Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.18.849ON51451424770.0
ZYRO0C14850g8.849ON59447614660.0
TDEL0B001808.849ON58247514370.0
Smik_13.5008.849ON60247913790.0
YMR284W (YKU70)8.849ON60247813241e-178
Skud_13.4578.849ON60247813221e-177
Suva_13.4748.849ON60247813191e-177
NCAS0C003208.849ON60850213131e-176
TPHA0I003108.849ON60848512901e-172
KLTH0C03586g8.849ON57847412451e-166
NDAI0K003608.849ON62051412451e-165
SAKL0D01188g8.849ON58147412261e-163
Kwal_27.101998.849ON57247411901e-158
KAFR0L019508.849ON58848611771e-156
KNAG0M02650singletonON57447611511e-152
TBLA0B028908.849ON64852211491e-150
CAGL0I02662g8.849ON60649610581e-137
KLLA0C06226g8.849ON59248810381e-135
AFR443CsingletonON5764829201e-117
Ecym_46208.849ON5974748091e-100
ABL117C8.849ON6024755344e-60
TPHA0C003005.633ON375117697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.1
         (514 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   958   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   569   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   558   0.0  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   535   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   514   e-178
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   513   e-177
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   512   e-177
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   510   e-176
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   501   e-172
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   484   e-166
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     484   e-165
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   476   e-163
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   462   e-158
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   457   e-156
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   447   e-152
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   447   e-150
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   412   e-137
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   404   e-135
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   358   e-117
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   316   e-100
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   210   4e-60
TPHA0C00300 Chr3 complement(50015..51142) [1128 bp, 375 aa] {ON}...    31   7.3  

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/514 (94%), Positives = 487/514 (94%)

Query: 1   MPKTKYNKILANDEXXXXXXXXXXXNHFDESEVPDGKRPSYRKYDVHEGIMFCVELSEQM 60
           MPKTKYNKILANDE           NHFDESEVPDGKRPSYRKYDVHEGIMFCVELSEQM
Sbjct: 1   MPKTKYNKILANDEILDDDDILGDGNHFDESEVPDGKRPSYRKYDVHEGIMFCVELSEQM 60

Query: 61  FQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCYIYNCHKDNSNNNIFNFIPLED 120
           FQQLPELNYKV                VITRPGTGVGCYIYNCHKDNSNNNIFNFIPLED
Sbjct: 61  FQQLPELNYKVQLLEILESLLELMSQLVITRPGTGVGCYIYNCHKDNSNNNIFNFIPLED 120

Query: 121 VNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESLLELTQDELVKNVSTPKPFNN 180
           VNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESLLELTQDELVKNVSTPKPFNN
Sbjct: 121 VNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESLLELTQDELVKNVSTPKPFNN 180

Query: 181 KKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFK 240
           KKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFK
Sbjct: 181 KKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFK 240

Query: 241 LGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIK 300
           LGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIK
Sbjct: 241 LGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIK 300

Query: 301 GYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAEEVKEGLTKVFPYGDLNIELS 360
           GYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAEEVKEGLTKVFPYGDLNIELS
Sbjct: 301 GYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAEEVKEGLTKVFPYGDLNIELS 360

Query: 361 EEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGSIRMLASLF 420
           EEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGSIRMLASLF
Sbjct: 361 EEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGSIRMLASLF 420

Query: 421 RTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRKFPVITTSS 480
           RTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRKFPVITTSS
Sbjct: 421 RTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRKFPVITTSS 480

Query: 481 FKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           FKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS
Sbjct: 481 FKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/476 (56%), Positives = 353/476 (74%), Gaps = 8/476 (1%)

Query: 40  SYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCY 99
           SYRKY+VHEGI+FC+ELS  MFQ+L ELNYKV                VI RPGTG+GCY
Sbjct: 23  SYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVRPGTGIGCY 82

