Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.118.837ON38138111671e-159
CAGL0M02937g8.837ON3732137961e-103
KAFR0B039008.837ON3792137961e-103
TDEL0B006008.837ON3692137791e-101
NCAS0C004308.837ON3692147606e-98
TPHA0I002208.837ON3772137572e-97
ZYRO0G14124g8.837ON3692227476e-96
NDAI0K004408.837ON4042127454e-95
SAKL0D01540g8.837ON3652137353e-94
KLTH0C03938g8.837ON3762207354e-94
Kwal_27.102758.837ON3792147208e-92
ABL129W8.837ON3452137082e-90
Skud_13.4488.837ON3642157075e-90
Smik_13.4898.837ON3722156991e-88
YMR276W (DSK2)8.837ON3732156972e-88
Suva_13.4648.837ON3662156807e-86
TBLA0D032308.837ON3752136801e-85
Ecym_46088.837ON4062256811e-85
KLLA0D01859g8.837ON3712136572e-82
KNAG0J002908.837ON3672225815e-71
TBLA0B032408.837ON2842021291e-07
Smik_9.215.701ON124541132e-06
Skud_9.205.701ON125541132e-06
Smik_11.3575.701ON125541132e-06
TDEL0G017504.16ON77541093e-06
NDAI0H002704.16ON77541074e-06
Suva_10.32singletonON62541065e-06
KNAG0J028804.16ON153711082e-05
Ecym_84084.16ON153711082e-05
TPHA0K022504.16ON153711082e-05
KAFR0D022305.701ON128541062e-05
KAFR0H002205.701ON128541062e-05
Suva_11.3305.701ON128541062e-05
Skud_11.3335.701ON128541062e-05
YIL148W (RPL40A)5.701ON128541062e-05
YKR094C (RPL40B)5.701ON128541062e-05
Kwal_YGOB_Anc_5.7015.701ON128541062e-05
KLTH0E01078g5.701ON128541062e-05
SAKL0E14894g5.701ON128541052e-05
ZYRO0G06622g5.701ON128541052e-05
KLLA0A00616g5.701ON128541052e-05
TPHA0E002405.701ON128541052e-05
TPHA0D046005.701ON128541052e-05
TBLA0E021105.701ON128541052e-05
CAGL0G02475g5.701ON128541052e-05
Kpol_1043.695.701ON128541053e-05
Ecym_40195.701ON128541053e-05
Suva_10.34singletonON151721073e-05
NDAI0E050305.701ON128541053e-05
NCAS0A032105.701ON128541053e-05
NCAS0G002405.701ON128541053e-05
AFR285C5.701ON128541053e-05
KNAG0L021205.701ON128541053e-05
TDEL0B022005.701ON128541053e-05
Suva_9.405.701ON144541054e-05
TBLA0G006704.16ON229711085e-05
NDAI0D049304.16ON229711085e-05
KAFR0I014704.16ON229711085e-05
Kwal_55.206074.16ON231711075e-05
TPHA0C023908.386ON150541045e-05
KLTH0E05852g4.16ON409711105e-05
Ecym_41818.386ON152541045e-05
Suva_10.33singletonON254711086e-05
NCAS0C029408.386ON152541046e-05
ZYRO0C04026g8.386ON152541047e-05
KLTH0F08734g8.386ON150541037e-05
SAKL0H25784g4.16ON305711077e-05
Kwal_23.33118.386ON150541038e-05
NDAI0G022808.386ON152541038e-05
AGL128W8.386ON152541038e-05
KAFR0H020008.386ON152541038e-05
KNAG0C065805.701ON149541038e-05
KLLA0D18304g8.386ON150541038e-05
SAKL0H13926g8.386ON154541039e-05
Skud_12.294.16ON381711079e-05
YLL039C (UBI4)4.16ON381711079e-05
Kpol_1036.628.311ON7773989e-05
ACL062C4.16ON382711079e-05
TDEL0F051008.386ON150541021e-04
YLR167W (RPS31)8.386ON152541021e-04
Suva_10.304.16ON381711071e-04
KLLA0E00749g4.16ON381711071e-04
KNAG0A027308.386ON150541021e-04
Smik_12.184.16ON460711071e-04
CAGL0G08173g8.386ON152541021e-04
ZYRO0G07854g4.16ON460711071e-04
Kpol_1070.64.16ON533711071e-04
CAGL0D05082g4.16ON533711071e-04
Kpol_1030.58.386ON152541021e-04
Kpol_1024.168.386ON152541021e-04
NCAS0C058504.16ON388711071e-04
NDAI0F003005.701ON187751022e-04
Suva_10.2668.386ON152541002e-04
Skud_12.2348.386ON152541002e-04
Smik_12.2298.386ON152541002e-04
TBLA0H031808.386ON152541002e-04
CAGL0B01589g8.311ON7773934e-04
KLLA0F17974g8.311ON7773925e-04
SAKL0D11814g1.480ON40063980.001
Kwal_27.101521.480ON38163970.002
NCAS0B045908.142ON44742970.002
KAFR0E005301.480ON37963960.002
TDEL0F043808.311ON7773870.002
KAFR0C030008.142ON39742960.003
TPHA0C008908.311ON7773840.008
NCAS0B035208.311ON7773830.008
NDAI0J010708.311ON7773830.010
ZYRO0D05962g8.311ON7773820.012
KLTH0C03410g1.480ON39163900.014
TBLA0D022108.142ON56338900.016
NDAI0G003301.480ON42758860.035
AFR358W1.480ON41365860.040
CAGL0L06028g8.142ON50538860.044
NDAI0B01850singletonON40342850.048
NCAS0G041201.480ON39254840.066
TPHA0O004401.480ON36955840.069
SAKL0H15818g8.311ON7771770.069
KLTH0G12540g8.311ON7770760.087
YGL181W (GTS1)8.142ON39638820.11
KAFR0I027801.480ON21466800.12
Smik_7.918.142ON39938820.14
SAKL0H24772g8.142ON41438810.17
TDEL0B046908.142ON44238810.17
TDEL0C025901.480ON36854790.25
Suva_5.321.480ON40955780.34
YEL037C (RAD23)1.480ON39855780.41
Suva_7.818.142ON40138780.43
TBLA0B021601.480ON40462770.43
Skud_5.531.480ON39754770.52
YDR139C (RUB1)8.311ON7773700.60
Ecym_35721.480ON44365760.68
TPHA0H004008.142ON46642741.1
Smik_5.561.480ON39754741.2
TBLA0C012001.369ON50346731.5
KNAG0G005101.480ON37544722.2
CAGL0L01309g1.480ON39258694.6
Skud_7.908.142ON39638685.3
Kpol_541.508.142ON51138687.4
Suva_1.267.38ON27882668.1
ACL055W8.142ON47138669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.11
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   454   e-159
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   311   e-103
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   311   e-103
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   304   e-101
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   297   6e-98
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   296   2e-97
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   292   6e-96
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   291   4e-95
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   287   3e-94
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   287   4e-94
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   281   8e-92
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   277   2e-90
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   276   5e-90
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   273   1e-88
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   273   2e-88
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   266   7e-86
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   266   1e-85
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   266   1e-85
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   257   2e-82
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   228   5e-71
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    54   1e-07
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     48   2e-06
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     48   2e-06
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    48   2e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    47   3e-06
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    46   4e-06
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    45   5e-06
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    46   2e-05
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    46   2e-05
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    46   2e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    45   2e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    45   2e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    45   2e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    45   2e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    45   2e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    45   2e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    45   2e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    45   2e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    45   2e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    45   2e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    45   2e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    45   2e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    45   2e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    45   2e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    45   2e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    45   3e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    45   3e-05
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    46   3e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    45   3e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    45   3e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    45   3e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    45   3e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    45   3e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    45   3e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     45   4e-05
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    46   5e-05
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              46   5e-05
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    46   5e-05
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    46   5e-05
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    45   5e-05
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    47   5e-05
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    45   5e-05
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    46   6e-05
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    45   6e-05
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    45   7e-05
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    44   7e-05
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    46   7e-05
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    44   8e-05
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    44   8e-05
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    44   8e-05
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    44   8e-05
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    44   8e-05
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    44   8e-05
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    44   9e-05
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    46   9e-05
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    46   9e-05
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    42   9e-05
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    46   9e-05
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    44   1e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    44   1e-04
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    46   1e-04
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    46   1e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    44   1e-04
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    46   1e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    44   1e-04
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    46   1e-04
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    46   1e-04
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    46   1e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    44   1e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    44   1e-04
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             46   1e-04
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        44   2e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    43   2e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    43   2e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    43   2e-04
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    43   2e-04
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    40   4e-04
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    40   5e-04
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    42   0.001
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    42   0.002
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    42   0.002
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    42   0.002
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    38   0.002
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    42   0.003
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    37   0.008
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    37   0.008
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    37   0.010
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    36   0.012
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    39   0.014
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.016
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    38   0.035
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    38   0.040
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    38   0.044
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    37   0.048
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    37   0.066
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    37   0.069
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    34   0.069
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    34   0.087
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    36   0.11 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    35   0.12 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    36   0.14 
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    36   0.17 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    36   0.17 
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    35   0.25 
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    35   0.34 
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    35   0.41 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    35   0.43 
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    34   0.43 
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    34   0.52 
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    32   0.60 
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    34   0.68 
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    33   1.1  
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    33   1.2  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    33   1.5  
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    32   2.2  
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    31   4.6  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    31   5.3  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    31   7.4  
Suva_1.26 Chr1 complement(45699..46535) [837 bp, 278 aa] {ON} YA...    30   8.1  
ACL055W Chr3 (267925..269340) [1416 bp, 471 aa] {ON} Syntenic ho...    30   9.9  

