Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.28.848ON49149124500.0
TPHA0I003008.848ON49349313900.0
Suva_13.4728.848ON51048913890.0
YMR283C (RIT1)8.848ON51348913810.0
KAFR0B039808.848ON48348313500.0
Smik_13.4968.848ON49448913500.0
TDEL0A079708.848ON48949213460.0
Skud_13.4558.848ON49448913460.0
SAKL0D01276g8.848ON50247013051e-176
NCAS0C003508.848ON48648412991e-176
ZYRO0G14344g8.848ON47248512921e-175
NDAI0K003508.848ON50450312901e-174
KNAG0J002208.848ON49948812891e-174
Ecym_46238.848ON48048512291e-165
KLTH0C03696g8.848ON47448412131e-163
Kwal_27.102198.848ON50048512091e-162
KLLA0D01386g8.848ON48948712041e-161
AFR451C8.848ON40842410061e-133
Ecym_45145.443ON124699741.9
TBLA0A051801.50ON67688722.9
KLTH0D14146g4.240ON132354698.4
TDEL0D049903.124ON2972124698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.2
         (491 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   948   0.0  
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   540   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   539   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   536   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   524   0.0  
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   524   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   523   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   523   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   507   e-176
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   504   e-176
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   502   e-175
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   501   e-174
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   501   e-174
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   478   e-165
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   471   e-163
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   470   e-162
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   468   e-161
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   392   e-133
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    33   1.9  
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...    32   2.9  
KLTH0D14146g Chr4 complement(1159134..1163105) [3972 bp, 1323 aa...    31   8.4  
TDEL0D04990 Chr4 complement(901423..910341) [8919 bp, 2972 aa] {...    31   8.7  

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/491 (95%), Positives = 467/491 (95%)

Query: 1   MVSKVEDDYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGL 60
           MVSKVEDDYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDT            NERCGL
Sbjct: 1   MVSKVEDDYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGL 60

Query: 61  WYCNPKLFEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDA 120
           WYCNPKLFEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDA
Sbjct: 61  WYCNPKLFEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDA 120

Query: 121 LSKTVPIWCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKL 180
           LSKTVPIWCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKL
Sbjct: 121 LSKTVPIWCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKL 180

Query: 181 AIIDGSDLYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCT 240
           AIIDGSDLYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVW            LCT
Sbjct: 181 AIIDGSDLYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIILCT 240

Query: 241 VSYRAQDGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVED 300
           VSYRAQDGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVED
Sbjct: 241 VSYRAQDGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVED 300

Query: 301 LLAAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSES 360
           LLAAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSES
Sbjct: 301 LLAAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSES 360

Query: 361 CKLSVSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILI 420
           CKLSVSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILI
Sbjct: 361 CKLSVSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILI 420

Query: 421 CCNSGTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT 480
           CCNSGTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT
Sbjct: 421 CCNSGTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT 480

Query: 481 LNSVNEYLMSN 491
           LNSVNEYLMSN
Sbjct: 481 LNSVNEYLMSN 491

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/493 (56%), Positives = 347/493 (70%), Gaps = 12/493 (2%)

Query: 7   DDYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPK 66
           DD S+NQI KDI+KE KSLKNRI SILLD++FL D             NERCGLWYC   
Sbjct: 3   DDASVNQITKDIRKENKSLKNRIHSILLDSKFL-DEKVIPFFPYPLVPNERCGLWYCKRA 61

Query: 67  LFEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVP 126
            F  TSYFKSTDGHINQWDFSTRRLNFHL+P + +  GI+I+DSTRRGKKIPDALSKTVP
Sbjct: 62  NFTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVP 121

Query: 127 IWCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGS 186
           IWCAVLN+++L+  +   D   +VLFVPP+TV  SEY+RI  K+P L+E+L KL +IDG 
Sbjct: 122 IWCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGK 181

Query: 187 DLYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGE-STNDVWXX-XXXXXXXXXXLCTVSYR 244
            LY+QF G LLRPIWIHPGSS+LQS  D FTGE  +N  W             LCTVSY+
Sbjct: 182 KLYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQ 241

Query: 245 AQDGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAA 304
            QDGVD R GFTYVQGAADDHELWSHGL+P +FWDNIE  N+L+ SE++L+  VE++L +
Sbjct: 242 VQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEILLS 301

Query: 305 KQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364
           +  +++  E    F  +D IT +++LG I DGL I  +L       +S+VI+ S S KL+
Sbjct: 302 ESMKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLA 361

Query: 365 VSKNEEKI-------TQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELP 417
             +  E+        T  I + +LQSGSKKSSK LR  LPE+   +    S+    ++ P
Sbjct: 362 SDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSS-GSTKKP 420

Query: 418 ILICCNSGTDMSIALVLMLLCKHYDLDW-NTSKPNEVNKIIIRKHLTKLISHLKGRNVNP 476
           IL+CCN+G+DMSIA++L+ L K Y  +W  TS+  E+NKI IRKHLTK+ISHL GRNVNP
Sbjct: 421 ILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNP 480

