Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.108.838ON61761727580.0
TPHA0I002308.838ON6144448301e-102
TDEL0B005908.838ON5413417479e-91
ZYRO0G14146g8.838ON5073426865e-82
SAKL0D01518g8.838ON5743545351e-59
Kwal_27.102728.838ON5514245191e-57
NCAS0B003108.838ON5643485192e-57
Suva_13.298.838ON5093504986e-55
YML114C (TAF8)8.838ON5103614891e-53
Smik_13.208.838ON5103504838e-53
KLTH0C03916g8.838ON5704164842e-52
Skud_13.278.838ON5143444777e-52
ABL128W8.838ON4743474721e-51
Ecym_46098.838ON5203764723e-51
NDAI0E003008.838ON6642124329e-45
TBLA0D032508.838ON6832214292e-44
KAFR0A028208.838ON4533193902e-40
KLLA0D01617g8.838ON5623773467e-34
CAGL0B02299g8.838ON6432093142e-29
KNAG0G034108.838ON5263202571e-22
NCAS0A130501.492ON56265724.3
TPHA0A021308.195ON933101698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.10
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...  1066   0.0  
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   324   e-102
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   292   9e-91
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   268   5e-82
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   210   1e-59
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   204   1e-57
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   204   2e-57
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   196   6e-55
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   192   1e-53
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   190   8e-53
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   191   2e-52
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   188   7e-52
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   186   1e-51
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   186   3e-51
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   171   9e-45
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   169   2e-44
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   154   2e-40
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   137   7e-34
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   125   2e-29
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...   103   1e-22
NCAS0A13050 Chr1 (2566112..2567800) [1689 bp, 562 aa] {ON} Anc_1...    32   4.3  
TPHA0A02130 Chr1 complement(432707..435508) [2802 bp, 933 aa] {O...    31   8.8  

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score = 1066 bits (2758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/617 (87%), Positives = 538/617 (87%)

Query: 1   MTGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMS 60
           MTGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMS
Sbjct: 1   MTGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMS 60

Query: 61  LVVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDK 120
           LVVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDK
Sbjct: 61  LVVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDK 120

Query: 121 DYESLXXXXXXXXXXXXXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYT 180
           DYESL             YQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYT
Sbjct: 121 DYESLTKIATTTTRTLSTYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYT 180

Query: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFXXXXXXXXXX 240
           YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKF          
Sbjct: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFSSSEMELATE 240

Query: 241 XXXXXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNP 300
                   ITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNP
Sbjct: 241 ETLATYSAITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNP 300

Query: 301 FLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQXXXXXXXXXXXXXXX 360
           FLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ               
Sbjct: 301 FLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQERKEARERAEEEKER 360

Query: 361 XXXXXXXXXXXXXXXXXXXXSSDFNLLDLSNYPNDSHGGFFAALESSDEERELIIQPRLS 420
                               SSDFNLLDLSNYPNDSHGGFFAALESSDEERELIIQPRLS
Sbjct: 361 RLAEIKALKEEKLKEMEAKKSSDFNLLDLSNYPNDSHGGFFAALESSDEERELIIQPRLS 420

Query: 421 SYTRNNSGVSSNETQADSVKXXXXXXXXXXXXXIKAGKELENDTTDSVKDIPTEENKIHT 480
           SYTRNNSGVSSNETQADSVK             IKAGKELENDTTDSVKDIPTEENKIHT
Sbjct: 421 SYTRNNSGVSSNETQADSVKNANENENENENEAIKAGKELENDTTDSVKDIPTEENKIHT 480

Query: 481 DANTAATEKVETIQNNNSDDAKTAQDNEKETVEKTETAPAIENSEQTVKEPETTESNGIG 540
           DANTAATEKVETIQNNNSDDAKTAQDNEKETVEKTETAPAIENSEQTVKEPETTESNGIG
Sbjct: 481 DANTAATEKVETIQNNNSDDAKTAQDNEKETVEKTETAPAIENSEQTVKEPETTESNGIG 540

Query: 541 SSTDTTKDKEPVISNPEEPQVNSDINEPTASSTTDTTLQQAQEPEKEEVEADNGQSIENV 600
           SSTDTTKDKEPVISNPEEPQVNSDINEPTASSTTDTTLQQAQEPEKEEVEADNGQSIENV
Sbjct: 541 SSTDTTKDKEPVISNPEEPQVNSDINEPTASSTTDTTLQQAQEPEKEEVEADNGQSIENV 600

Query: 601 EPLTTAEPGSEPKPILD 617
           EPLTTAEPGSEPKPILD
Sbjct: 601 EPLTTAEPGSEPKPILD 617

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  324 bits (830), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/444 (42%), Positives = 249/444 (56%), Gaps = 19/444 (4%)