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 248/381 (65%), Positives = 248/381 (65%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           KIQDEHSIHLVKSGG                         PLPSNIAAGQSGGFNPLSDL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR                           
Sbjct: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAASSFPAP 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXQQNPFASLXXXXXXXXXXXXXXXXXXXXXXXX 300
                                       QQNPFASL                        
Sbjct: 241 GETDTTAAAETNTETTSTPAATGAAAAGQQNPFASLFNPAMNPFAAMMNNNAAAAAGAGA 300

Query: 301 XXXXXXXXXXXXDPSLFASMFXXXXXXXXXXXXXXXXXRYESQLRQLNDMGFFDFDRNVA 360
                       DPSLFASMF                 RYESQLRQLNDMGFFDFDRNVA
Sbjct: 301 TGAAGATGTPAFDPSLFASMFQPPQQQQQEQDNRPPEERYESQLRQLNDMGFFDFDRNVA 360

Query: 361 ALRRSGGSVQGALDALLSNDV 381
           ALRRSGGSVQGALDALLSNDV
Sbjct: 361 ALRRSGGSVQGALDALLSNDV 381

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  311 bits (796), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 149/213 (69%), Positives = 171/213 (80%), Gaps = 6/213 (2%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I IHIKSGQNKW+V++D S T+L LKEEIAKVSEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
            I+D+H+IH+VKSGG                          +PSNIA+GQ+GGFNPL+DL
Sbjct: 61  NIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTA-----VPSNIASGQTGGFNPLADL 115

