +  L ++ +++L K+  +  +S  
Sbjct: 263 MPDNSEQ--KYSRKMVRLGAKNTSIRITSSYKA-MDHQTLLKIADLVLQKE--RLLNSED 317

Query: 300 LDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSY 359
           L ST++ S  H  Q Q+++  I+  W IS    P    IK K     PS++ILI+I+ S+
Sbjct: 318 LLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISILVSF 377

Query: 360 IYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMM 419
              D ++   + ILD FI+ YP++ +D +FWRRL Q  +  W P  D++ T    CW++M
Sbjct: 378 HLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLM 437

Query: 420 KNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAE 479
           K W+ +   K   L  D++   + Y L K+T N  +  +++ N   P ++ +  A+K  +
Sbjct: 438 KQWHES---KGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQN-FKPGIT-RTSAMKTEK 492

Query: 480 LN-LLNKYQTLAMNWLIERRQFKKAAFFIEEWSID 513
           +N ++ K+Q   +  L+ R +   A  FI ++S D
Sbjct: 493 INGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFD 527

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  186 bits (472), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 128/443 (28%), Positives = 223/443 (50%), Gaps = 36/443 (8%)

Query: 142 RVIQNHHSLSYTELIYEIFELYTSTIPKESGII-----KLNALHLKDLNLFITIFIKEAQ 196
           R+I    ++ Y+E  +++F LY   +      +      L++  + DLNL I  FI+  Q
Sbjct: 156 RLICKEINVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQ 215

Query: 197 LSKAQNVLQYIIDAEGSI---EKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKK 253
           LSKAQ +L +I+D    I    +  D  T+V+FL+LRCG L  +W +P  S     Q ++
Sbjct: 216 LSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRR 275

Query: 254 NSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQ 313
             RL + + + R  S+YK+    T+L ++ +++L  K  +  +S  L ST++ S  H  Q
Sbjct: 276 MVRLGAKNTSIRLSSTYKAMDHQTLL-KIADLVLQDK--RFLNSEDLLSTLIQSFGHLGQ 332

Query: 314 KQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKIL 373
            Q+++  I+  W ISS   P  + IK +     PS++ILI+I+ S+   D+++   + IL
Sbjct: 333 TQILERCIEHIWQISSQEFPSHVAIKPR--GCYPSSKILISILVSFHLNDKDLHRGLSIL 390

Query: 374 DKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVL 433
           D FI+ YP++ LD +FWRRL+Q  +  W P  D++      CW++MK+W  +   K++  
Sbjct: 391 DSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYES---KELSP 447

Query: 434 PYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNW 493
             D++   + Y + K+T N  +  +++ +        +    +K E  +L KYQ   +  
Sbjct: 448 SVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEKLEA-ILIKYQKCIIKQ 506

Query: 494 LIERRQFKKAAFFIEEWSIDR----------NNRIQLREAFKKRKQLMLRKLSTXXXXXX 543
           L+ R +   A  FI ++  +R          +NRI     F + K++     +       
Sbjct: 507 LVNRGKISAARKFIGDFGFNRRAAKDLNIFCSNRI-----FSRSKKIK----NDIENKKK 557

Query: 544 XXXXXXXXYDEMEEEDMIIGRLW 566
                   YD+ E++ MIIG LW
Sbjct: 558 RDGLAPGNYDDDEDDGMIIGSLW 580

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  176 bits (446), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 123/478 (25%), Positives = 228/478 (47%), Gaps = 40/478 (8%)

Query: 62  SLVHSRNSNTIIKQSDVLPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSG--- 118
           ++V  +  + +  +   L   + ++YL  N  DK+   +L S   D     ++   G   
Sbjct: 38  AMVFHKQYDPVRVERKALKNTLSKSYLYEN--DKY--QMLRSFLDDTKLSGDVHPGGLPA 93

Query: 119 --DLTYNELSIFINRIYKSNGHD--IKRVIQNHHSLSYTELIYEIFELYTSTIPKESGII 174
             +++  E SIF NR+  ++G    +K  I  +  +    L  ++++ Y + + +E    
Sbjct: 94  CQEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVP---LANKLYQFYMAILEREKKT- 149

Query: 175 KLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGL 234
           +   + L DLN F   F+ E +L  A+ VLQ I+   GS +   DH T+V + +L  G L
Sbjct: 150 RFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSL 209