Query: 477 SRATLNSVNEYLM 489
           SRATLNSVN++LM
Sbjct: 481 SRATLNSVNDFLM 493

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/489 (56%), Positives = 342/489 (69%), Gaps = 11/489 (2%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           S++QI+KD++KE KS++NR+QSILLD RFL D             NERCGLWYC P  FE
Sbjct: 24  SLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGLWYCEPSSFE 83

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           QTSYFKSTDGH+NQWDFSTRRLNFHLL  + +N GI+IVDSTRRGKKIPDALSKTVPIWC
Sbjct: 84  QTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDALSKTVPIWC 143

Query: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189
           AVLN++ML+  ++ N D  KVL+VPP TVP SEY  I +K+P L+++L KL  ID   L 
Sbjct: 144 AVLNTIMLQETEE-NVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLNAIDSKTLN 202

Query: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGE-STNDVWXXXXXXXXXXXXLCTVSYRAQDG 248
           K F GK+LRPIW+HPGSSLL  + D FTGE    ++W            LCTVSY+AQDG
Sbjct: 203 KLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCTVSYQAQDG 262

Query: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAK--- 305
           +DKR+GFTYVQGAADDHELWS GL+  MFW +I+   D + S+D L + + DL+  K   
Sbjct: 263 MDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIGKKLEY 322

Query: 306 QKEVSETETL-EAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364
           Q  + +   L + F  +D IT +I LGK+  GL I + L  EL   +  VI+FS S  ++
Sbjct: 323 QLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVIIFSNSVAIA 382

Query: 365 V---SKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILIC 421
               S  E +    I + +LQSG KKSSKALR T P +H  ++P F+ + AK   PIL+C
Sbjct: 383 AHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFA-NPAKGMKPILVC 441

Query: 422 CNSGTDMSIALVLMLLCKHYDLDWN-TSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT 480
           CN+GTDMSI ++L +LC  Y+ +W  TS+   VNKIIIRKHLTKLISHL GRNVNPSRAT
Sbjct: 442 CNTGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGRNVNPSRAT 501

Query: 481 LNSVNEYLM 489
           LNSVN +LM
Sbjct: 502 LNSVNSFLM 510

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/489 (56%), Positives = 348/489 (71%), Gaps = 11/489 (2%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           S++QI+KDI+KE KS++NR+QSILLD +FL+D             NERCGLWYCNP  F+
Sbjct: 27  SLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYCNPSSFK 86

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           QTSYFKSTDGH+NQWDFSTRRLNFHLL T+  N GI+IVDSTRRGKKIPDALSKTVPIWC
Sbjct: 87  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 146

Query: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189
           AVLN+LML+  ++ N    KVL++PP TVP SEY  I +K+P L+ +L KL IID   L 
Sbjct: 147 AVLNTLMLQETEK-NVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLN 205

Query: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTN-DVWXXXXXXXXXXXXLCTVSYRAQDG 248
           + F GKLLRPIW+HPGSSLL  + D FTGE    + W            LCTVSY+AQDG
Sbjct: 206 ELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSYQAQDG 265

Query: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAK--- 305
           +DKR+GFTYVQGAADDHELWS GL+ +MFW +IE   D   S+D L   + DL AAK   
Sbjct: 266 MDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLRN 325

Query: 306 QKEVSETETL-EAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364
           Q  + +  +L E F  +D IT +I LGK++ GL I  +L  +L S++  VI+FS S  ++
Sbjct: 326 QCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTVA 385

Query: 365 VSKNEEKITQR---IVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILIC 421
              ++E+ +     I I +LQSG KKSSKALR T P +H  I+  F T++ +   P+LIC
Sbjct: 386 EDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLF-TNRDEKIKPMLIC 444

Query: 422 CNSGTDMSIALVLMLLCKHYDLDWN-TSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT 480
           CN+GTDMSI ++L +LC  Y  +W  TS+  +++K+I+RKHLTKLISHLKGRNVNPSRAT
Sbjct: 445 CNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVNPSRAT 504

Query: 481 LNSVNEYLM 489
           LNSVN +LM
Sbjct: 505 LNSVNSFLM 513

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/483 (56%), Positives = 340/483 (70%), Gaps = 5/483 (1%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           S++ I KDIK EY+SLKNR+QSI+LD  FLE+             NERCGLWYC+PK FE
Sbjct: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           QTSYFKSTDGHINQWDFSTRRLNFHLLP LA++ GI+IVDSTRRGKKIPDALSKT+PIWC
Sbjct: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122

Query: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189
           AVLN L+LE       DY KVLFVPP+TV NSEY RIL+K+  L+ +L  L ++   +LY
Sbjct: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182

Query: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCTVSYRAQDGV 249
              NGKL+RP W++PGSSLL +  D FTGE T + W            LCTVSY+AQDGV
Sbjct: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDGV 242

Query: 250 DKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDL-LAAKQKE 308
           DKR GF YVQGAADDHELWS GL P  FW+NI+  ND+ +++ +L+  V+ L L    ++
Sbjct: 243 DKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENHEK 302