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           T ARYAGY  NLPSADMFGPDGG+N+ P+QD+MLRM+ENP+FQSQMNEMLSNP+M+DFMI
Sbjct: 116 TGARYAGYA-NLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMI 174

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           QSNPQLQAMGP+ARQM QSPFFRQMLTNP MIR
Sbjct: 175 QSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIR 207

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 48/69 (69%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXXXXRYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGA 372
           DP+L AS+                  RYE QLRQLNDMGFFDFDRNVAALRRSGGSVQGA
Sbjct: 305 DPTLLASLLGGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGA 364

Query: 373 LDALLSNDV 381
           LDALL+ DV
Sbjct: 365 LDALLNGDV 373

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  311 bits (796), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 171/213 (80%), Gaps = 1/213 (0%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I IHIKSGQNKW+V  ++S+++  LKEEI+K+SEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           KI++ HSIHLVKSGG                          +PSNIA+GQ+GGFNPL+DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           TSARYAGY LN+PSADMFGPDGG+NS P+QDDMLRML+NPVFQSQMNEMLSNPQMIDFMI
Sbjct: 121 TSARYAGY-LNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           QSNPQLQAMGP+ARQM QSP FRQML NP+MIR
Sbjct: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIR 212

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 49/71 (69%), Gaps = 2/71 (2%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXX--XXRYESQLRQLNDMGFFDFDRNVAALRRSGGSVQ 370
           DP+L ASM                    RYE+QLRQLNDMGFFDFDRNVAALRRSGGSVQ
Sbjct: 309 DPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQ 368

Query: 371 GALDALLSNDV 381
           GALDALL+ DV
Sbjct: 369 GALDALLNGDV 379

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  304 bits (779), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 168/213 (78%), Gaps = 2/213 (0%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I + +K GQ+KWEV+V+   TV + K+EIAKVSEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           KIQD H+IHLVKSGG                          +PSNIA+GQ+GGFNPLSDL
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSAT-VPSNIASGQTGGFNPLSDL 119

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           TSARYAG+  NLPSADMFGPDGG+ +MPNQDDML MLENP+FQSQMNEMLSNPQM+DFMI
Sbjct: 120 TSARYAGF-TNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           QSNPQLQAMGP+ARQ+ QSPFFRQMLTNP+M+R
Sbjct: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLR 211

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 48/70 (68%), Gaps = 1/70 (1%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXX-XXRYESQLRQLNDMGFFDFDRNVAALRRSGGSVQG 371
           DPS+ AS+                   RYE QLRQLNDMGFFDF++NVAALRRSGGSVQG
Sbjct: 300 DPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQG 359

Query: 372 ALDALLSNDV 381
           ALD+LL+ DV
Sbjct: 360 ALDSLLNGDV 369

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  297 bits (760), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 171/214 (79%), Gaps = 9/214 (4%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I IH+KSGQN W+V++D ++T+LQLKEEIAKVSE+P  NQRLI+SGKILKDDQ +EFY
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           KI D  SIH+VKSGG                         P+  N+AAG++GGFNPLSDL
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTAT-------PVAPNMAAGETGGFNPLSDL 113

Query: 121 TSARYAGYGLNLPSADMFGPDGGMN-SMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFM 179
           TSARYAGY LNLPSAD FGPDGG+N S PNQD+MLRML+NPVFQSQMNEMLSNPQM+DF+
Sbjct: 114 TSARYAGY-LNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFI 172

Query: 180 IQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           IQ+NPQLQAMGP+ARQ+ Q+P FRQMLTNP+MIR
Sbjct: 173 IQANPQLQAMGPQARQILQNPMFRQMLTNPDMIR 206

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/69 (63%), Positives = 48/69 (69%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXXXXRYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGA 372
           DPS FASMF                 RYE QLRQLNDMGFFDFDRNVAALRRSGG+V+ A
Sbjct: 301 DPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESA 360

Query: 373 LDALLSNDV 381
           L+ALL+ DV
Sbjct: 361 LNALLNGDV 369

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  296 bits (757), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 142/213 (66%), Positives = 165/213 (77%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I + IKSGQNKW+V V+ SNT+L+ KE I+K S+IP  NQRLIYSGKILKD + +E Y
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           KIQD HSIHLVKSG                           +P+NI +GQ+ GFNPL+DL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           TSARYAGY L +PSADMFGPDGGM +MPNQDDML MLENPVFQSQMNEMLSNPQM+++MI
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
            SNPQLQA+GP+AR+MFQSPFFRQMLTNP+MIR
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIR 213

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 43/43 (100%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381
           RYESQLRQLNDMGFF+FDRN+AALRRSGGSVQGALDALL+NDV
Sbjct: 335 RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  292 bits (747), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 146/222 (65%), Positives = 166/222 (74%), Gaps = 12/222 (5%)

Query: 3   IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKI 62
           I + IKSGQNKWEVTVD  +TV   KEEI+KVSEIP  +QRLIYSGKILKDDQ L+FY +
Sbjct: 4   ITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNL 63

Query: 63  QDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXP-----------LPSNIAAGQS 111
           QD HS+HLVKS                           P            PSN++AGQS
Sbjct: 64  QDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQS 123

Query: 112 GGFNPLSDLTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLS 171
           GGFNPL+DLTSARYAG+  +LPSADMFGPDGG  +MPNQ+D+L ML+NP+FQSQMNEMLS
Sbjct: 124 GGFNPLADLTSARYAGF-TSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 172 NPQMIDFMIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           NPQM+DFMIQSNPQLQAMGP+ARQMFQSPFFRQMLTNP+MIR
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIR 224