Query: 4   EATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVV 63
           E  KY+QLT+LPTLTE+KYE+T+  +E ILAKA+ALQLK MN DT+ITKFAF HL SLV 
Sbjct: 41  EQKKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVD 100

Query: 64  GQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYE 123
            Q+ DMV ++ +L++LQRR  VAK DI +WLRGFNL P DL   +Q+S+Y+ + Y  +  
Sbjct: 101 EQLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVT 160

Query: 124 SLXXXXXXXXXXXXXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKF 183
            L             ++K D T KD ST +T KLVPI+N L+ +IP WLP FPPDYTYKF
Sbjct: 161 LLNRLATDTNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTYKF 220

Query: 184 TPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDL---KFXXXXXXXXXX 240
           TPQ+N  ITD T+IR+KV  EGK+SEKALL+LL   ++   S+ L   KF          
Sbjct: 221 TPQFNKHITDATVIRKKVAAEGKKSEKALLHLLES-EKITTSKLLNLDKFDSDDMDTAKL 279

Query: 241 XXXXXXXXITLRNKHLTSFFEKE----------PIQNSLNVEEYARTRVEIERKKVLGYE 290
                    +   K  T+FFE E             N  ++E+Y   R+ I R KV  YE
Sbjct: 280 EMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQYE 339

Query: 291 ERQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQXXXXX 350
           ++QL++Q +PFLK++ L+S   D KVS+ V NT I   LKRS L  I+SIP   Q     
Sbjct: 340 DKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDT 399

Query: 351 XXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXSSDFNLLDLSNYPNDSHGGFFAALESS 407
                                            +  F  +DLS++ N   GGF    +SS
Sbjct: 400 RERAMVEKKRRHDEWLKRREEKLKKLEQEKNLRAQAFGAIDLSSFTNIDDGGFLDGFDSS 459

Query: 408 DEERELIIQPRLSSYTRNNSGVSS 431
           + E+EL I  R  S   N+  +SS
Sbjct: 460 ENEQELEI--RAKSSQNNSKDISS 481

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  292 bits (747), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 156/341 (45%), Positives = 219/341 (64%), Gaps = 12/341 (3%)

Query: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66
           ++IQLT LPTL E  + +TE A+ KIL+KAVALQLK M  D  I+KFAFEHLM L+  Q+
Sbjct: 8   RHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQL 65

Query: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLX 126
           +DM+ +LHR S++QRR ++AK D+ ++L+G+NLTP DL++Q+Q SQY SK Y K+++SL 
Sbjct: 66  NDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLH 125

Query: 127 XXXXXXXXXXXXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFTPQ 186
                       +    +   + S    ++LV  +NPL + IP W+P FPPD+TYKFTPQ
Sbjct: 126 SLKET-------FTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQ 178

Query: 187 YNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRD---LKFXXXXXXXXXXXXX 243
           YN PITDETIIRR++V+EGKQSE ALL+LL+       S D     +             
Sbjct: 179 YNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIY 238

Query: 244 XXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLK 303
                   +N   +S    +  Q + ++EEYAR+RVEI RKKV+ YEERQ+++QRNPF+K
Sbjct: 239 GNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIK 298

Query: 304 ISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQ 344
            S++  +N+ +K  +  A  EI   L+RSL + I SIP+ Q
Sbjct: 299 YSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQ 339

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  268 bits (686), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 147/342 (42%), Positives = 214/342 (62%), Gaps = 14/342 (4%)

Query: 8   YIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQID 67
           YIQ+T+LPTL E ++E+ EP + K+LAK+VALQLK MN    IT+FAF+ L+ LV GQ++
Sbjct: 4   YIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNA--QITQFAFDRLLQLVDGQLN 61

Query: 68  DMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDY---ES 124
           DM+ +LHR+S+LQRR T+AK DIS+ + GFN++P  +E Q++ S++ S+ Y K++    S
Sbjct: 62  DMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHS 121

Query: 125 LXXXXXXXXXXXXXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFT 184
           L             ++  +   ++ ST     LVP +NPLQ  +P WLPDFPPD+TYKFT
Sbjct: 122 LRDLQSSLAHEMVPFEDQEAVRQNVSTV----LVPPTNPLQDFLPKWLPDFPPDHTYKFT 177

Query: 185 PQYNTPITDETIIRRKVVEEGKQSEKALLNL--LRGGQEDRISRDLKFXXXXXXXXXXXX 242
           PQY+ PITDET IRR++VEE KQSE AL +L   +   +D ++R                
Sbjct: 178 PQYSHPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRSQYDSELAEQETLAIY 237

Query: 243 XXXXXXITLRNKHLTS--FFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNP 300
                    ++    S     K P Q + +VEEYA  R+E+ RKKVL +EERQLQ Q++P
Sbjct: 238 GSQLKKRKTQHPQANSADLLSKLP-QTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDP 296

Query: 301 FLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPK 342
           FLK+SR+     ++K +K   + E +  L+RS ++ + SIP+
Sbjct: 297 FLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPE 338

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  210 bits (535), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 196/354 (55%), Gaps = 25/354 (7%)

Query: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66
           K I+L +LPTL    ++  E  + KIL++AVA++LK MN D ++++FAFE+L+ LV   +
Sbjct: 17  KQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENL 76

Query: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLX 126
             M+  LHR   +QRR  ++K D+ + L+G++L+  +L  + + SQY+   + +    + 
Sbjct: 77  SFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIA 136

Query: 127 XXXXXXXXXXXXYQKLDLTHKDTSTAQTSK----------LVPISNPLQKLIPSWLPDFP 176
                            +T K+   +  S+          LVP +N   + IP WLP+FP
Sbjct: 137 QKSKELKSKLLK----PMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFP 192

Query: 177 PDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRG--------GQEDRISRDL 228
           PD+TY+FT QYN P+ DE  +RRK+VEEGKQSE+AL+NLL+         G  +R+ +  
Sbjct: 193 PDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRS 252

Query: 229 KFXXXXXXXXXXXXXXXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLG 288
            +                   T  N H        P++N  +VEEYAR RVEI R+KVL 
Sbjct: 253 LYEETQEETFLIFGPERKKSHTTENSH--ELLRTLPLKN-FSVEEYARNRVEIARRKVLE 309

Query: 289 YEERQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPK 342
           YE+ QL++Q+NPF+K + L S    + +S+   + E++  L+RS +  + S+PK
Sbjct: 310 YEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPK 363

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  204 bits (519), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 138/424 (32%), Positives = 210/424 (49%), Gaps = 36/424 (8%)

Query: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66
           + +QL  LPTL E    + +  ++K+L KA+A+QLKS+N D SI++ AFE+L+ LV   +
Sbjct: 17  RVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEML 76

Query: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYL------------ 114
            +M+++LH+++++QRR+ ++K D+ + + G+NL+  DL  + ++S+Y+            
Sbjct: 77  SNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVE 136

Query: 115 --SKLYDKDYESLXXXXXXXXXXXXXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWL 172
             SK  +K   +              +  LD   KD  T     LVP S    K +P WL
Sbjct: 137 EDSKYVEKQEHTPLTQNELLSSTHPEFFVLD---KDVLT-----LVPPSVKDTKHVPRWL 188

Query: 173 PDFPPDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDR----ISRDL 228
           PDFPPD+TY+FT QYN PITDE +++RK+ EE   SEKAL++L     E+     I  D 
Sbjct: 189 PDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDT 248

Query: 229 KFXXXXXXXXXXXXXXXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLG 288
            +                      N+ +       P QN  +VEEYAR RVEI R++V  
Sbjct: 249 IYEEAQQETQLLFGPVKKKKTAAINE-VNDLLRTLPQQN-FSVEEYARNRVEIARRRVNE 306

Query: 289 YEERQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQXXX 348
           YE  QLQ+Q+  F+K + L+S  +  + S      EIR  L RS +  + S P  ++   
Sbjct: 307 YERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKE--- 363

Query: 349 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDFNLLDLSNYPNDSHGGFFAALESSD 408
                                           S++F++LDL+N   D    FF  L SSD
Sbjct: 364 --RRKREIALAEENRRLRDEKLRKEREARSKSSNEFDVLDLNNLNEDP---FFGGLGSSD 418

Query: 409 EERE 412
            E E
Sbjct: 419 SEDE 422

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  204 bits (519), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 124/348 (35%), Positives = 186/348 (53%), Gaps = 21/348 (6%)

Query: 11  LTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMV 70
           + EL   TE     ++  + K+L K++ALQLK +N +  +++ AF  L  LV  Q+D ++
Sbjct: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLNLE--LSQLAFNELSLLVNDQLDFLI 87

Query: 71  LELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLXXXXX 130
            ELHR+S +QRRN  AK DI + LRG NL   +L  Q Q S ++     KDY++L     
Sbjct: 88  SELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSS 147

Query: 131 XXXXXXXXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFTPQYNTP 190
                       +  H       ++ L+  +NP +  IP+WLP FPPD+TYKFTPQ+N P
Sbjct: 148 TIFDSSDTMA--NPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKP 205