Query: 309 VSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSVSKN 368
            + +  ++ F  L+ +T +I LGKI D  +I   L  EL  KFS+VI+ SE+  + ++K 
Sbjct: 303 KASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSET--IEITKL 360

Query: 369 EEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSGTDM 428
           EE  T+ I + +LQSGSKKSSK+LR  LPE+   I P+F      ++ PILICCNSG DM
Sbjct: 361 EEATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILICCNSGNDM 420

Query: 429 SIALVLMLLCKHYDLDWN--TSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVNE 486
           S+A++L +L K Y   W   TS    ++K +IRKHL KLIS L+GRNVNPSRATLNS+N 
Sbjct: 421 SVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480

Query: 487 YLM 489
           YLM
Sbjct: 481 YLM 483

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/489 (54%), Positives = 343/489 (70%), Gaps = 11/489 (2%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           S+ +I++D++KE KS++NR+QSILLD +FL+D             NERCG+WYC P  ++
Sbjct: 8   SLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYK 67

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           QTSYFKSTDGH+NQWDFSTRRLNFHLL T+  N GI+IVDSTRRGKKIPDALSKTVPIWC
Sbjct: 68  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 127

Query: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189
           AVLN++ML+  ++ N D  K L++PP TVP SEY  I +K+P L+ +L KL IID   L 
Sbjct: 128 AVLNTIMLQETEE-NFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLN 186

Query: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGE-STNDVWXXXXXXXXXXXXLCTVSYRAQDG 248
           + F GK+LRPIW+HPGSSLL  + D FTGE   ++ W            LCTVSY+AQDG
Sbjct: 187 ELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQDG 246

Query: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAK--- 305
           +DKR+GFTYVQGAADDHELWS GL+  MFW ++E   D + S+D L   + DL+A K   
Sbjct: 247 MDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLKS 306

Query: 306 QKEVSETETL-EAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364
           Q  + +   L E F  +D IT +I LGK+  GL I + L  EL S++  V++ S+S  ++
Sbjct: 307 QMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTVA 366

Query: 365 VSKNEEKITQR---IVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILIC 421
                 + T+    I + +LQSG KKSSKALR  LP++H  +E  F+ ++A+   P+L+C
Sbjct: 367 EDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFA-NRAEEMRPMLVC 425

Query: 422 CNSGTDMSIALVLMLLCKHYDLDWN-TSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT 480
           CN+GTDMSI ++L +LC  Y  +W  T +  EVNKIIIRKHLTKLISHL GRNVNPSRAT
Sbjct: 426 CNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVNPSRAT 485

Query: 481 LNSVNEYLM 489
           LNSVN +LM
Sbjct: 486 LNSVNSFLM 494

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/492 (54%), Positives = 342/492 (69%), Gaps = 7/492 (1%)

Query: 1   MVSKVEDDY--SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERC 58
           +V ++++++  S+  I+KDIKKEYKSL+NR+QSILLD  FL               NERC
Sbjct: 2   VVDQMDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERC 61

Query: 59  GLWYCNPKLFEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIP 118
           GLWYCNPK F QTSYFKSTDGH NQWDFS+RRLNFH++PT+A++ GI+IVDSTRRGKK+P
Sbjct: 62  GLWYCNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVP 121

Query: 119 DALSKTVPIWCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLN 178
           DALSKT+PIWCAVLN LMLES  Q      + L+VPP TV  SE+  I  ++P L+E+L 
Sbjct: 122 DALSKTIPIWCAVLNHLMLES--QGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLK 179

Query: 179 KLAIIDGSDLYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXL 238
            L +I+G +L+KQ  GKLLRP WI+PGSS+LQSTTDIFTGE T+D W            L
Sbjct: 180 SLEVINGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKW-IPVDNSIIPIIL 238

Query: 239 CTVSYRAQDGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTV 298
           CTVSY+AQDGVDKR GFTYVQGAADDHELWSHGLN  +FW NI+   + + SE+ L+  V
Sbjct: 239 CTVSYQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFV 298

Query: 299 EDLLAAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFS 358
             L         E +  +AF  +D++T ++ LG + D L     L  E+    S+VIV S
Sbjct: 299 SQLSLRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLS 358

Query: 359 ESCKLSVSKNE-EKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELP 417
           +S        E E  ++ I I++LQSGSK SS+ L+  L ++   IE     D  K   P
Sbjct: 359 QSVNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHI-LDLDKQRKP 417

Query: 418 ILICCNSGTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPS 477
           +LICCNSGTDMSI L+L++LC++Y++DW  + P  V+KI+++KHL KLISHLKGRNVNP 
Sbjct: 418 VLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPP 477

Query: 478 RATLNSVNEYLM 489
           RATLNSVN YLM
Sbjct: 478 RATLNSVNSYLM 489

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/489 (53%), Positives = 342/489 (69%), Gaps = 11/489 (2%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           S++QI+KD+++E KS++NR+QSILLD +FL++             NERCGLWYC P  F+
Sbjct: 8   SLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWYCEPSTFK 67

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           +TSYFKSTDGH+NQWDFSTRRLNFHLL T+    GI+I+DSTRRGKKIPD+LSKTVPIWC
Sbjct: 68  RTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLSKTVPIWC 127