Query: 235 PKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKS 294
              W  P+   A   +  + SR        R      +++P  ++++V+  +L    WK 
Sbjct: 210 ASLWPTPKVQSACYDKLVRGSR--------RPKYVVYNSLPEGIMYDVLQKLLENDDWKH 261

Query: 295 KHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGD------PLDLFIKKKKVASAPS 348
             S  LD+ I+YSL H  +  + +GF++  WGI  H        P+D+        + P 
Sbjct: 262 LRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDI-----SSGTYPG 316

Query: 349 NEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQ 408
           +E+LIAI++S+ Y++ +++ A++++D F+  YP + L   FW +L  W   ++D K+D  
Sbjct: 317 SEVLIAIVTSFSYRN-DLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPL 375

Query: 409 GTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHL 468
           G+    CW  M +W  +  G+ V  PY   +    Y + K+T+N K A  +  + +    
Sbjct: 376 GSLQKACWLRMLSWYKS-RGESV--PYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVY 432

Query: 469 SEKNVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKK 526
           ++   A  K  L ++ KYQ   +  L  R +      FIE+W  +  N  +L++ F++
Sbjct: 433 AKS--AAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQR 488

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  169 bits (427), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 137/437 (31%), Positives = 215/437 (49%), Gaps = 59/437 (13%)

Query: 125 LSIFINRIYKSN---GHDIKRVIQNHHSLSYTELIYEIFELYTSTIP------------- 168
           LSI IN + K N     D  R+    HS    ELI++++++Y   I              
Sbjct: 156 LSIVINLLVKYNHFQPKDSDRLSFKSHS----ELIFKVYQIYIERIEHPILNSNNNSHIQ 211

Query: 169 --KESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDA-EGSIEKITDHDTMVN 225
              E     LN + L DLN  IT FIK  QL KA   L YI+      I +I D  T++N
Sbjct: 212 SIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNAEIFQIPDSKTIIN 271

Query: 226 FLRLRCGGLPKFWLVPQASYAVTK-QTKKNSRLSSNSPNTRFPSSYKST---VPNTVLFE 281
           FL+L CGGLP  W +   ++   K Q K++ +L +NS   R PSSYK+    VP  ++  
Sbjct: 272 FLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEH 331

Query: 282 VI----NMILNKKVWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLF 337
           +     +M L+ K++    +G  DST++YSL    +  + + + K++W +S   D ++L 
Sbjct: 332 IKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNW-LSDSCDDVEL- 389

Query: 338 IKKKKVASAPSNEILIAIMSSYIYKD-RNIDGAMKILDKFIRMYPDISLDNMFWRRLIQW 396
                     +++I+IAI SSY+Y +  NI+ A K++ + I+ YPD+ L+   W R+I+W
Sbjct: 390 ----------TSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRW 439

Query: 397 CNRLWDPKIDRQGTFGYGCWNMMKNW-----NGAGTGKDVVLPYDFQIYEEFYRLFKRTN 451
             ++WD   D  G   Y  +  M  +     +   T K   +PY+  +  + Y LF    
Sbjct: 440 NIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLF---- 495

Query: 452 NGKIAAE----IVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQF--KKAAF 505
           N KI+      I+ N     L +    V   +  +L KYQ + + +LI  R+    K   
Sbjct: 496 NTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLD 555

Query: 506 FIEEWSIDRNNRIQLRE 522
           FIE++S+D NN+ QL E
Sbjct: 556 FIEKYSLDTNNKEQLLE 572

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  165 bits (417), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 120/445 (26%), Positives = 210/445 (47%), Gaps = 60/445 (13%)

Query: 123 NELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLK 182
           N  +  IN I  S  ++I+R+ +        E+I+++FE Y   I       +L  L ++
Sbjct: 89  NRFARLIN-IALSEKYNIQRIKERR-----PEIIFQLFETYVKLISSHE---ELTILQVE 139

Query: 183 DLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQ 242
           D+N FI  F++  QL KAQ V++Y+I     + +  D  T  N+L+L CG   + W    
Sbjct: 140 DMNKFINYFVEFKQLKKAQLVMKYLILKSPRVLEKYDVSTTRNYLKLNCGACHELWY--- 196