Query: 191 ITDETIIRRKVVEEGKQSEKALLNLLRGGQE-------------DRISRDLKFXXXXXXX 237
           ITD+ +I++K++EEGK+SEK+LLNLL    E               ++R+          
Sbjct: 206 ITDQVLIKQKLIEEGKKSEKSLLNLLNDITEQSSIENEETSNFDSELAREENIAIYGYDA 265

Query: 238 XXXXXXXXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQ 297
                      I++ +    +FF         NV  YA  RVE+ RK+V  +E  QL+ +
Sbjct: 266 MSRKKRKPPHLISIHDTE-QNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWE 324

Query: 298 RNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345
           +NPFL++SR+I   ND KVS+S    EI+  L+RS  +   + PK +Q
Sbjct: 325 KNPFLRLSRMI---NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQ 369

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  196 bits (498), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 123/350 (35%), Positives = 190/350 (54%), Gaps = 17/350 (4%)

Query: 2   TGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSL 61
           +G +   +QLT LP LTE  + E +  + +IL K+V  QL S+N    I+ FA + +++L
Sbjct: 10  SGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNI--CISNFALDEMVNL 67

Query: 62  VVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKD 121
           V  Q+D M   LH L+ LQRR+ V++AD+ +  R FNL    L +Q Q S+++   +  +
Sbjct: 68  VAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVE 127

Query: 122 YESLXXXXXXXXXXXXXYQKLDLTHKDTSTA-QTSKLVPISNPLQKLIPSWLPDFPPDYT 180
           YE L               + D  +       + + L+P SNPL+KLIPSWLP+FPPD+T
Sbjct: 128 YEKLVKSSSFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLPNFPPDHT 187

Query: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFXXXXXXXXXX 240
           YKFTP++N PITD   I+R++V+E  +SE+ALLNL       R+ R              
Sbjct: 188 YKFTPEFNHPITDLKTIKREIVKESGESERALLNL-----NKRLFRISSASHTPSPRLPD 242

Query: 241 XXXXXXXXITLRNKHLTSFFEKEP--IQNSL---NVEEYARTRVEIERKKVLGYEERQLQ 295
                       N    +  E++P  I  S    N+E+YA+ R+E+ R++V  +E  QL+
Sbjct: 243 ASDASERLEIWGN----TLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLK 298

Query: 296 IQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345
             +NPFLKIS  + +  +   S  V    I   L++S+  F+H++PK Q+
Sbjct: 299 RTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQK 348

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  192 bits (489), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/361 (34%), Positives = 189/361 (52%), Gaps = 38/361 (10%)

Query: 2   TGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSL 61
           TG  +  +QL  LP LTE  + E +  + +IL K V  QL S+N    I+ FA + L++L
Sbjct: 10  TGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNI--CISNFALDELVNL 67

Query: 62  VVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKD 121
           V  Q+D M   LH L+ LQRR+  ++AD+ + LR FNL    L +Q Q S+++   +  +
Sbjct: 68  VTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTE 127

Query: 122 YESLXXXXXXXXX-XXXXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYT 180
           YE L               ++ +L + +    + + L+P SNPL+K IPSWLP+FPPD+T
Sbjct: 128 YEKLMSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLPNFPPDHT 187

Query: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRG----------------GQEDRI 224
           YKFTP++N PITD   I++++V+E ++SEKALLNL +                   ED I
Sbjct: 188 YKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAI 247

Query: 225 SRDLKFXXXXXXXXXXXXXXXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERK 284
            + L+                    T+  K   SF E        N+E+YA+ RVE+ R+
Sbjct: 248 EQQLEIWGNALEERKP---------TITEK---SFNEN-------NIEQYAKYRVELARE 288

Query: 285 KVLGYEERQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQ 344
           +V  +E  QL+  +NPFLKIS  +        S       I    ++S+  F+H++PK Q
Sbjct: 289 RVTKFEVNQLKRTKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQ 348

Query: 345 Q 345
           +
Sbjct: 349 K 349

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  190 bits (483), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 118/350 (33%), Positives = 188/350 (53%), Gaps = 16/350 (4%)

Query: 2   TGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSL 61
           +G     +QL  LP LTE  + E +  + +IL K V  QL S+N    I+ FA + L++L
Sbjct: 10  SGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNI--CISNFALDELVNL 67

Query: 62  VVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKD 121
           V  Q+D M   LH L+ LQRR+  ++AD+ +  R FN+    L +Q Q S+++   +  +
Sbjct: 68  VAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVE 127