Query: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189
           AVLN++ML+  ++ + D  KVL+VPP TVP SEY  I +K+P L+ +L KL ++D   L 
Sbjct: 128 AVLNTIMLQK-EKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVVDSEKLN 186

Query: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGE-STNDVWXXXXXXXXXXXXLCTVSYRAQDG 248
             F GK+LRPIW+HPGSSLL  + D FTGE    + W            LCTVSY+AQDG
Sbjct: 187 DLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVSYQAQDG 246

Query: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAK--- 305
           +DKR+GFTYVQGAADDHELWS GL+ +MFW +++   D D+S+D L   + DL+A K   
Sbjct: 247 MDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLVAKKLEN 306

Query: 306 QKEVSETETL-EAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364
           Q  + +  +L E F  +D+IT +I LGK+  GL I   L  EL  ++  VIVFS+S  ++
Sbjct: 307 QLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFSDSVAIT 366

Query: 365 VSKNEEKITQR---IVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILIC 421
              + E+ +     I + +LQSG KKSSK LR   P +H  ++  F+     ++ PILIC
Sbjct: 367 EDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTK-PILIC 425

Query: 422 CNSGTDMSIALVLMLLCKHYDLDWN-TSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRAT 480
           CN+GTDMSI ++L +LC  Y  DW  T +  EVNKIIIR+HLTKLISHL+GRNVNPSRAT
Sbjct: 426 CNTGTDMSIGVILSILCTKYTEDWKLTPELPEVNKIIIRRHLTKLISHLRGRNVNPSRAT 485

Query: 481 LNSVNEYLM 489
           LNSVN +LM
Sbjct: 486 LNSVNSFLM 494

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  507 bits (1305), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 260/470 (55%), Positives = 324/470 (68%), Gaps = 18/470 (3%)

Query: 24  SLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFEQTSYFKSTDGHINQ 83
           SL+NR+QSI+ D +FL               NERCGLWYCNP+ F Q SYFKSTDGHINQ
Sbjct: 47  SLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQ 106

Query: 84  WDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWCAVLNSLMLESVDQL 143
           WDFSTRRLNFHLLP++AQ+GGIVI+DSTRRGKKIPDALSKT+PIWCAV+N+L+LE+ ++ 
Sbjct: 107 WDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASNRS 166

Query: 144 NDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLYKQFNGKLLRPIWIH 203
            +    VLF PP TVP SEY RI  ++P L+E+L  L I+ G +L KQF GK+LRP+W++
Sbjct: 167 EE----VLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVY 222

Query: 204 PGSSLLQSTTDIFTGEST-NDVWXXXXXXXXXXXXLCTVSYRAQDGVDKRHGFTYVQGAA 262
           PGSSL  S+TDIFTG+ T +  W            LCT SY+ QDGVDKR+GFTYVQGAA
Sbjct: 223 PGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGAA 282

Query: 263 DDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDL---LAAKQKEVSETETLEAFN 319
           DDHELW+ GL PDMFWDN     D  +SE  L   V         + KE S  +  + F+
Sbjct: 283 DDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREATERTKEASGNDLNQCFS 342

Query: 320 PLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSVSKNEEKITQRIVIN 379
            +D IT ++ LG + DGL + + L S+L S++++ +V SES K++ S  E   T+   I 
Sbjct: 343 -VDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIA-SIQENPNTK---IF 397

Query: 380 QLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSGTDMSIALVLMLLCK 439
            L SG+KKSSK LR  L E+   I+   +     S LPILICCN+G DMS+ ++L  LC+
Sbjct: 398 PLTSGNKKSSKELRSKLIEICPLIQASLN-----SPLPILICCNTGKDMSVGVLLATLCQ 452

Query: 440 HYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVNEYLM 489
           +YD DW    PN  NK IIRKHLT+LISHLKGRNVNPSRATLNSVN YLM
Sbjct: 453 NYDEDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYLM 502

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  504 bits (1299), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 258/484 (53%), Positives = 334/484 (69%), Gaps = 9/484 (1%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           S+ QI+KDI+KE KS++NR+QSILLD +FL D             NERCGLWY  P+ F+
Sbjct: 8   SLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPEDFK 67

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           QTSYFKSTDGH NQWDFSTRRLNFHL PTL  +GGI+IVDSTRRGKKIPDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPIWC 127

Query: 130 AVLNSLMLESVDQLND-DYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDL 188
           AVLN +ML S    +D D + VLF PP T+  +EY  I +++P L+ +L KL I+DG++L
Sbjct: 128 AVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGNEL 187

Query: 189 YKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCTVSYRAQDG 248
           +    GKLLRP W++PGSSLLQS+ D+FTGE T D W            LCT+SYRAQDG
Sbjct: 188 FILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQDG 247

Query: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQKE 308
            DKRHGFTYVQGAADDHELWS GL P +FW +I  F +++ +E+ +   VE L+  +   
Sbjct: 248 HDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQDDA 307