Query: 243 ASYAVTKQTKKNSRLSSNSPNTRFPSSYK-STVPNTVLFEVINMILNKKVWKSKHSGILD 301
                                    ++YK     NT L +++   L+ K+      G  D
Sbjct: 197 -------------------------TNYKIFDFNNTTLDKLVKYSLDNKI------GYWD 225

Query: 302 STIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIY 361
             I++SL ++ + + ++ +I + WGIS          +      AP +E+L AI++ + Y
Sbjct: 226 VEIIHSLGYSGRIRSLEDYILKKWGISLCDRA-----QVNTTNEAPESEVLEAIINGFFY 280

Query: 362 KDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKN 421
           +D+ +  A+KIL++F+ +YPD++L   FW+  +  C + WD K+D++G      W  MK 
Sbjct: 281 RDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVDQKGVVIVEYWETMKR 340

Query: 422 WNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELN 481
           W      +   +P++    +     FK+ NN  +A +I  N    +       +  +ELN
Sbjct: 341 WYTVHNRR---IPFNINFLKVMRTCFKKNNNLVLATDIFQNCF-HNFYFCATRMNDSELN 396

Query: 482 LLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTXXXX 541
           ++ +YQ   ++ LIE++ F  A  FI +      N+ QL   +  RK+  L+K++     
Sbjct: 397 VIKEYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQLMNYYHGRKEHKLKKMT----- 451

Query: 542 XXXXXXXXXXYDEMEEEDMIIGRLW 566
                     YD+M EED IIG+LW
Sbjct: 452 --RNENLEKTYDDMVEEDFIIGKLW 474

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  137 bits (345), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 140/553 (25%), Positives = 243/553 (43%), Gaps = 78/553 (14%)

Query: 29  LIKSKRITPI----STSRYEKHYSTTSVKYAIESELDSLVHSRNSNTIIKQSDVLPENIW 84
           +I ++RI P+     T+    +   +S+  A   E  ++  S +  TI   S V      
Sbjct: 6   IIITRRIPPLRRGLGTTSRALNSPASSIANATSKE-PTISISMDKGTIASNSRV---RFS 61

Query: 85  RNYLKNNEIDKFTLHLLASLRGDD--DFVKNLFKS--GDLTYNELSIFINRIYKSNGHDI 140
              LK NE +K+  H L   R  D    + N   S     T  E S+F+ ++      D+
Sbjct: 62  STLLKKNEFNKYE-HFLRGGRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMKDSDV 120

Query: 141 KRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQLSKA 200
                         +++++FE+Y      E     LNAL + DLN  I  FIK  QL + 
Sbjct: 121 N-----------VNVVFQLFEIYARMYCGEGS---LNALQIYDLNKLIKYFIKRDQLKQG 166

Query: 201 QNVLQYIIDAEGSIEKITDHDTMV---NFLRLRCGGLPKFWLVPQAS--YAVTKQTKKNS 255
           Q VL +II   G IE +  H  ++   N L+L+ G L K W     +  Y  ++Q + N 
Sbjct: 167 QIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRLNY 226

Query: 256 RLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQ 315
           +                 +    L ++ +++LN  +   K   +L ++I+YSL H  Q +
Sbjct: 227 KF----------------LDGWSLLKIADLVLNDPM---KCQNVLTNSIIYSLGHLRQVE 267

Query: 316 MMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDK 375
           ++D FI + W   +         + +     P    +IAI++SY Y   N+D +  +LD+
Sbjct: 268 LLDHFIDQMWMQET---------RPRNGLLYPDTNNIIAIITSYCYNYGNMDKSFDVLDR 318

Query: 376 FIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPY 435
            +  Y  +  D  FWRRL QWC  L +P  ++    G  CW++M+        K   + +
Sbjct: 319 ILEKYSGLKFDKFFWRRLFQWC-ILTEPNANKGFILG-QCWSLME--------KQEKVEF 368

Query: 436 DFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLI 495
           D  + E       +  +  +A  ++  ++I  L + N  + + ++ LL KYQ    + L 
Sbjct: 369 DGVLLELLREKIVKVRDVPLALRVLKMIVI-ELKKVNF-INELDMELLLKYQKFVFSKLG 426