Query: 122 YESLXXXXXXXXXXXXXYQKLD-LTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYT 180
           Y  L               + D L++ +   ++ + L+P SNPL+KLIPSWLP+FPPD+T
Sbjct: 128 YGKLVRLSSFPALAHNEEDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLPNFPPDHT 187

Query: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFXXXXXXXXXX 240
           YKFTP++N PITD   I++++V+E ++SEKALLNL       R+S               
Sbjct: 188 YKFTPEFNHPITDLKTIKKEIVKESEESEKALLNL-----NKRLSHLSSASHTSPPPVLD 242

Query: 241 XXXXXXXXITLRNKHLTSFFEKEPI-----QNSLNVEEYARTRVEIERKKVLGYEERQLQ 295
                   + +    L    E++P       N  N+E+YA+ RVE+ R++V  +E  QL+
Sbjct: 243 DADATEQQLEIWGNALQ---ERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLK 299

Query: 296 IQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345
             +NPFLK+S  +  +     S     + I    ++S+  F+H++PK Q+
Sbjct: 300 RTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQK 349

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  191 bits (484), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 136/416 (32%), Positives = 203/416 (48%), Gaps = 21/416 (5%)

Query: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66
           K +QL  LP L E      +  + K+L KAVA+QLK++N + SI++FAFE+L+ LV   +
Sbjct: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76

Query: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLS----KLYDKDY 122
            +M+++LH++ ++QRR+ ++K D+ + + G+NLT  DL  + ++SQY+     +   K  
Sbjct: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVR 136

Query: 123 ESLXXXXXXXXXXXXXYQKLDLTHKD--TSTAQTSKLVPISNPLQKLIPSWLPDFPPDYT 180
           E                + L+  H +      +   LVP +    K +P WLP+FPPD+T
Sbjct: 137 EESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHT 196

Query: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISR----DLKFXXXXXX 236
           Y+FT Q+N PITDE +++RK+ EE   SEKAL++L +   E+  S     D  F      
Sbjct: 197 YRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKESQQD 256

Query: 237 XXXXXXXXXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQI 296
                       I   N   +      P QN  NVEEYAR RVEI R+KV  YE  QL +
Sbjct: 257 TQLIFGPAKKTKIAAING-ASDLLRTLPQQN-YNVEEYARNRVEIARRKVEEYERHQLLL 314

Query: 297 QRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQXXXXXXXXXXX 356
           Q+  F+K + L+S     +  K V   E+R  L RS +  + S P  ++           
Sbjct: 315 QKGAFIKAAHLLSPFAKKRNCKQV-EKEVRTLLHRSYIGLLKSAPLLRE-----QRKREV 368

Query: 357 XXXXXXXXXXXXXXXXXXXXXXXXSSDFNLLDLSNYPNDSHGGFFAALESSDEERE 412
                                   S D+++LDL N   D    FF  L SSD E E
Sbjct: 369 ELAEENRRLREEQIRQEREERLKNSKDYDVLDLDNLNEDP---FFGGLGSSDTEDE 421

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  188 bits (477), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 185/344 (53%), Gaps = 6/344 (1%)

Query: 3   GEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLV 62
           G     +QL  LP LTE  + + +  + +IL K V  QL S+  D  I+ FA + L++LV
Sbjct: 11  GTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLV 68

Query: 63  VGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDY 122
             Q+D M   LH L+ LQRR+   +AD+ +  + FNL P  L +Q Q S+++   +  +Y
Sbjct: 69  AVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEY 128

Query: 123 ESLXXXXXXXXXXX-XXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTY 181
           E L               ++ +L + +    + S L+P SNPL+KL+PSWLP+FPPD+TY
Sbjct: 129 EKLVSSSSFSASSHNEEDEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLPNFPPDHTY 188

Query: 182 KFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFXXXXXXXXXXX 241
           +FTP++N PITD   I+R++V+E K+SEKALLNL +      ++                
Sbjct: 189 RFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDDADAGE 248

Query: 242 XXXXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNPF 301
                    L+ +  T+  +     N  N+E+YA+ RVE+ R++V  +E  QL+  +NPF
Sbjct: 249 QQLEIWGNALQEEKRTAISKS---FNENNIEQYAKYRVELARERVSKFEVNQLKRTKNPF 305

Query: 302 LKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345
           L+IS  + ++             I    ++S++ F H++PK Q+
Sbjct: 306 LRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQK 349

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  186 bits (472), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/347 (32%), Positives = 182/347 (52%), Gaps = 16/347 (4%)

Query: 5   ATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVG 64
           A + IQL +LP LTE    ++ P ++K+LA+AV L LK+M  D  IT+  FE+L+  V  
Sbjct: 15  AKEGIQLKKLPDLTEVT--KSNP-MQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVEL 71