Query: 309 VSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSVSKN 368
             +++  +AF+ +D +T  + LGKI D ++IG  L  +L  +F++ I+ SE+ +L    N
Sbjct: 308 GEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVELDPVDN 367

Query: 369 EE-KITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSGTD 427
           E   I+  I   +LQSGSKKSSK LR  + E+   +E   +    K   PILICCN+GTD
Sbjct: 368 ENLPISTHIF--KLQSGSKKSSKLLRNKIEEIIGLVESQMNNALNK---PILICCNTGTD 422

Query: 428 MSIALVLMLLCKHYDLDW--NTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVN 485
           MSI ++L LLC++Y   W     +   ++KI+IRK LT+LISHL+GR +N SRATLNSVN
Sbjct: 423 MSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNSVN 482

Query: 486 EYLM 489
            YLM
Sbjct: 483 NYLM 486

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  502 bits (1292), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 258/485 (53%), Positives = 327/485 (67%), Gaps = 23/485 (4%)

Query: 9   YSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLF 68
           +S+NQI++DIKKEY SL+NRIQSIL D  F+               NERCGLWYC+PK F
Sbjct: 7   FSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDF 66

Query: 69  EQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIW 128
           +QTSYFKSTDGH NQWDFSTRRLN HLLP L +  GI+IVDSTRRGK +PDALSKT+PIW
Sbjct: 67  DQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIW 126

Query: 129 CAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDL 188
           CAVLNSLM         D S+VLF PP  V  SE+  I  ++P L++RL KL I+D  DL
Sbjct: 127 CAVLNSLM-------QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDL 179

Query: 189 YKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCTVSYRAQDG 248
             +F GK+LRP W++PGS +L+S+TD FTGE     W            LCT SYRAQDG
Sbjct: 180 RNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDG 239

Query: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQKE 308
           VDKRHGFTYVQGAADDHELWS GL+P + W+N   F+DLDR++  L+S V+ L+     E
Sbjct: 240 VDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLI-----E 294

Query: 309 VSET----ETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364
           ++ET      L     +D IT ++ LGK+ D   I  ++  EL S+FS+VI+ S+S  LS
Sbjct: 295 LAETTDHRNHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLS 354

Query: 365 VSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNS 424
                 K    I    LQSGSK+SSK LR  L E+   +    + D  K + PI++CCNS
Sbjct: 355 ------KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRK-PIMVCCNS 407

Query: 425 GTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSV 484
           GTD+S+ ++LM+LCK+Y  DW   KP+ VNK +IR+HL ++I+ +K RNVNPSRATLNS+
Sbjct: 408 GTDISVGVILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSI 467

Query: 485 NEYLM 489
           N +LM
Sbjct: 468 NSFLM 472

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  501 bits (1290), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 263/503 (52%), Positives = 340/503 (67%), Gaps = 30/503 (5%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           S++QI+KDIKKEYKSL+NR+QSILLD  FL D             NERCGLWY +P  + 
Sbjct: 9   SLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYN 68

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           QTSYFKSTDGH NQWDFSTRRLNFHLL T+A++ GI I+DSTRRGKKIPDALSKT+PIWC
Sbjct: 69  QTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWC 128

Query: 130 AVLNSLMLESVDQLND--DYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSD 187
           AVLN +ML  +   ND       LFVPP+TVP SEY  IL+K+P L+E+L+KL II+ ++
Sbjct: 129 AVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANE 188

Query: 188 LYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDV-WXXXXXXXXXXXXLCTVSYRAQ 246
           L   F+GKLLRP+WI+PGSS+L S+ D+FTGE T  + W            LCT+SY+AQ
Sbjct: 189 LISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAW--EAPENIIPIVLCTISYQAQ 246

Query: 247 DGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQ 306
           DGVDKR+GFTYVQGAADDHELWS GL P++FW +I    +   S+D L   V  ++  K 
Sbjct: 247 DGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMKI 306

Query: 307 KEVSETE---TLEAFNP--LDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESC 361
           K+ +      T++A  P  +D IT +I LGKI + + I  S+  E    FS+V++ SE+ 
Sbjct: 307 KDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSETV 366

Query: 362 KLSVSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILIC 421
            L+    +E+ +  + I +L SGSKKSSK LR  +P+++  +    +  K     PILIC
Sbjct: 367 TLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGK-----PILIC 421

Query: 422 CNSGTDMSIALVLMLLCKHYDLDWNTSKP---------------NEVNKIIIRKHLTKLI 466
           CN+GTD+SI ++L +LCK+Y LD +  K                  ++K IIRK+LT LI
Sbjct: 422 CNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLI 481

Query: 467 SHLKGRNVNPSRATLNSVNEYLM 489
           SHL+GRNVNPSRATLNSVN+YLM
Sbjct: 482 SHLEGRNVNPSRATLNSVNDYLM 504

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  501 bits (1289), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 259/488 (53%), Positives = 331/488 (67%), Gaps = 15/488 (3%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           S+ QI K++K++ +SL+NR+QSILLD  FLE              NERCGLWYCNP  F 
Sbjct: 19  SLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYCNPSHFA 78