Query: 496 ERRQFKKAAFFI--EEWSIDRNNRIQLREAFKKRKQLMLRKLSTXXXXXXXXXXXXXXYD 553
           E  +  KA   +  ++++I++ N+  +R  + + K+    +                 YD
Sbjct: 427 EINKTVKAMELLSCDDYTINKENKAFMRAYYFENKR----EKRKKNKRSNQYDDLQRKYD 482

Query: 554 EMEEEDMIIGRLW 566
           EM+EEDMIIG+LW
Sbjct: 483 EMDEEDMIIGKLW 495

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 119/429 (27%), Positives = 198/429 (46%), Gaps = 50/429 (11%)

Query: 115 FKSGDLTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGII 174
           + +  LT  + S+F+N++      DI+        L+ TE+   ++ +Y   +   + + 
Sbjct: 92  YSNEKLTPEDYSVFVNQLMDVYSKDIEL-------LNKTEVWKSLYHIYRVFV--VNAVD 142

Query: 175 KLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGL 234
             NA+ L DLN F+ +FI    L  A+NV Q I+    + E   D  T+  +LRL CG L
Sbjct: 143 DGNAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGAL 202

Query: 235 PKFWLVPQASYAVTKQTKKN-------SRLSSNSPNTRFPSSYKSTVPNTVLFEVINMIL 287
            + W         T QT +N       S   SN+ + R PS           F+   ++L
Sbjct: 203 SELW---------TTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQ---LLL 250

Query: 288 NKKVWKSKHSGI----LDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKV 343
            K V   ++S +    +DS I+ +L H  +   +  +I   +GI  +    +     KK+
Sbjct: 251 RKLVEDPEYSKLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKL 310

Query: 344 ASAPSNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDP 403
              P +++L +++S+Y + + NI   M ++  F+  YP+++LD  FWR  I W  R W+ 
Sbjct: 311 T--PDSQLLKSVISAYGH-NNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNK 367

Query: 404 KIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRL----FKRTNNGKI--AA 457
             D +G+     WN+M NW  A  GK V  P+D +I    YRL     ++ +N  I    
Sbjct: 368 YKDSKGSQPKKAWNLMLNW-YATIGKAV--PFDQKIM--LYRLSFLKSRKDHNAAIRDVQ 422

Query: 458 EIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNR 517
           ++   + I   +EKN  +   E  +L  YQ   +  L+ + +  K   FI EW ID  N 
Sbjct: 423 QVFKRIFIK--TEKNTFI--VERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENG 478

Query: 518 IQLREAFKK 526
             L   FK+
Sbjct: 479 RYLERYFKE 487

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 135/490 (27%), Positives = 215/490 (43%), Gaps = 62/490 (12%)

Query: 120 LTYNELSIFINRIYKSNGHDIKR----VIQNH--HSLSYTELIYEIFELYTSTIPKESGI 173
           L++ E+SIFI R+ K+    I      ++ N   + L   E+I+ +F +        +  
Sbjct: 154 LSHEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCNNTN- 212

Query: 174 IKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKIT---DHDTMVNFLRLR 230
            +LN L + DLN FI  F++E QL KAQ VL YIID  G IE++    D  T+ N L+L+
Sbjct: 213 -QLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKLK 271

Query: 231 CGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKK 290
            G + K W     S + T    + S L   S N +   +YK  +    L ++I+M+L  K
Sbjct: 272 NGAIYKNWKPLTDSESNTFLQYRLS-LEDKSHNFKGFKNYK-FLDGWSLLKIIDMVLTDK 329

Query: 291 VWKSKHS-GILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSN 349
                H   IL+ +I+YSL    Q + M+ FIK+ W +       +   +  K    P  
Sbjct: 330 T----HCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDKYNLPPDT 385

Query: 350 EILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISL----DNMFWRRLIQWCNRLWDPKI 405
             LIAI++SY    +++D A  +LDK I+ YP+       DN FW +++QW  ++ D   
Sbjct: 386 NELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGIKIADKNG 445

Query: 406 DR-QGTFGYGCWNMMKNWNGAGTGKDVVL------PYDFQIYEEFYRLFKRTNNGKIAAE 458
           +   GT    C  +M+ W   G  K  +        Y   +    + + K   N  I  +
Sbjct: 446 NNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGLK 505