Query: 100 IYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLES 159
            YNC+KD++ N+I+ F PL D+N K+MKK++DLLDDL+N+R TL K+ PYD+++RTPL+ 
Sbjct: 83  FYNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLPYDESERTPLDF 142

Query: 160 LLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFV 219
           L    QDE +K V   K FNNKKVFLFTDNDSP EA D   K+RLR L DD +++FI F 
Sbjct: 143 LYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRLRHLVDDMDDHFINFT 202

Query: 220 PFFINRENKPFDSSFYSDIFKLG-NSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEI 278
            FFI +E  PFD SFYSD+ KLG  +E+P++    EFDGP+T PISASYIKSRVLRKQE+
Sbjct: 203 TFFIGKEEAPFDDSFYSDVLKLGATAEDPNT----EFDGPNTTPISASYIKSRVLRKQEV 258

Query: 279 KRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCIT 338
           KR++FQC LIL + M F V IKGY+I+ QE+ G RY++VYE ++VRKEA SKRK L+  T
Sbjct: 259 KRIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLVYEKDEVRKEANSKRKFLDSNT 318

Query: 339 AEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITK 398
            E ++EGLTKVFPYGDL+I +++E++ +V+++Y E+  FLK++GFR     +HY+NNI +
Sbjct: 319 GEVIEEGLTKVFPYGDLDITITDEELNEVRKSYTEEESFLKIIGFRDYNKCIHYFNNIDR 378

Query: 399 PSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEG 458
             FVVPDE + +GSIR LASLF+ +R K KVAV+WGKLK NSHP ++VLS S   DPNEG
Sbjct: 379 ALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLKTNSHPAVFVLSPSRNEDPNEG 438

Query: 459 FFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           F+LYRIPF +E+R+FP    S  + N+ +T EY  +K TT++I+ +F    GY PS
Sbjct: 439 FYLYRIPFAEELRRFP---QSLIRHNSYDTPEYNQLKDTTKSIIDHFQFAKGYRPS 491

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/475 (55%), Positives = 350/475 (73%), Gaps = 7/475 (1%)

Query: 40  SYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCY 99
            YR+YD+HEGI+FC+ELS  MF +LPELNYK+                VITRP TG+GCY
Sbjct: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74

Query: 100 IYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLES 159
            +NC++ ++ + I+ F+PL+DVN + MKK++DLL+DL  ERTTL ++ PYD ++ TPLES
Sbjct: 75  FFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLES 134

Query: 160 LLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFV 219
           LLEL ++E VK+V   K FNNKK+F FTDNDSP EASD   K+RLR L +D ++ FI F 
Sbjct: 135 LLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFT 194

Query: 220 PFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIK 279
            FFI +   PFD  FYSDI +LG +   S     EFDGP+T PISA+YIKSRVLRKQEIK
Sbjct: 195 TFFIGKPGLPFDEGFYSDILRLGATTKASD----EFDGPNTTPISAAYIKSRVLRKQEIK 250

Query: 280 RVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITA 339
           R++FQC LIL ++  F V +KGY+I+S EK G RYK+VYE+ED+R+EAFS+RK LN  T 
Sbjct: 251 RIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTG 310

Query: 340 EEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKP 399
           EE+K+GLTKV+PYGDL+IELSE DI +++  Y  +  FLK++GF+S E  LHYYNNI K 
Sbjct: 311 EEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKA 370

Query: 400 SFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGF 459
           +FVVPDE + +GSIR L+SLF+ +R+KNKVA++WGKLK NS+P ++    S+ + PNEGF
Sbjct: 371 TFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGF 430

Query: 460 FLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           +LYR+PFLDE+R+ P +  S      +   +YEN+K  T+ ++ +FNLK+G+ PS
Sbjct: 431 YLYRVPFLDELRRIPPMLIS---HGEIQDDDYENLKEATKKLINHFNLKNGFEPS 482