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           QTSYFKSTDGH NQWDFSTRRLNFHLLPTL + GG+VIVDSTRRGKKIPDALSKTVP+WC
Sbjct: 79  QTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPLWC 138

Query: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189
           AVLNSLMLESV +   + + VLFVPP TVP SE  ++ KKLP L+E+L  L + DG+   
Sbjct: 139 AVLNSLMLESVGK-KFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTKTS 197

Query: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCTVSYRAQDGV 249
           +  +GKLLRP W+ PGSSLLQS TDIFTGE   + W            LCTVSY+AQDG+
Sbjct: 198 RMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQAQDGI 257

Query: 250 DKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAK---- 305
           DKR+GFTYVQGAADDHELWSHGL  ++FW NI++F +L   +  L   V+ ++  +    
Sbjct: 258 DKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQNNNM 317

Query: 306 QKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSV 365
           Q+        +    +D +T+ + LG+I D + +     ++L   +S VIV SE+  L  
Sbjct: 318 QRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVHL-- 375

Query: 366 SKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSG 425
            K+  +  + + I +L SGSKKSSK LR  LP++   I         K   P+LICCN+G
Sbjct: 376 DKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIK---PLLICCNTG 432

Query: 426 TDMSIALVLMLLCKHYDLDWNT----SKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATL 481
            DMSI ++L +LC++YD  W+      KP+ V+KI+IR+HLTKLI+HL GRNVNPSRATL
Sbjct: 433 KDMSIGVLLAVLCQNYDEVWDLLPEDVKPS-VSKIVIRRHLTKLIAHLNGRNVNPSRATL 491

Query: 482 NSVNEYLM 489
           NS+N +LM
Sbjct: 492 NSINSFLM 499

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  478 bits (1229), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 235/485 (48%), Positives = 326/485 (67%), Gaps = 18/485 (3%)

Query: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFE 69
           ++ QI K+I+++  SL+NR+QS+  D++F+ +             NERCGLWYCNP  +E
Sbjct: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68

Query: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129
           QT YFKSTDGH NQWDFSTRRLNFH+L  +A+ GGI+IVDSTRRGKK+PDALSKT+PIWC
Sbjct: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128

Query: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189
           AVLN+LML+   +  +D    LF PP TV   E+  I  K+P L+E+L KL II G +LY
Sbjct: 129 AVLNNLMLDYKGK--EDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELY 186

Query: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCTVSYRAQDGV 249
             F GK+LRP W++PGS LL ++ DIFTGE   +VW            LCT SY+ QDG 
Sbjct: 187 NMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVW--QSEQNSIPVILCTASYQCQDGE 244

Query: 250 DKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDL-----LAA 304
           DK HGFTYVQGAADDHELW++GLNP++FW NIE   D D+SE  L+  V+ +     L A
Sbjct: 245 DKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKLTA 304

Query: 305 KQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364
           +  + S+ E+  +F  +D IT +++LG +A+G+ + +++  EL SK+S+ I+    C  S
Sbjct: 305 QSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCII----CSQS 360

Query: 365 VSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNS 424
           V+   +   +RI +  + + SKKSS+ LR  L E+   I+   +      +LPILICCN+
Sbjct: 361 VTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHIT-----DQLPILICCNT 415

Query: 425 GTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSV 484
           G D+SI ++L  LC+HYDL W+  +   VNK I++KHL ++I+ L G N+NPSR+TL +V
Sbjct: 416 GKDISIGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNV 475

Query: 485 NEYLM 489
           N +L+
Sbjct: 476 NAFLL 480

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  471 bits (1213), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 237/484 (48%), Positives = 333/484 (68%), Gaps = 17/484 (3%)

Query: 8   DYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKL 67
           D +IN ++++IKKEY+SL+NR+QSI+ D +FL++             NERCG+WYC+PK 
Sbjct: 6   DQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKD 65

Query: 68  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPI 127
           + QTSYFKSTDGH NQWDFS RRLNFHLLP LA +GGIV+VDSTRRGK++PDALSKTVPI
Sbjct: 66  YLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPI 125

Query: 128 WCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSD 187
           WCAVLNSL+LE          +VLF PP TV   E++RI  ++P L+ +  K+ I+ G+D
Sbjct: 126 WCAVLNSLLLE----YQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGAD 181

Query: 188 LYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCTVSYRAQD 247
           + + F GK+LRP+W+ PG+SLL S  D FTGE  +  W            LCTVSY+ QD
Sbjct: 182 IDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQD 241

Query: 248 GVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQK 307
           GVDKRHGFTYVQGAADDHELW+ GL  ++FW +I   ++++ S+  L+S VED +  ++ 
Sbjct: 242 GVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEP 301

Query: 308 EVSETE-TLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSVS 366
             +E   +L+     D++T ++ LGKI+  + +G+ L  EL  K+S+VI+ S +  +++S
Sbjct: 302 NSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNT--VTLS 359

Query: 367 KNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSGT 426
           ++E  I     I +LQS  KKSSKALR  L ++    E +       + LP+L+CCN+G 
Sbjct: 360 EDEAAIK----IFKLQSECKKSSKALRTELIKICPLAEAYLP-----NSLPMLVCCNTGK 410