Query: 459 IVSNVLIPHLSEKNVAVKKAELNLLNKY------------QTLAMNWLIERRQFKKAAFF 506
            + N            V+K +L  +NKY            Q      + E   + K    
Sbjct: 506 AIENF-----------VQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGLAL 554

Query: 507 IEEWSIDRNNRIQ--LREAF--------KKRKQLMLRKLSTXXXXXXXXXXXXXXYDEME 556
           I+  +  +N+ ++  LRE +         KR +    + +               YDE+E
Sbjct: 555 IDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDEIE 614

Query: 557 EEDMIIGRLW 566
           EE MIIG+LW
Sbjct: 615 EEGMIIGKLW 624

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  117 bits (293), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 111/421 (26%), Positives = 190/421 (45%), Gaps = 59/421 (14%)

Query: 113 NLFKSGDLTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELI---YEIFELYTSTIPK 169
           N+F     T  + S+ +NR+  S         QN+  L   E +   + IF  Y   I  
Sbjct: 78  NVFNILSPTAMQFSVLLNRVLAS---------QNYRHLDSKENVEKFFAIFMRYKGAIAL 128

Query: 170 ESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRL 229
           +S   KL  + L D NL    FI   QL KAQ ++ +++  +       D   + N+ +L
Sbjct: 129 QSN--KLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF----DVFMIKNYTKL 182

Query: 230 RCGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNK 289
           RCG             +  KQT  N              +YK    NTV F++I      
Sbjct: 183 RCGS------------SFGKQTLNNK-------------AYKVFDQNTV-FQLIG----- 211

Query: 290 KVWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHG---DPLDLFIKKKKVASA 346
           KV   +     ++ IV SL +T    +M+ +I + W IS H    + + +   ++  A  
Sbjct: 212 KVEADRKFAFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMY 271

Query: 347 PSNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKID 406
           PS+++L  I+SSY   D+ +  A+ I+++F + YP + L+  FW  L+    +    K  
Sbjct: 272 PSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSKDP 331

Query: 407 RQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIP 466
            Q      CWN+MK W+   T +  ++P+   +     R  ++T+N     +I+   L P
Sbjct: 332 SQFL---ACWNLMKKWH---TQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGP 385

Query: 467 HLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKK 526
            L  K   + + E ++L KYQ   +  L+++R++     FI++WSID +N+  L   ++ 
Sbjct: 386 -LYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYES 444

Query: 527 R 527
           R
Sbjct: 445 R 445

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  117 bits (292), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 112/427 (26%), Positives = 191/427 (44%), Gaps = 41/427 (9%)

Query: 158 EIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDA-----EG 212
           ++ ++Y S     +G   ++AL+  D+N FI  FI+ +QL +AQ  LQ+++D      E 
Sbjct: 145 KLMQIYISLTRTHNGG-SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED 203

Query: 213 SIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKS 272
            +    D  T+ +FL LR G L   W +  ++       KK +    N  +    S+Y +
Sbjct: 204 LLGPYGDKQTIAHFLMLRSGALQDLWKIDVSN----GNNKKQAFYKINGSHRNVKSTY-N 258

Query: 273 TVPNTVLFEVINMILNKKVWKSKHS-------GILDSTIVYSLAHTFQKQMMDGFIKEHW 325
            + +  LFE++  IL     K  HS       GIL + I+  L +  Q  +++  I + W
Sbjct: 259 VLDSVKLFEIVRYILRYND-KDNHSQPVYFDEGILKNVIL-CLGYVGQTTLIEDIINKIW 316

Query: 326 GISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISL 385
            + S   P        K     ++++L AI+S+Y    ++I   + I DKF    P+I +
Sbjct: 317 ELDSVSVP-------PKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIV 369

Query: 386 DNMFWRRLIQWCNRL---WDPKIDRQGTFGYGCWNMMKNW-NGAGTGKDVVLPYDFQ--I 439
            + FW  L +W   L   W   ID         W +MK+W N    G  +    +F   +
Sbjct: 370 KDDFWINLQKWNIILPNKWRSTID----LSKRTWELMKSWRNSTNNGGFITANVEFLNLV 425

Query: 440 YEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQ 499
           Y+     + +  + +   +I  + L+   S+ ++ V   E+ LL K+Q   +  ++    
Sbjct: 426 YKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVD--EIKLLKKFQIFTIKKMVYFGH 483