Query: 65  QIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYES 124
           Q+DDM+  LHR +++QRRN V+  D+ ++L G  +  E L E+  +SQY+ + +     S
Sbjct: 72  QLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRS 131

Query: 125 LXXXXXXXXXX----XXXYQKLDLTHKDT--STAQTSKLVPISNPLQKLIPSWLPDFPPD 178
           +                  + L  +H +          LVP +N     +P WLP+FPPD
Sbjct: 132 IEEQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPD 191

Query: 179 YTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFXXXXXXXX 238
           +TYKFT  YN PITDE  ++RK+ EE K SEKALL++L    +   + D +         
Sbjct: 192 HTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQL-------P 244

Query: 239 XXXXXXXXXXITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQR 298
                     + +          +       N+E+YAR RVE+ R++V  +E+++LQ+Q+
Sbjct: 245 QIISDGQQENLLIYGPERRRLAPEPAPTRGFNIEDYARCRVELARRRVEEFEQQKLQVQK 304

Query: 299 NPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345
           NPF++ +   S     ++S+     E    L RS +  +H+IP+ ++
Sbjct: 305 NPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRR 351

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  186 bits (472), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/376 (31%), Positives = 191/376 (50%), Gaps = 54/376 (14%)

Query: 5   ATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVG 64
           A ++IQL +LP L E         ++ +L+++VALQLK+M  D SIT+  F ++M  +  
Sbjct: 15  AKEFIQLKKLPGLQEVAKHN---PMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEM 71

Query: 65  QIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYES 124
           Q++DM   LHR +++QRRN ++  D+ ++L+G  +  + L ++ +KS+Y+ K Y+ ++++
Sbjct: 72  QMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKN 131

Query: 125 LXXXXXXXXXXXXXYQKLDLTHKDTSTAQTSKL------------------VPISNPLQK 166
           +              Q LDL  K     +  +L                  VP +N    
Sbjct: 132 IER------------QSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNS 179

Query: 167 LIPSWLPDFPPDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISR 226
            +P+WLP+FPPD+TYKFT  YN PI+DE  ++R + EEGK SEKALLN+L   Q    ++
Sbjct: 180 YVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQ----AK 235

Query: 227 DLKFXXXXXXXXXXXXXXXXXXITL-----RNKHLTSFFEKEPIQN-----------SLN 270
            LK                   +       R +   ++       N             N
Sbjct: 236 MLKVEDEETIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFN 295

Query: 271 VEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLISA-NNDNKVSKSVANTEIRKYL 329
           ++EYAR+R+ + R+KV  +E  +LQ Q+NPF++ S + S   N  K ++  A  E    L
Sbjct: 296 IQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILL 355

Query: 330 KRSLLNFIHSIPKTQQ 345
           +RS +  + SIPK +Q
Sbjct: 356 RRSYVGVLKSIPKLRQ 371

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  171 bits (432), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 130/212 (61%), Gaps = 15/212 (7%)

Query: 19  EYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMVLELHRLSS 78
           E  +   +  IEK+L K++A+QLK+   D S  K AF  L  LV  Q++ ++ ELHRLS 
Sbjct: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFS--KLAFNQLTLLVDDQLNSLITELHRLSL 77

Query: 79  LQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLS-KLYDKDY-------ESLXXXXX 130
           LQRRN++AK D+ +W+RGFN+ P DL  Q + S+Y+  KL  K+Y       E +     
Sbjct: 78  LQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRT 137

Query: 131 XXXXXXXXYQKLDLTHK----DTSTAQTSKLVPISNPLQKL-IPSWLPDFPPDYTYKFTP 185
                       DLT +      +T  ++ L+  +NP + + I SWLP FPPD+TYKFTP
Sbjct: 138 HIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTP 197

Query: 186 QYNTPITDETIIRRKVVEEGKQSEKALLNLLR 217
           Q+N PITDE +I++K+VEEG +SEKALLN L+
Sbjct: 198 QFNNPITDEKLIKQKLVEEGTKSEKALLNFLK 229

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 41/61 (67%)

Query: 249 ITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLI 308
           I++ ++ + +FF         +V +Y+  RVE+ RKKV  +E ++L++++NPFLK+S+L+
Sbjct: 318 ISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLV 377

Query: 309 S 309
            
Sbjct: 378 C 378

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  169 bits (429), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 131/221 (59%), Gaps = 6/221 (2%)

Query: 11  LTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMV 70
           L  LP L +         I ++LAK++ALQLK MN +TSI+  AF  L++LV  Q++DM+
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 71  LELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESL----- 125
            +L RLS  QRR T+A  D+S+WLR FNL P DL    ++S ++   ++KDY  L     
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161

Query: 126 -XXXXXXXXXXXXXYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFT 184
                         Y   DL +  +S + +S++VP SN + + +P WLP  PPD+TYKFT
Sbjct: 162 DYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221

Query: 185 PQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRIS 225
           P YN PITDET++++ +V EGK +E AL+ LL       I+
Sbjct: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEIN 262

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 36/110 (32%)

Query: 268 SLNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLISANND-------------- 313
           + NVEEYAR +V+  R++VL YEE+QLQ Q+NPF K S++I   +               
Sbjct: 355 TFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVGPSQFHHGPHHHHHHHHH 414

Query: 314 ----------------------NKVSKSVANTEIRKYLKRSLLNFIHSIP 341
                                   VSK   N +I++   RSL N I+S+P
Sbjct: 415 HHRRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQMFNRSLNNLINSLP 464

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  154 bits (390), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/319 (33%), Positives = 165/319 (51%), Gaps = 28/319 (8%)

Query: 27  PAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMVLELHRLSSLQRRNTVA 86
           P ++ +L K+VA++LK +N  T +   AF++L+ L+  Q++D++ +L RLS LQRRN+ A
Sbjct: 24  PQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNA 83

Query: 87  -KADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLXXXXXXXXXXXXXYQKLDLT 145
            K+DI + L+GFNL+  +L  + + S ++ +LY +D + L              Q  D  
Sbjct: 84  TKSDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKKLSEDSIHYN------QHTDFV 137

Query: 146 HK-DTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFTPQYNTPITDETIIRRKVVEE 204
              +TS+ Q   L+  +NPL+  IPSW P  PPD+TYKFTP+YN  I D  II++K  +E
Sbjct: 138 GPVETSSFQ---LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDE 194

Query: 205 GKQSEKALLNLLRGGQEDRISRDLKFXXXXXXXXXXXXXXXXXXITLRNKHLTSFFEK-- 262
            K  + AL NL+   + +    DL +                      NK +        
Sbjct: 195 SKTVKTALFNLINKIESNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSII 254

Query: 263 EPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLISANNDNKVSKSVAN 322
            PI    ++EEY+  RV I R KV  +E + L ++ NPF+ +       ND         
Sbjct: 255 VPI-TKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLI------ND--------Q 299

Query: 323 TEIRKYLKRSLLNFIHSIP 341
           T+++ YL RS    I+SIP
Sbjct: 300 TDVKSYLNRSFQLMINSIP 318

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  137 bits (346), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 106/377 (28%), Positives = 186/377 (49%), Gaps = 53/377 (14%)

Query: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66
           + ++L +LP L E  +      +E++ A+AV LQLK++N +  I++ AF+ L  + + Q+
Sbjct: 19  RRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQL 75

Query: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLX 126
           DD++  L +++ +QRR  ++K D++++ +G  +  +DL  Q + S ++   +  +  +L 
Sbjct: 76  DDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALN 135

Query: 127 XXXXXXXXXXXXYQKLDLTHKDTSTAQTSK----------LVPISNPLQKLIPSWLPDFP 176
                       + K +L  K+  +++ S+          L+P SN   K +PSWLP+ P
Sbjct: 136 ETVLKVKQQ---FMK-ELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELP 191

Query: 177 PDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLL-------------------- 216
           PD+TYKFT  Y  PITDE ++++K++EEG+ SEKALLN+L                    
Sbjct: 192 PDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSA 251

Query: 217 ------RGGQEDRISRDLKFXXXXXXXXXXXXXXXXXXITLRNKHLTSFFEKEPIQNSLN 270
                    +E ++  DL F                        H    F   P++N  N
Sbjct: 252 NNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVL------HGIESFNLSPVKN-FN 304

Query: 271 VEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLIS--ANNDNKVSKSVANTEIRKY 328
           V EY + R  I +++    E +    +RNPF++ + + S       K  KSV N +++  
Sbjct: 305 VLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVEN-QLKTM 363

Query: 329 LKRSLLNFIHSIPKTQQ 345
           L+RS L  I SIP+ ++
Sbjct: 364 LRRSYLGLIDSIPRVKE 380

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 116/209 (55%), Gaps = 24/209 (11%)

Query: 32  ILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMVLELHRLSSLQRRNTVAKADIS 91
           +L +AV +QL++++ D ++T+ A + L+     Q++ +V  LHR+S LQRR ++A +D+ 
Sbjct: 37  LLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLE 96

Query: 92  VWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLXXXXXXXXXXXXXYQKLDLTHKD--- 148
           +W+RG+NL P DL    ++S+++ + Y  D   +               ++++ +K+   
Sbjct: 97  IWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKENIE 156