Query: 427 DMSIALVLMLLCKHYDL-DWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVN 485
           DMS+ + L +LC++Y++  W+ +    ++KI I+KHL+K+I+ L+GRNVNP RA+LNSVN
Sbjct: 411 DMSVCVSLAILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVN 470

Query: 486 EYLM 489
            YLM
Sbjct: 471 AYLM 474

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  470 bits (1209), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 240/485 (49%), Positives = 328/485 (67%), Gaps = 19/485 (3%)

Query: 8   DYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKL 67
           D ++N ++K+IKKE K+L+NR+QSIL D RFLE+             NERCGLWYC+P+ 
Sbjct: 32  DQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPER 91

Query: 68  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPI 127
           + QTSYFKSTDGH NQWDFS RRLN HLLPT+ Q GGIVIVDSTRRGK++PDALSKTVPI
Sbjct: 92  YSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPI 151

Query: 128 WCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSD 187
           WCAVLNS+MLE          +VLF PP+TV  SE++RI  ++P L+ R  +L +    +
Sbjct: 152 WCAVLNSIMLEG----RQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDE 207

Query: 188 LYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCTVSYRAQD 247
           L+K  +GK+LRPIW++PG+SLL S  D FTG+     W            LCTVSY+ QD
Sbjct: 208 LFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTW-EAQNENFMPVVLCTVSYQCQD 266

Query: 248 GVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQK 307
           GVDKRHGFTYVQGAADDHELW+ GL  ++FW +IE F D   S+  L + V +L+ +   
Sbjct: 267 GVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGDA 326

Query: 308 EVSETETLEAFNPLDM--ITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSV 365
               T++L   + L+   +T ++ LG++A+ + +  +L  +L  K+S+V++ S     S+
Sbjct: 327 NNKLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLST----SI 382

Query: 366 SKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSG 425
           S  EE   + I I +LQSGSKKSS+ALR  L ++   IE        ++ LP+LICCN+G
Sbjct: 383 SVYEE--AENIRIFKLQSGSKKSSRALRAALTQICPLIEA-----NLQNSLPVLICCNNG 435

Query: 426 TDMSIALVLMLLCKHYDLD-WNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSV 484
            DMS+ +VL +LC++++++ W   +   V+K II+KHL K+I+ L GRN+NP R +LNSV
Sbjct: 436 KDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSV 495

Query: 485 NEYLM 489
           N+YLM
Sbjct: 496 NDYLM 500

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  468 bits (1204), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 248/487 (50%), Positives = 327/487 (67%), Gaps = 14/487 (2%)

Query: 11  INQIHKDIKKEYKSLKNRIQSILLDARFLEDTXXXXXXXXXXXXNERCGLWYCNPKLFEQ 70
           I +I K+++KE KSLKNR+QSI+ D  FL++             NERCGLWYC+PK+++ 
Sbjct: 9   IKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTFQYPVVP-NERCGLWYCDPKIYDT 67

Query: 71  TSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWCA 130
           TSYFKSTDGH+NQWDFSTRRLNFHLLP L +NGG+VI+DSTRRGKKIPDALSKTVPIWCA
Sbjct: 68  TSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALSKTVPIWCA 127

Query: 131 VLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLYK 190
           VLN LMLE+  +      ++LFVPPSTVP SE+ R+  KLP L+++L KL IID   L K
Sbjct: 128 VLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDIIDVKKLRK 187

Query: 191 QF-----NGKLLRPIWIHPGSSLLQSTTDIFTGEST-NDVWXXXXXXXXXXXXLCTVSYR 244
                  + KLLRPIW++PGSSLLQ   D+F+GE   N  W            LCTVSY+
Sbjct: 188 SLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHW--EPPSNIIPVILCTVSYQ 245

Query: 245 AQDGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLL-- 302
            QDG DKR+GFTYVQGAADDHELW+  L P +FW+NI++  D+ +S+  L+ +   ++  
Sbjct: 246 CQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKDSYNAVILR 305

Query: 303 AAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCK 362
           A  Q  +  +  +     +D IT  + LGKI     I       L  K+S V++  E+  
Sbjct: 306 AKVQNSLDISGDISKMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYSAVVLCHEA-- 363

Query: 363 LSVSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICC 422
           +SV++  E + + I I  L SGSKKSS+ LR  L ++++ IE   S     + LPILI C
Sbjct: 364 ISVTEITE-LPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAANLPILIAC 422

Query: 423 NSGTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLN 482
           +SG D+S++++L+ LCK+Y+LDW     + VNK II+KHL K+I  L+GRNVNPSRA+LN
Sbjct: 423 DSGKDISVSILLVALCKYYNLDWELQPQDSVNKTIIKKHLAKIIESLQGRNVNPSRASLN 482

Query: 483 SVNEYLM 489
           SVN +LM
Sbjct: 483 SVNSFLM 489

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  392 bits (1006), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 204/424 (48%), Positives = 268/424 (63%), Gaps = 17/424 (4%)