Query: 500 FKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTXXXXXXXXXXXXXXYDEMEEED 559
           + K   FI+EWS D  N+ QL   F   +   L+K                 YDE E+ED
Sbjct: 484 YSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQKRG--YNQEKEMTKVQKKYDEEEQED 541

Query: 560 MIIGRLW 566
           M++G LW
Sbjct: 542 MLLGGLW 548

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 90/414 (21%), Positives = 175/414 (42%), Gaps = 44/414 (10%)

Query: 125 LSIFINRIYKS--NGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLK 182
            S+FI+R+  +     D+K ++    +++  + +Y  +    +  P    I + +   L 
Sbjct: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAP----IGRPSPGRLH 188

Query: 183 DLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKIT-DHDTMVNFLRLRCGGLPKFWLVP 241
           D N F   F+ E++L  A+ V   ++     + K+  D +T++  L+L  G    FW  P
Sbjct: 189 DANSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDP 248

Query: 242 QASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILD 301
             S     Q    + ++         ++Y S    T+L  +  +  + + WKS  S  LD
Sbjct: 249 GNSVGRGGQLFTPAHMA-------VVTAYNSLGEETLLRLLRLLQSDPQ-WKSVCSPDLD 300

Query: 302 STIVYSLAHTFQKQM----MDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMS 357
             I+ +LA  F  ++                 HG P    +        P   ++ A+++
Sbjct: 301 RNIILALA--FHNRLDLVHAQAARYYAPAAPGHGLPSTPLL--------PDGALVGAVVT 350

Query: 358 SYIYKDRNIDG---AMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYG 414
           ++ +K +   G   A + LD+F  + P+   ++  W+ +  W  R        QG   Y 
Sbjct: 351 AFAFKHQLAQGLAIAYQFLDRFTHL-PN---EHELWKIIFTWLARRH--PTGSQGAALYD 404

Query: 415 -CWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNV 473
             W+ M+    A  G+    PYD+ I    YR+ +R ++ +    ++++ + P   +  V
Sbjct: 405 EAWSKMRT-RYAEHGQPT--PYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAV 461

Query: 474 AVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKR 527
           A +  +  LL K Q   +  L+  R+   AA F+++W++D   R  L E    R
Sbjct: 462 APR--DRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLEHIAAR 513

>TBLA0E02020 Chr5 complement(490462..491943) [1482 bp, 493 aa] {ON}
           Anc_7.324 YDL146W
          Length = 493

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 17/129 (13%)

Query: 94  DKFTLHLLASLRGD--DDFVKNLFKSGDLTYNELSIFINRIYKSNGHDIKRVI-QNHHSL 150
           D F   L+ ++R D  DD   N      L+ NE  I I R Y+ +    K +I    +S+
Sbjct: 201 DFFIYFLINTVRSDLTDDLYNNALFKLILSLNEQYIIIARTYEIDNKIFKYLISHTSNSM 260

Query: 151 SYTELIYEIF-------------ELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQ- 196
            + EL+   F             ++  S        I  N  +L DLN+F+ + I+E Q 
Sbjct: 261 EFIELLLLKFNRMMDRPLQIMMCKILYSIFTCTDDNISFNFFYLNDLNVFVDVLIRELQN 320

Query: 197 LSKAQNVLQ 205
           +S +Q +L+
Sbjct: 321 ISDSQEILR 329

>KLLA0F11121g Chr6 (1024978..1025856) [879 bp, 292 aa] {ON} similar
           to uniprot|Q6Q558 Saccharomyces cerevisiae YDR489W SLD5
           Subunit of the GINS complex (Sld5p Psf1p Psf2p Psf3p)
           which binds to DNA replication origins and facilitates
           assembly of the DNA replication machinery
          Length = 292

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 9/86 (10%)

Query: 157 YEIFELYTSTIPKESGIIKLNAL--------HLKDLNLFITIFIKEAQLSKAQNVLQYII 208
           Y I+    S +P  +G+ +L+ L        H+K  ++ + +F   A L      LQ + 
Sbjct: 150 YSIYLRQQSELPNNAGLSRLDLLMSKEEVKYHMKHSDILLKLF-NNAVLKHLPEELQAVN 208