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/479 (53%), Positives = 341/479 (71%), Gaps = 5/479 (1%)

Query: 39  PSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGC 98
           P YRK+D+HEGI+FCVELSE MF++  EL+YK                 VITRPGT +GC
Sbjct: 21  PGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGC 80

Query: 99  YIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQ---RT 155
           Y Y C++D++   I+   PL D+NV+ MKK+NDLL+DLS+ER TL +YF + KT+   + 
Sbjct: 81  YFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQM 140

Query: 156 PLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENF 215
           PL SL     D  +++ S  K  NNK+VFLFTDND P EA +   +ARLRRL  D  +N 
Sbjct: 141 PLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNK 200

Query: 216 ITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRK 275
           I F  FFI   N  FD+ FYSDI +LG+ +N +     EFDGP+T+PI A YIKSR+LRK
Sbjct: 201 INFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRK 260

Query: 276 QEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILN 335
           +E+KR++FQC LI +++ +F + IKGY++ S EK G RYK+VYEHED+R+EA+SKRK LN
Sbjct: 261 REVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLN 320

Query: 336 CITAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNN 395
            ++ E+V +   KV+PYGDL+I LSE   + V EAY     FLK+ GFRS  IS+HY+NN
Sbjct: 321 FMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNN 380

Query: 396 ITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDP 455
           I K SF+VPDE K +GSIR L SL + +RKK+K+A+LWGKLK NSHP L+VLS SN  + 
Sbjct: 381 IEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEY 440

Query: 456 NEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           NEGF+LYR+PFLDEIRKFP +   S+ + + + I+Y+N+K+ T++I+GYFNL+ GY PS
Sbjct: 441 NEGFYLYRVPFLDEIRKFPSLL--SYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPS 497

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  514 bits (1324), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 336/478 (70%), Gaps = 5/478 (1%)

Query: 40  SYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCY 99
            YRK+D+HEGI+FC+ELSE MF++  +L YK                 VITRPGT +GCY
Sbjct: 22  GYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIGCY 81

Query: 100 IYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKT---QRTP 156
            Y C+++++   I+   PL D+N   MKK+NDLL+DLS+ R +L  YF + +T   ++  
Sbjct: 82  FYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQVR 141

Query: 157 LESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFI 216
           L  L     D  ++ +   K  +NK+VFLFTD D P EA D   +ARLRRL  D  +N +
Sbjct: 142 LSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLTIDLFDNKV 201

Query: 217 TFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQ 276
            F  FFI   +KPFD+ FYSDI +LG+  N ++  + EFDGPST+PI A YIKSR+LRK+
Sbjct: 202 NFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPIDAKYIKSRILRKK 261

Query: 277 EIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNC 336
           E+KR++FQC LIL+++ NF V +KGY++ + EK G RYK+VYEHED+R+EA+SKRK LN 
Sbjct: 262 EVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKFLNP 321

Query: 337 ITAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNI 396
           IT E+V     KV+PYGDL+I LS+   + V EAY +   FLK++GFRS   S+HY+NNI
Sbjct: 322 ITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNI 381

Query: 397 TKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPN 456
            K SF+VPDE+K +GSIR LASL + +RKK+K+A+LWGKLK NSHP L+ LS S+  D N
Sbjct: 382 DKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYN 441

Query: 457 EGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           EGF+LYR+PFLDEIRKFP +   S+ + + + ++Y+N+K+ T++I+GYFNL+ GY PS
Sbjct: 442 EGFYLYRVPFLDEIRKFPSLL--SYDDGSEHKLDYDNMKKVTQSIMGYFNLRDGYNPS 497

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  513 bits (1322), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 332/478 (69%), Gaps = 5/478 (1%)

Query: 40  SYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCY 99
            YRK+D+HEGI+FCVELSE MF++  EL+YK                 VITRPGT +GCY
Sbjct: 22  GYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQLVITRPGTAIGCY 81

Query: 100 IYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYF---PYDKTQRTP 156
            Y C +D++   IF F PL D+N   MK++NDLL+DLS+ R TL +YF   P +K ++ P
Sbjct: 82  FYYCSRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEYFNFQPTEKQRQMP 141

Query: 157 LESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFI 216
           L  L     D  ++++   +  ++KKVFLFTDND P EA D   +ARLR L  D  +N +
Sbjct: 142 LGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRARLRSLTIDLFDNKV 201

Query: 217 TFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQ 276
            F  FFI   NK FD+ FYSDI +LG+  N       EFDGP+T+PI+A YIKS++LRK+
Sbjct: 202 NFSTFFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEFDGPNTKPINAKYIKSKILRKK 261

Query: 277 EIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNC 336
           EIKR++FQC L+  +  +FTV +KGY++ S EK G RYK+VYEHEDVR+EAFSKRK LN 
Sbjct: 262 EIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYEHEDVRREAFSKRKFLNP 321

Query: 337 ITAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNI 396
           +T E+V     KV+PYGDL+I  SE   + V EAY +   FL+++GFRS   ++HY+NNI
Sbjct: 322 MTGEDVTSSTVKVYPYGDLDINFSENQNQIVMEAYTQKDAFLRIIGFRSSSKAIHYFNNI 381

Query: 397 TKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPN 456
            K +F+VPDE+K +GS+R L SLF+T+RKK+K+A+LWGKLK NSH  L+VLS S+  + N
Sbjct: 382 EKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKTNSHASLFVLSPSSIKEYN 441

Query: 457 EGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           EGF+LYR+PFLDEIRKFP +   S+       ++YEN+K+ T+NI+GYFNLK GY PS
Sbjct: 442 EGFYLYRVPFLDEIRKFPSLL--SYDNGEKYKLDYENMKKITQNIMGYFNLKDGYNPS 497

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  512 bits (1319), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 335/478 (70%), Gaps = 5/478 (1%)

Query: 40  SYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCY 99
           SYRK+D+HEGI+FC+ELS  MF++ PELNYK                 VITRPGT +GCY
Sbjct: 22  SYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCY 81

Query: 100 IYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPY---DKTQRTP 156
            Y C +D++   I+   PL D+N K MK +NDLL+D+S+ R TL +YF +   +K  + P
Sbjct: 82  FYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMP 141

Query: 157 LESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFI 216
           L  L     D  ++++   K  ++KK+FLFTDND P E+ D   +ARLRRL  D  +N +
Sbjct: 142 LGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKV 201

Query: 217 TFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQ 276
            F  FFI   N  FD+ FYSDI +LG+ +N   D + EFDGP+T+PI A YIKS++LRK+
Sbjct: 202 NFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILRKK 261

Query: 277 EIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNC 336
           E+KR+ FQC LI +++ NF + +KGY++ S EK G RYK+VYEHED+R+EA+SKRK LN 
Sbjct: 262 EVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNP 321

Query: 337 ITAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNI 396
            T  +V     KV+PYGDL+I LSE+  + + EAY +   FL+++GFRS   S+HY+NNI
Sbjct: 322 TTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNI 381

Query: 397 TKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPN 456
            K +F+VPDE+K +GSIR LASL +T+RKK+KVA++WGKLK NSHP L+VLS S+  + N
Sbjct: 382 EKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYN 441

Query: 457 EGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           EGF+LYRIPFLDEIRKFP +   S+     + +EY+N+KR +++I+GYFNL+ GY PS
Sbjct: 442 EGFYLYRIPFLDEIRKFPSLL--SYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPS 497

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  510 bits (1313), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 260/502 (51%), Positives = 353/502 (70%), Gaps = 23/502 (4%)

Query: 32  EVPDGKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITR 91
           E+ +G  PS++KYD+HEGI+FC+ELS+ MF+++PELNYKV                VI R
Sbjct: 5   EIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIR 64