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/69 (63%), Positives = 48/69 (69%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXXXXRYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGA 372
           DP L ASM                  RYE+QLRQLN+MGFFDFDRNVAALRRSGGSVQGA
Sbjct: 301 DPQLLASMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGA 360

Query: 373 LDALLSNDV 381
           LD+LL+ DV
Sbjct: 361 LDSLLNGDV 369

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  291 bits (745), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 144/212 (67%), Positives = 164/212 (77%), Gaps = 8/212 (3%)

Query: 3   IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKI 62
           I IHIKSGQN W+V++D + ++  LK+EIAKVSEIP  NQRLIYSGKILKDDQ ++FY I
Sbjct: 4   ISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNI 63

Query: 63  QDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDLTS 122
           QD HS+HLV+SG                           +PSNI+AGQ+GGFNPL+DLTS
Sbjct: 64  QDGHSVHLVRSG-------KKSTPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLTS 116

Query: 123 ARYAGYGLNLPSADMFGPDGGMN-SMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMIQ 181
           ARYAGY LNLPSAD FGPDGGMN S  N D+ L ML+NP+ QSQMNEMLSNPQMIDFMIQ
Sbjct: 117 ARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQ 176

Query: 182 SNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           SNPQLQAMGP+ARQMFQSP FRQMLTNP+MIR
Sbjct: 177 SNPQLQAMGPQARQMFQSPMFRQMLTNPDMIR 208

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/72 (56%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXX---XXRYESQLRQLNDMGFFDFDRNVAALRRSGGSV 369
           DPS+FAS+F                    RYE+QLRQLNDMGFFDFDRN+AALRR+GGSV
Sbjct: 333 DPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSV 392

Query: 370 QGALDALLSNDV 381
           + A++ALL+ DV
Sbjct: 393 EAAVNALLNGDV 404

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  287 bits (735), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 166/213 (77%), Gaps = 4/213 (1%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I +HIKSGQNKW+V+++ +NTV++LKE I+KVSEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           KI D+H++HLV+SGG                          +PSNI++GQ+GGFNPL+DL
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAA---VPSNISSGQTGGFNPLADL 117

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           T ARYAGY  NLPSADMFGPDGG+ + PN D++L ML+NP+ QSQMNEMLSNPQM+DFMI
Sbjct: 118 TGARYAGYA-NLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMI 176

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           Q NPQLQAMGP AR++ QS +FRQM+TNP+MIR
Sbjct: 177 QQNPQLQAMGPRARELLQSDYFRQMMTNPDMIR 209

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 41/43 (95%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381
           RYE QLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALL+ DV
Sbjct: 323 RYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 365

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  287 bits (735), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 140/220 (63%), Positives = 160/220 (72%), Gaps = 8/220 (3%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I +HIKSGQNKW+V +D S+T+ Q K  IA  SEI  ENQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPL-------PSNIAAGQSGG 113
           KI D+HS+HLVKSGG                         P        P+N++ GQ  G
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 114 FNPLSDLTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNP 173
           FNPLSDLTSARYAG+ LNLPSAD FGPDGGM S PN DD+LRMLENPV QSQMNEMLSNP
Sbjct: 121 FNPLSDLTSARYAGF-LNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNP 179

Query: 174 QMIDFMIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           QMIDF+IQ +PQLQ+MGP+AR + QSPFFRQM+TNP+MIR
Sbjct: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIR 219

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/43 (90%), Positives = 41/43 (95%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381
           RYE QLRQLNDMGFF+FDRNVAALRRSGGSVQGALDALL+ DV
Sbjct: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  281 bits (720), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 141/214 (65%), Positives = 162/214 (75%), Gaps = 2/214 (0%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I +H+KSGQ+KW+V+VD  +TV Q K  IA+ S+I  ENQRLIYSGKILKDDQ LE Y
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXX-XXXXXXXXXPLPSNIAAGQSGGFNPLSD 119
           KI D H++HLVKSG                             P+++++GQ+GGFNPLSD
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 120 LTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFM 179
           LTSARYAGY LNLPSAD FGPDGGM S PN DDMLRMLENPV QSQMNEMLSNPQMIDF+
Sbjct: 121 LTSARYAGY-LNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFL 179

Query: 180 IQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           IQ +PQLQ+MGP+ARQM QSPFFRQM+TNPEMIR
Sbjct: 180 IQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIR 213

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/43 (90%), Positives = 41/43 (95%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381
           RYE QLRQLNDMGFF+FDRNVAALRRSGGSVQGALDALL+ DV
Sbjct: 337 RYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  277 bits (708), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 138/213 (64%), Positives = 163/213 (76%), Gaps = 4/213 (1%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M IKI +KSGQN+WEV+V+ S +V +LK+EIAKVSEIP ENQRLIYSGKILKDDQ +E Y
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           KI D H+IHLVKS                            +PS+I+AGQSGGFNPL+DL
Sbjct: 61  KIADGHAIHLVKS---GGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADL 117

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           T ARYAGY  NLPS DMFGPDGG+NS   Q++++ MLENP+FQSQMNEML+NPQMIDF+I
Sbjct: 118 TGARYAGY-TNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLI 176

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           Q +P LQAMGP AR+M QSPFFRQMLTNP++IR
Sbjct: 177 QQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIR 209

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 49/69 (71%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXXXXRYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGA 372
           DP++ +S+F                 RYE QLRQLNDMGFFDFDRNVAALRR+GGSVQGA
Sbjct: 277 DPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGA 336