Query: 67  LFEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVP 126
           + E T YFKSTDGH+N WDFS RRLNFHLLP LA+  G +IVDSTRRGKKIPDALSKT+P
Sbjct: 1   MCETTCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIP 60

Query: 127 IWCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGS 186
           IWCAVLN+L+LE      +   +VLF PP TV   EY RI  KLP L+++L ++  I G+
Sbjct: 61  IWCAVLNTLILEH----TEGSGEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGA 116

Query: 187 DLYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWXXXXXXXXXXXXLCTVSYRAQ 246
           +L     G+LLRP W++PG+++L +T D+FTGES  + W            LCT S + Q
Sbjct: 117 ELCSLLGGRLLRPFWVYPGAAMLGTTRDLFTGESLQEPW--QPPPGVIPLILCTASRQCQ 174

Query: 247 DGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQ 306
           DGVDK  G+ YVQGAADDHELW++GL P +FW N++   D    E LLQ  VE ++   +
Sbjct: 175 DGVDKSQGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHK 234

Query: 307 KEVSETETLE-AFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSV 365
              +E    E      D++T  + LG +A    I D     L  ++S+V++   S +LS 
Sbjct: 235 STHTEAVAHELPCRETDVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELSA 293

Query: 366 SKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSG 425
           +        RI I  L SG KKSS+ALR  L E    I P  ST   ++ LP+LICC+SG
Sbjct: 294 AAPHP----RIRIYPLNSGCKKSSRALRPALIE----IIPLISTALCEA-LPVLICCSSG 344

Query: 426 TDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVN 485
           +D+S+ +VL  LCK+YDL+W      ++ K II+KHL KL S + GR +NPSR TLNSVN
Sbjct: 345 SDISVGIVLAALCKNYDLEWRHEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVN 404

Query: 486 EYLM 489
            +LM
Sbjct: 405 AFLM 408

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 294  LQSTVEDLLAAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSM 353
            + ST  +LLA KQ+ +   ETLEA            L K   GL + DSL          
Sbjct: 1056 MASTESELLAKKQESLQLHETLEAIKQ----RRKKILSKNDAGLTLKDSLKE-------- 1103

Query: 354  VIVFSESCKLSVSKNEEKITQRIVINQLQSGSKKSSKAL 392
              +F ES  L+ S+ + +I +R +I QL S S +  K L
Sbjct: 1104 TKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKEL 1142

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 12/88 (13%)

Query: 257 YVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVED--LLAAKQKEVSETET 314
           +  G  DD ++      PD++ D++E      +  +L+ +T++D  LL  ++KE S  E 
Sbjct: 109 FSNGLEDDQKV-----GPDIYIDDLEN----KQQVELIGTTIQDEELLPGQKKEDSNAEL 159

Query: 315 LEAFNPLDMITTDIFLGKIADGLIIGDS 342
            +   P  +I   +  G I  GL++G++
Sbjct: 160 RQTIKPRHVIMMSLGTG-IGTGLLVGNA 186

>KLTH0D14146g Chr4 complement(1159134..1163105) [3972 bp, 1323 aa]
           {ON} similar to uniprot|Q06706 Saccharomyces cerevisiae
           YLR384C IKI3 Subunit of RNA polymerase II elongator
           complex which is a histone acetyltransferase involved in
           maintaining structural integrity of the complex iki3
           mutations confer resistance to the K. lactis toxin
           zymocin
          Length = 1323

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 270 HGLNPDMFWDNIEQF-NDLDRSE--DLLQS--TVEDLLAAKQKEVSETETLEAF 318
           H   PD+F++N+E F ND+ + E  DL  S  T ED+   K KE       E F
Sbjct: 751 HDYAPDLFYENLEHFINDIGKGEHLDLFISCLTEEDVTITKYKETLRASMDERF 804

>TDEL0D04990 Chr4 complement(901423..910341) [8919 bp, 2972 aa] {ON}
            Anc_3.124 YBR140C
          Length = 2972

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 9/124 (7%)

Query: 284  FNDLDRSEDLLQSTVEDLLAAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSL 343
            +  LDR E+  +   ED   A + +V+E E LE ++ L  I  ++++G   D  +I    
Sbjct: 2175 YYALDRIEE--EYVNEDQAPATKHDVNERENLERYDILCHIFLNVWVGLCGDDDVIRSV- 2231

Query: 344  TSELLSKFSMVIVFSESCKLSVSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRI 403
                   ++++ V  E+  +    +  +  +  V+N   +     S+AL +T PEL + +
Sbjct: 2232 ------AYNLLAVTQETFNVDCGSHFRQSPEVYVLNYCCTFGCLISEALARTAPELTAFV 2285

Query: 404  EPFF 407
              +F
Sbjct: 2286 FKYF 2289

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,898,881
Number of extensions: 2076851
Number of successful extensions: 7710
Number of sequences better than 10.0: 36
Number of HSP's gapped: 7825
Number of HSP's successfully gapped: 36
Length of query: 491
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 377
Effective length of database: 40,409,475
Effective search space: 15234372075
Effective search space used: 15234372075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)