Query: 209 DAEGSIEKITDHDTMVNFLRLRCGGL 234
           D EGSI  I + D       L CGG+
Sbjct: 209 DTEGSISMIDEPDWNKTVFILVCGGV 234

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 13/78 (16%)

Query: 431 VVLPYDFQIY----EEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKY 486
           + LPY+F+ +    E FYR+ K  N        + +++IP   ++ V VKK   ++LN Y
Sbjct: 431 ISLPYNFEQFQSKSEAFYRILKSLN--------IFDLIIPISIDEAVCVKKTPNDILNNY 482

Query: 487 QTLA-MNWLIERRQFKKA 503
            + + M   I R  FK+ 
Sbjct: 483 TSNSKMCEEIRREVFKET 500

>KLLA0F26499g Chr6 (2456560..2458689) [2130 bp, 709 aa] {ON} similar
           to uniprot|P36085 Saccharomyces cerevisiae YKL072W STB6
           and similar to uniprot|P46679 Saccharomyces cerevisiae
           YMR053c STB2
          Length = 709

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 58/136 (42%), Gaps = 20/136 (14%)

Query: 389 FWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFK 448
           +++ +++ C    DP I  + +F  G +N  K  N   T        D +   + +++  
Sbjct: 287 YFKFIVEDCISFKDPYI--ESSFYSGVYNFQKKHNLPKTSY-----LDIETMNKLFKVTS 339

Query: 449 RTNNG---KIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAF 505
           R N     K+   + S V       +++A K   + L N+  T  ++WLIE  Q      
Sbjct: 340 RANTTDIFKLKRALKSRV-------QDIARKVNPIQLANEILTTDLDWLIENVQGGYLGL 392

Query: 506 FIEEWSIDRNNRIQLR 521
           F   WS  R N+I L+
Sbjct: 393 F---WSGKRQNKITLQ 405

>SAKL0C08492g Chr3 complement(778821..780068) [1248 bp, 415 aa] {ON}
           similar to uniprot|P10849 Saccharomyces cerevisiae
           YDL044C MTF2 Mitochondrial matrix protein that interacts
           with an N-terminal region of mitochondrial RNA
           polymerase (Rpo41p) and couples RNA processing and
           translation to transcription
          Length = 415

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 67/165 (40%), Gaps = 26/165 (15%)

Query: 229 LRCGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFE-VINMIL 287
           L+C   P+   V   S   T+  ++   L+  SP   F SS+ STV    LFE +   I+
Sbjct: 2   LKCS--PRSTRVLARSVHCTRPLRQKPPLTDTSPG-HFKSSHVSTVQEKTLFEQIFAQIM 58

Query: 288 NKKVWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWG--ISSHGDPLDLFIKKKKVAS 345
            +   K K  G+L   +                   H G   ++  D L +  +KKK  +
Sbjct: 59  KRSEAKDKSKGLLRDAL-------------------HKGDPPAAENDNLQIVFEKKKEIT 99

Query: 346 APSNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFW 390
             + ++L     +   +  ++    K+    IR YP +SL + ++
Sbjct: 100 PENEKLLQFFKDTSGEQPGDVSDYAKLTTDDIRKYP-VSLTSTYF 143

>KLLA0D07590g Chr4 (652790..654859) [2070 bp, 689 aa] {ON} similar
           to uniprot|Q750H9 Ashbya gossypii AGL028C AGL028Cp and
           weakly similar to YFL013C uniprot|P43579 Saccharomyces
           cerevisiae YFL013C IES1 Subunit of the INO80 chromatin
           remodeling complex
          Length = 689

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 240 VPQASYAVTKQTKKNSRLSSNSPNTRFPS-SYKSTVPNTVLFEVINMILNKKVWKSKHSG 298
           +P +S    K  +K S +S++SPN+  PS S  S +P     E++    N++  KSKHS 
Sbjct: 54  MPDSSNDENKYYEKESTVSADSPNSALPSDSQHSVIPPPPPMELVQYPGNER--KSKHSH 111

Query: 299 ILD 301
            ++
Sbjct: 112 AMN 114

>Kpol_1036.87 s1036 (227517..229418) [1902 bp, 633 aa] {ON}
           (227517..229418) [1902 nt, 634 aa]
          Length = 633