Query: 149 -------TSTAQTSKLVPI-SNPLQKLI-------------PSWLPDFPPDYTYKFTPQY 187
                         +L+ +  + +++L              P WLPDFPPD+TYK+TP Y
Sbjct: 157 PTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSY 216

Query: 188 NTPITDETIIRRKVVEEGKQSEKALLNLL 216
              +  ET IR+K+VEEG+ SEKAL+ L+
Sbjct: 217 VNVVKPETEIRQKLVEEGRLSEKALVKLM 245

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 45/73 (61%), Gaps = 4/73 (5%)

Query: 269 LNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKY 328
            +VE YAR R+EI R+KV+ +E  QL ++ NP L+++++   +      +S   TE +K 
Sbjct: 398 FDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYD----AEESDFETEYQKC 453

Query: 329 LKRSLLNFIHSIP 341
           +KR++  F  +IP
Sbjct: 454 IKRTMDRFKRNIP 466

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 142/320 (44%), Gaps = 37/320 (11%)

Query: 18  TEYKYEETEPAIEKILAKAVALQL------KSMNCDTSITKFAFEHLMSLVVGQIDDMVL 71
            E  +E  +  ++++LA +VA Q+              +   AF+ L+ LV  Q+  MV 
Sbjct: 24  VELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLLQLVEEQLSGMVT 83

Query: 72  ELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKL--YDKDYESLXXXX 129
           ELHR++++QRR      D+++ L+GF LTPED+EEQ     YLSK   Y++  +      
Sbjct: 84  ELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQ----MYLSKKIGYNR-MQVPREQT 138

Query: 130 XXXXXXXXXYQKLDLTHKDTSTAQTSKLVPISN--PLQKLIPSWLPDFPPDYTYKFTPQY 187
                    Y +  L       A       +S   P+ + IP+WLP  PP++TYKFT +Y
Sbjct: 139 VQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEKIPAWLPKLPPNHTYKFTTEY 198

Query: 188 NTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFXXXXXXXXXXXXXXXXX 247
           N  + DE +++ K+++E  + E +L NL+R    D    D K                  
Sbjct: 199 NKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRD---ADTKVDERARETPPEELKRIDD 255

Query: 248 XITL---------------RNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEER 292
            I                 R K  T  +    ++ S +V+ Y+  RV++ R  V  +E  
Sbjct: 256 EIVALYGPLEEIAERHEGPRTKRRTPLY----LKKSFDVQAYSLGRVKLARNAVQRFEWE 311

Query: 293 QLQIQRNPFLKISRLISANN 312
                RNPFL   R +  N+
Sbjct: 312 TKYRPRNPFLCSHRAVPENS 331

>NCAS0A13050 Chr1 (2566112..2567800) [1689 bp, 562 aa] {ON}
           Anc_1.492 YJR052W
          Length = 562

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 529 KEPETTESNGIGSSTDTTKDKEPVISNPEEPQVNS--DINEPTASSTTDTTLQQAQEPEK 586
           KE    E +  G ++ T  D+ P   NP    V+   D+NE T SS  D  LQ AQ+ ++
Sbjct: 48  KEDVNKEVDTKGENSQTESDENP---NPVSLNVSDEEDVNESTPSSIMDRVLQVAQDSDE 104

Query: 587 EEVEA 591
           EE E+
Sbjct: 105 EEYES 109

>TPHA0A02130 Chr1 complement(432707..435508) [2802 bp, 933 aa] {ON}
           Anc_8.195 YDR074W
          Length = 933

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 48/101 (47%), Gaps = 4/101 (3%)

Query: 507 NEKETVEKTETAPAIENSEQTVKEPETTESNGIGSSTDTTKDKEPVISNPEEP-QVNSD- 564
           N++  ++   T PA+  S Q + + E  E + +G + + T+D  P+ +  EE  Q+N D 
Sbjct: 23  NDEWNIKPLLTNPALYTSFQYLNDNENYEQHIVGWTGEITRDDVPIFAKHEEDEQINEDE 82

Query: 565 --INEPTASSTTDTTLQQAQEPEKEEVEADNGQSIENVEPL 603
             + +  +       L Q  + +   +E  +  ++ N +PL
Sbjct: 83  TELKDLDSKVINADILDQHLKNDLNNLEKSSSSAVNNDDPL 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.125    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,692,895
Number of extensions: 2581665
Number of successful extensions: 21680
Number of sequences better than 10.0: 1381
Number of HSP's gapped: 21162
Number of HSP's successfully gapped: 2546
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 69 (31.2 bits)