Query: 373 LDALLSNDV 381
           LDALL+ DV
Sbjct: 337 LDALLNGDV 345

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  276 bits (707), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 159/215 (73%), Gaps = 6/215 (2%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M + IHIKSGQ+KWEV V    TVLQ KE I+K + IPV NQRLIYSGKILKDDQ ++ Y
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
            IQD HS+HLVKS                           P   N+++GQS GFNPL+DL
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATP---NMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYGLNLPSADMFGPDGGM--NSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDF 178
           TSARYAGY LN+PSADMFGPDGG   N   NQD++LRM+ENP+FQSQMNEMLSNPQM+DF
Sbjct: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 MIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           MIQSNPQLQAMGP+ARQM QSP FRQMLTNPEM+R
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMR 211

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXX---XXRYESQLRQLNDMGFFDFDRNVAALRRSGGSV 369
           DP+L ASMF                    RYE QLRQLNDMGFFDFDRNVAALRRSGGSV
Sbjct: 293 DPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 352

Query: 370 QGALDALLSNDV 381
           QGALD+LL+ DV
Sbjct: 353 QGALDSLLNGDV 364

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  273 bits (699), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 139/215 (64%), Positives = 160/215 (74%), Gaps = 6/215 (2%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M + IHIKSGQ+KWEV+V   +TV Q KE I+K + +PV NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
            IQD HS+HLVKS                           P   N+++GQS GFNPL+DL
Sbjct: 61  HIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATP---NMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYGLNLPSADMFGPDGGM--NSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDF 178
           TSARYAGY LN+PSADMFGPDGG   N   NQD++LRM+ENP+FQSQMNEMLSNPQM+DF
Sbjct: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 MIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           MIQSNPQLQAMGP+ARQM QSP FRQMLTNP+MIR
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIR 211

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXX---XXRYESQLRQLNDMGFFDFDRNVAALRRSGGSV 369
           DP+L ASMF                    RYE QLRQLNDMGFFDFDRNVAALRRSGGSV
Sbjct: 301 DPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSV 360

Query: 370 QGALDALLSNDV 381
           QGALD+LL+ DV
Sbjct: 361 QGALDSLLNGDV 372

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  273 bits (697), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 141/215 (65%), Positives = 159/215 (73%), Gaps = 6/215 (2%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M + IHIKSGQ+KWEV V   +TVLQ KE I K + IPV NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
            IQD HS+HLVKS                           P   N+++GQS GFNPL+DL
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATP---NMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYGLNLPSADMFGPDGGM--NSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDF 178
           TSARYAGY LN+PSADMFGPDGG   N   NQD++LRM+ENP+FQSQMNEMLSNPQM+DF
Sbjct: 118 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDF 176

Query: 179 MIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           MIQSNPQLQAMGP+ARQM QSP FRQMLTNP+MIR
Sbjct: 177 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIR 211

 Score = 92.0 bits (227), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 49/69 (71%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXXXXRYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGA 372
           DP+L ASMF                 RYE QLRQLNDMGFFDFDRNVAALRRSGGSVQGA
Sbjct: 305 DPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGA 364

Query: 373 LDALLSNDV 381
           LD+LL+ DV
Sbjct: 365 LDSLLNGDV 373

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  266 bits (680), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 135/215 (62%), Positives = 160/215 (74%), Gaps = 5/215 (2%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M + +++KSGQ+KWEV+V   +TVLQ KE I++ + IPV NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
            IQD HS+HLVKS                               N+++GQS GFNPL+DL
Sbjct: 61  HIQDGHSVHLVKS--QPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADL 118

Query: 121 TSARYAGYGLNLPSADMFGPDGGM--NSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDF 178
           TSARYAGY LN+PSADMFGPDGG   N   NQD++LRM++NP+FQSQMNEMLSNPQM+DF
Sbjct: 119 TSARYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDF 177

Query: 179 MIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           MIQSNPQLQAMGP+ARQM QSP FRQMLTNP+MIR
Sbjct: 178 MIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIR 212

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 313 DPSLFASMFXXXXXXXXXXXXXXX---XXRYESQLRQLNDMGFFDFDRNVAALRRSGGSV 369
           DP+L ASMF                    RYE QLRQLNDMGFFDFDRNVAALRRSGGSV
Sbjct: 295 DPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSV 354

Query: 370 QGALDALLSNDV 381
           QGALD+LL+ DV
Sbjct: 355 QGALDSLLNGDV 366

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  266 bits (680), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 156/213 (73%), Gaps = 4/213 (1%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I +HIKSGQN W+V ++ S+T+   K++IA VSEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           KIQD HSIH+VKSG                             S ++ G+  GFNPLSDL
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGS---SGMSTGRGSGFNPLSDL 117

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           TSARYAGY  NLPSADMFGPDGG  +  +QDDML MLENPVFQSQMNEMLSNP+++DF+I
Sbjct: 118 TSARYAGY-TNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLI 176

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
            SNPQLQ++GP+AR MFQSP FRQMLTNP+MIR
Sbjct: 177 NSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIR 209

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 39/40 (97%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLS 378
           RYE QLRQLNDMGFFDFD+NVAALRRSGGSVQGA++ALLS
Sbjct: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  266 bits (681), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 160/225 (71%), Gaps = 17/225 (7%)

Query: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           M I +H+KSGQNKW+V+ D S+++  LK+ IA+VS IP ENQRLIYSGKILKDDQ +E Y
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDEHSIHLVK------------SGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAA 108
           KI D HSIHLV+            +GG                          +P+NI A
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGST----VPNNITA 116

Query: 109 GQSGGFNPLSDLTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNE 168
           GQ GGFNPL+DLT ARYAGY  NLPS DMFGPDGG+NS   Q+++L ML+NP+FQSQ+NE
Sbjct: 117 GQMGGFNPLADLTGARYAGYA-NLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNE 175

Query: 169 MLSNPQMIDFMIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           ML+NPQMIDF+IQ +P LQAMGP AR+M QSPFFRQM+TNP++IR
Sbjct: 176 MLANPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIR 220

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (90%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381
           RY+ QL QLN+MGF DFDRNVAALRRSGGSVQGAL+ALL+ DV
Sbjct: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  257 bits (657), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 127/213 (59%), Positives = 153/213 (71%), Gaps = 6/213 (2%)

Query: 3   IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKI 62
           I +H+KSGQN W V ++ + T+   KE I+ VS +P +NQRLIYSGKILKD + +E YKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  QDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDLTS 122
           QD HS+H+VKS                             PSNI+AGQ+GGFNPL+DLT 
Sbjct: 64  QDGHSVHMVKS---GGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTG 120

Query: 123 ARYAGYGLNLPSADMFGPDGGMNSM--PNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180
           ARYAG   NLPSADMFGPDGG+NS    N + ML+MLENP+FQSQMNEMLSNPQM+DF+I
Sbjct: 121 ARYAGLA-NLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLI 179

Query: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           Q NPQLQA+GP AR M QSPFFRQM+T+P+MIR
Sbjct: 180 QQNPQLQALGPRARDMLQSPFFRQMMTDPQMIR 212

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (97%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381
           RYESQLRQLNDMGFFDFDRNVAALRR+GGSVQGALDALL+ DV
Sbjct: 329 RYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 371

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  228 bits (581), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 154/222 (69%), Gaps = 10/222 (4%)

Query: 1   MGIKIHIKSGQNKWEVTVDVS---NTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVL 57
           MGI + +K GQN+W+V V       TV Q KE +A V+ +PVENQRLIYSGKILKD Q L
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  EFYKIQDEHSIHLVKSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPL 117
           E YKI D H++HLVKSGG                            +++AAGQ  GFNPL
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAG-ASMAAGQQPGFNPL 119

Query: 118 SDLTSARYAGYGLNLPSADMFGPDGGMNSMPNQ------DDMLRMLENPVFQSQMNEMLS 171
           +DLTSARYAGY L +PSADMFGPDGG+ S          +++L MLENP+FQSQMNEM S
Sbjct: 120 ADLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFS 179

Query: 172 NPQMIDFMIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213
           NPQM+DF+IQSNPQLQAMGP+AR+M QSP FRQMLTNP+M+R
Sbjct: 180 NPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381
           RYE QLRQLNDMGF DFDRNVAALRR+GGS+QGALDALL+ DV
Sbjct: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 93/202 (46%), Gaps = 18/202 (8%)

Query: 3   IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKI 62
           I ++IK  + K+ +  ++   +  +  +I    +IP  NQRLIYSG+IL  ++ L+ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  QDEHSIHLV--KSGGXXXXXXXXXXXXXXXXXXXXXXXXXPLPSNIAAGQSGGFNPLSDL 120
           +D H I ++  K                            P+ S    G+      +  +
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGN----IITI 117

Query: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQ-MIDFM 179
           T+     YG+   S ++  P+        + ++L++L++P    Q NEML N Q ++ F+
Sbjct: 118 TTTSPDPYGVR--SNEVHDPEV-------ERELLQVLDHP-RSFQENEMLLNNQNLLRFL 167

Query: 180 IQSNPQLQAMGPE-ARQMFQSP 200
           IQ+NP L+ M    ARQ+ + P
Sbjct: 168 IQTNPHLRHMDINGARQVLRDP 189

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 13 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 14 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 14 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 3  VEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
           YLL039C
          Length = 153

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
           Ashbya gossypii ACL062C
          Length = 153

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
           YLL039C
          Length = 153

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
           YALI0E18986g (REAL)
          Length = 151

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 2   GIKIHIKSGQNKWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEF 59
           G++I +K+   K  +T++V  S+T+  +K +I     IP + QRLI++GK L+D + L  
Sbjct: 76  GMQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 134

Query: 60  YKIQDEHSIHLV 71
           Y IQ E ++HLV
Sbjct: 135 YNIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 33 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
           YLL039C
          Length = 229

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
           YIL148W
          Length = 229

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {ON}
           YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 180 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 239

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 240 NIQKESTLHLV 250

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 256 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 315

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 316 NIQKESTLHLV 326

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 332 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 391

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 392 NIQKESTLHLV 402

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18  VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
           V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 121 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
           YLL039C (REAL)
          Length = 254

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YLL039c UBI4 ubiquitin
          Length = 305

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
           381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
           UBI4Ubiquitin, becomes conjugated to proteins, marking
           them for selective degradation via the ubiquitin-26S
           proteasome system; essential for the cellular stress
           response; encoded as a polyubiquitin precursor comprised
           of 5 head-to-tail repeats
          Length = 381

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 43/73 (58%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M +K+   +G+   E++V++  S+ V  +KE + +   IP   QRLI+ GK + D+Q ++
Sbjct: 1  MYVKVKTLTGK---EISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVD 57

Query: 59 FYKIQDEHSIHLV 71
            K+ D   +HLV
Sbjct: 58 SAKLTDGMQLHLV 70

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL039C
           (UBI4)
          Length = 382