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 403 PKIDRQGTFG---YGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEI 459
           P +D++   G   YG      N+N A + K   LP ++            +N   +  +I
Sbjct: 460 PILDQELEAGHNRYGTITQETNYNMARSNKLNTLPMNYNSSTTAPNTISNSNYNNLTPDI 519

Query: 460 VSNVLIP-HLSEKNVAVKKAELNLLNKYQTLAMNWLIE 496
           ++N +IP  L+ +N++V  A +   + +  +  N + E
Sbjct: 520 INNQMIPLRLAARNISVPPAHIQNSSNFSMIRSNQIQE 557

>TBLA0C00420 Chr3 (76048..78897) [2850 bp, 949 aa] {ON} Anc_8.20
           YLR067C
          Length = 949

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 6/85 (7%)

Query: 316 MMDGFIKEHWGISSHGDPLDLF--IKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKIL 373
           ++   +  H+ +      L  +   +K  V  +PS    IAIM     K   IDGA+K L
Sbjct: 372 ILQALLFAHYSVGDMNGCLSQYELFRKYSVKPSPST---IAIMLKVHMKISGIDGALKFL 428

Query: 374 DKFIRMYPDISLDNMFWRRLIQWCN 398
            + +   PD+ +D   +  LI  C+
Sbjct: 429 KRILDSDPDL-IDEKHFSSLINMCS 452

>KAFR0A06530 Chr1 (1320422..1324123) [3702 bp, 1233 aa] {ON}
           Anc_4.129 YAL002W
          Length = 1233

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 15/77 (19%)

Query: 294 SKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILI 353
           ++H+G+L S              +DG I  H G  S    LD     KK+ S PSNEIL+
Sbjct: 145 NRHTGLLVSD-------------LDGNITFHNGYRSRLWYLDY--TSKKILSIPSNEILL 189

Query: 354 AIMSSYIYKDRNIDGAM 370
              S    K++++D  +
Sbjct: 190 NCKSQLFIKNKDVDNGL 206

>KAFR0B02410 Chr2 complement(467555..473848) [6294 bp, 2097 aa] {ON}
           Anc_8.207 YER155C
          Length = 2097

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 56/127 (44%), Gaps = 21/127 (16%)

Query: 25  FGLTLIKSKRITPISTSRYEKHYSTTSVKYA-IESELDSLVHSRNSNTIIKQSDVLPENI 83
           FGLT  K K              ++ S++Y  I S  D+L+  R +  +    DVLP   
Sbjct: 451 FGLTFTKHK-----------SKLTSESLQYCNISSTSDNLMTDRLALVVKTLLDVLP--- 496

Query: 84  WRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFK-SGDLTYNE---LSIFINRIYKSNGHD 139
              YL +NEI   TL LL +L   +D V N  K S    +NE   L+ F+N    +   D
Sbjct: 497 --GYLLDNEIFHATLQLLDTLSLHNDEVSNRLKISVADKHNELTKLTSFVNSRDTTTNAD 554

Query: 140 IKRVIQN 146
           I   I N
Sbjct: 555 ITDSILN 561

>TBLA0G02340 Chr7 complement(603351..604850) [1500 bp, 499 aa]
          {ON} Anc_2.546 YKL035W
          Length = 499

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 44 EKHYSTTSVKYAIESELDSLVHSRNSNTIIKQSDVLPENIWRNYLKNNEIDKF 96
          +KH  T S  YA ES   ++  S+  N + K SD LP +  R    +NE+D F
Sbjct: 4  KKHIKTQS-SYAFESNTSNVAASQMRNALNKLSDSLPVDDPRRARFDNELDSF 55

>SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 833

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 154 ELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGS 213
           +L+  + E+    +P   G++ +N+  LKDL      F  + Q S   N+LQY+ +A G+
Sbjct: 684 DLLNRMKEVNPFCVPTCKGLLDINSSLLKDL------FDNQVQSSNHTNILQYLQNATGT 737

Query: 214 IEKITD 219
               TD
Sbjct: 738 QLDDTD 743

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,673,036
Number of extensions: 2865979
Number of successful extensions: 9851
Number of sequences better than 10.0: 71
Number of HSP's gapped: 10132
Number of HSP's successfully gapped: 72
Length of query: 566
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 451
Effective length of database: 40,294,809
Effective search space: 18172958859
Effective search space used: 18172958859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)