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.30 Chr10
           complement(67747..67841,68061..68288,68558..69013,
           69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++ K L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..49546)
           [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 230 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 290 NIQKESTLHLV 300

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 384 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 444 NIQKESTLHLV 454

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18  VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
           V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 171 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18  VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
           V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 325 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 380 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
           complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 380 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 456 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 516 NIQKESTLHLV 526

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
           to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
           ubiquitin
          Length = 533

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 380 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 456 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 516 NIQKESTLHLV 526

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 76  GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 152 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 228 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 2   GIKIHIKSGQNKW-EVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
           G++I +K+   K   + V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y
Sbjct: 304 GMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDEHSIHLV 71
            IQ E ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 6/75 (8%)

Query: 3   IKIHIKSGQNKW----EVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQV 56
           + IHIK    K      +T++V  S+T+  +K +I     IP + QRLI++GK L+D + 
Sbjct: 55  LHIHIKYSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRT 114

Query: 57  LEFYKIQDEHSIHLV 71
           L  Y IQ E ++HLV
Sbjct: 115 LSDYNIQKESTLHLV 129

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 18 VDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHLV 71
          V+ S+T+  +K +I     IP + QRLI++GK L+D + L  Y IQ E ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDVS--NTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M IK+   +G+   E+ V+VS  + V  +KE + +   IP   QRLI+ GK + +D  + 
Sbjct: 1  MIIKVKTLTGK---EIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTIS 57

Query: 59 FYKIQDEHSIHLV 71
            K+ D   +HLV
Sbjct: 58 TAKLSDGMQLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M +K+   +G+   E++VDV  S TV  +KE + +   IP   Q+LI+ GK + D+  + 
Sbjct: 1  MQLKVKTLTGK---EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIG 57

Query: 59 FYKIQDEHSIHLV 71
             +QD   +HLV
Sbjct: 58 SADLQDGSLLHLV 70

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 3  IKIHIKS-GQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYK 61
          I I+ K   + K  + +D ++TVLQ K+++A       +  +LI+SGK+L+D + LE  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 62 IQD 64
          ++D
Sbjct: 62 LKD 64

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 42/63 (66%), Gaps = 1/63 (1%)

Query: 3  IKIHIKSGQNK-WEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYK 61
          +KI+ K  + +   + +++S+TV + K+++A+  E      +LIYSGKIL+DD+ +  YK
Sbjct: 2  VKINFKDFKKQVLALELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYK 61

Query: 62 IQD 64
          ++D
Sbjct: 62 LKD 64

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSND 380
           +Y  QLR L DMGF D D NV AL    G++   ++ L SN+
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 11 QNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSIHL 70
          + K  V ++ S+T+L  K ++A +    ++  +LI+SGK+LKDDQ +    ++D   + +
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 71 VKS 73
          + S
Sbjct: 70 MIS 72

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 38.1 bits (87), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDVSNT--VLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M IK+   +G+   E+ V++ +   + ++K+ + +   IP   QRLI+ GK + D Q LE
Sbjct: 1  MIIKVKTLTGK---EIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLE 57

Query: 59 FYKIQDEHSIHLV 71
            K+ D   +HLV
Sbjct: 58 AAKLVDGMVLHLV 70

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 30/42 (71%), Gaps = 4/42 (9%)

Query: 339 RYES----QLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           RYES    Q+RQL +MGF D ++N+ AL++S G++  A+D L
Sbjct: 185 RYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M IK+   +G+   E+ ++V  S+ V  +K+ + +   IP   QRLI+ GK + D+Q +E
Sbjct: 1  MQIKVKTLTGK---EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVE 57

Query: 59 FYKIQDEHSIHLV 71
             + D   +HLV
Sbjct: 58 SANLIDGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 36.6 bits (83), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDVSNT--VLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M IK+   +G+   E+ VD+  T  V ++KE + +   IP   QRLI+ GK + D+Q + 
Sbjct: 1  MIIKVKTLTGK---EIPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVS 57

Query: 59 FYKIQDEHSIHLV 71
             + D   +HLV
Sbjct: 58 SANLIDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 36.6 bits (83), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDVSNT--VLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M IK+   +G+   E+ V++S    V ++KE + +   IP   QRLI+ GK + D+Q + 
Sbjct: 1  MIIKVKTLTGK---EIPVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVS 57

Query: 59 FYKIQDEHSIHLV 71
             + D   +HLV
Sbjct: 58 SANLVDGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 36.2 bits (82), Expect = 0.012,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDVS--NTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M IK+   +G+   E+ V+++  + + ++KE + +   IP   QRLI+ GK + D Q + 
Sbjct: 1  MIIKVKTLTGK---EIAVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVS 57

Query: 59 FYKIQDEHSIHLV 71
            K+ D   +HLV
Sbjct: 58 SAKLVDGMQLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 3  IKIHIKSGQNK-WEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYK 61
          +KI+ K  + +   + +D  +T+ + K+ +A+  +      +LIYSGKIL+DD+ +  YK
Sbjct: 2  VKINFKDFKKQVLALELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYK 61

Query: 62 IQD 64
          + D
Sbjct: 62 LND 64

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           +Y  QL++LNDMGF + D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 35/58 (60%)

Query: 11 QNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSI 68
          + K  + ++ SNT+L +K ++A+         ++IYSGK+L+D Q +E  ++++   I
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQI 68

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 1  MGIKIHIKS-GQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEF 59
          M I IH K   + +  + +  S T+ + K+ +A+  +      ++I+SGK+L+D   LE 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKIQD 64
           K++D
Sbjct: 61 CKLKD 65

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           +Y  +LRQL ++GF +  +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSND 380
           +Y  +LR+L +MGF D D N  AL  + G + GA+D L  ++
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDN 207

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%)

Query: 11 QNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQD 64
          + K  + ++ +NTVL  K ++A+         +LIYSGK+L+D + LE   ++D
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKD 64

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 12 NKWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQD 64
           K ++++D+  S+TVL  K+++A+  E      +LIYSGK+L+D   +E   ++D
Sbjct: 10 KKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKD 64

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 34.3 bits (77), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60
          M +K+   +G+ +  ++++    V ++KE + +   IP   QRLI+ GK ++DDQ ++  
Sbjct: 1  MELKVKTLTGK-EIPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSA 59

Query: 61 KIQDEHSIHLV 71
           +     +HLV
Sbjct: 60 NLSSGMQLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 33.9 bits (76), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 3  IKIHIKSGQNK-WEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYK 61
          +K+ +K+   K   V VD  + V ++KE + +   IP   QRLI+ GK + DD+ +    
Sbjct: 1  MKLTVKTLTGKEIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSAN 60

Query: 62 IQDEHSIHLV 71
          +     +HLV
Sbjct: 61 LSSGMQLHLV 70

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 3  IKIHIKS--GQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQR--LIYSGKILKDDQVLE 58
          +K++IK    ++K+++   V++TV  LK  I K  ++        LIYSGK+L+DD  L 
Sbjct: 1  MKLYIKDPRTRSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLN 60

Query: 59 FYKIQD 64
             ++D
Sbjct: 61 SLHLKD 66

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           R+  QLR L ++G+ D D NV AL  + G +  ALD L
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALDIL 221

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           RY  +LR L +MG+ D D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 34/54 (62%)

Query: 11 QNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQD 64
          + K  + +D+S++VL  K ++A+  E      +LIYSGK+L+D + L+   ++D
Sbjct: 11 KEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKD 64

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 12 NKWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQD 64
           K +V +D+  SNT+ + K ++A+ S       +LIYSGK+L+D + +    ++D
Sbjct: 10 KKEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKD 64

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 12 NKWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQD 64
           K +V +D+  SNT+L+ K ++A+         +LIYSGK+L+D + +    ++D
Sbjct: 10 KKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKD 64

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 11 QNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQD-EHSIH 69
          + K  + +D  +T+   K +IA      ++  +LIYSGKILK+D  +    ++D +H I 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 11 QNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQD 64
          + K  + ++ SNT+ + K ++A+ +       +LIYSGK+L+D + +    ++D
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKD 64

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 31.6 bits (70), Expect = 0.60,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query: 1  MGIKIHIKSGQNKWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLE 58
          M +K+   +G+   E++V++  S+ V  +KE + +   IP   QRLI+ GK + D   + 
Sbjct: 1  MIVKVKTLTGK---EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVT 57

Query: 59 FYKIQDEHSIHLV 71
             + +   +HLV
Sbjct: 58 DAHLVEGMQLHLV 70

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 1  MGIKIHIKS-GQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEF 59
          M I I+ K   + K  + +  + T+ + K+ +AK  +      ++I+SGK+L+D   L+ 
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKIQD 64
           K++D
Sbjct: 61 CKLKD 65

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSND 380
           +Y   ++ L  MG+ D D N  AL  + G +  A+D L SN+
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDILESNN 268

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 13 KWEVTVDV--SNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQD 64
          K +V +D+  SNT+ ++K ++A+         +LIYSGK+L+D + +    ++D
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKD 64

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
          bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 29/46 (63%)

Query: 3  IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSG 48
          ++ ++K   N + +++  S TV +LKE++ +++ +PV  Q+ +  G
Sbjct: 6  LEFNVKHSGNVYPISITSSTTVQELKEQVQELTNVPVSRQKFMVKG 51

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 11 QNKWEVTVDVSN-TVLQLKEEIAKVSEIPVENQRLIYSGKILKD 53
          +NK  + VD+ + +V  +KE++A   +   E  +LI+SGK+L+D
Sbjct: 11 KNKETLDVDLEHESVKDVKEKLAAARDCDAEQIKLIFSGKVLQD 54

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 33/58 (56%)

Query: 11 QNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKIQDEHSI 68
          + K+ + ++ S +++ +KE +++         +LI+SGK+LKD   +E    +D + +
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEV 68

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           RY  QL +L DMG+ D  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           RY  +L +L +MGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>Suva_1.26 Chr1 complement(45699..46535) [837 bp, 278 aa] {ON}
           YAL039C (REAL)
          Length = 278

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 11/82 (13%)

Query: 101 PLPSNIAAGQS--GGFNPLS---DLTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLR 155
           P PS     Q+  G  NPL+   +LT+AR  G  L+LP+      D  ++S+P   D   
Sbjct: 46  PSPSECPILQTDNGRINPLNNMPELTAARQPGQKLDLPA------DRTVSSIPKSPDSNE 99

Query: 156 MLENPVFQSQMNEMLSNPQMID 177
             E P  Q   N M+   ++ D
Sbjct: 100 FWEYPSPQQMYNAMVRKGKIGD 121

>ACL055W Chr3 (267925..269340) [1416 bp, 471 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL181W (GTS1)
          Length = 471

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 339 RYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 376
           RY SQL  +  +G+ D D  V AL  S G +  ALD L
Sbjct: 198 RYGSQLATMKSLGYSDTDAIVEALVLSRGDINVALDIL 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,652,690
Number of extensions: 873164
Number of successful extensions: 3098
Number of sequences better than 10.0: 149
Number of HSP's gapped: 3119
Number of HSP's successfully gapped: 237
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)