Query: 92  PGTGVGCYIYNCHKDN--SNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPY 149
           P TG+GCY + C + N  S N I+ F PL DVN + MKKV+DL++DL+ +R TL +YF +
Sbjct: 65  PSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNF 124

Query: 150 DKT------QRTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKAR 203
           D T      +R PLE+L     D+  K  +    +++KK+FLFTDNDSP E +DK    R
Sbjct: 125 DPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLR 184

Query: 204 LRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFKLG---NSEN-----PSSDYEI-E 254
           +RR+ DD N+N+I FV FFI RE KPF +SFYS+I KLG   N EN      + D E  E
Sbjct: 185 IRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSE 244

Query: 255 FDGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRY 314
           +DGP+T PI ASYIKS++LRK+EIKR +FQC LIL +E NF V+++GY+IV+QEK  +RY
Sbjct: 245 YDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRY 304

Query: 315 KMVYEHEDVRKEAFSKRKILNCITAEEVK-EGLTKVFPYGDLNIELSEEDIKKVKEAYLE 373
           K+VYEHE++RKEA S+RK LN  T EE+K + L KVFPYGD +IEL+++++ K+ + Y +
Sbjct: 305 KLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSK 364

Query: 374 DGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLW 433
              FLK++GFRS + S+ Y+NNI K  FVVPDES+ +G+I+ +ASLFR ++K++K  ++W
Sbjct: 365 HESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVW 424

Query: 434 GKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIE-YE 492
           GK+K NS+  L++LS +   D NEGF+LYRIPFLDEIRKFP +       N + T E Y 
Sbjct: 425 GKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKL----LDYNHITTSEDYL 480

Query: 493 NIKRTTENIVGYFNLKHGYIPS 514
           N+ R TENI+GYFNLK GY PS
Sbjct: 481 NLVRITENIIGYFNLKKGYRPS 502

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  501 bits (1290), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 256/485 (52%), Positives = 333/485 (68%), Gaps = 12/485 (2%)

Query: 35  DGKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGT 94
           D  + SYRKY+ HEG MFC+ELSE MF ++ +LNYKV                VITRP T
Sbjct: 29  DNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPST 88

Query: 95  GVGCYIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKT-- 152
           GVGC+ +NC    S   I+ F+PL D+NV  MKK++DLLDD+  ER ++   F +D+   
Sbjct: 89  GVGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEIND 148

Query: 153 QRTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNN 212
           +   LESL  L QD    N+   K + NKKVFLFTDND P E++DK    RLRRLFDD +
Sbjct: 149 KGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDIS 208

Query: 213 ENFITFVPFFINR--ENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKS 270
           +N+I FV FFIN+   +  FD SFYSDI KL NS +      IEFDGPST+PIS +YIK+
Sbjct: 209 DNYIQFVTFFINKIDSSDNFDDSFYSDILKLRNSNS------IEFDGPSTKPISVAYIKN 262

Query: 271 RVLRKQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSK 330
           +VLRK+EIKR++FQC LILN + +F V +KGY+I+S EK GSRYK+VYEHE++R+EAFSK
Sbjct: 263 KVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSK 322

Query: 331 RKILNCITAEEV-KEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEIS 389
           RK+LN  T   V K+   K+F  G+ +I   E + +K  +  L   PFLKL+GFRS E S
Sbjct: 323 RKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENS 382

Query: 390 LHYYNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSA 449
           LH +NNI K  F+VPDES+  GSIR L+S++RTMR KN+ A++WGKLK NS+P +W+LS 
Sbjct: 383 LHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSP 442

Query: 450 SNAS-DPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLK 508
           S+ + D NEGF+LY++PFLDEIRK P   T    +  +   +YEN+KR T NI+GYFNL 
Sbjct: 443 SDPTKDQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLT 502

Query: 509 HGYIP 513
           +GY P
Sbjct: 503 NGYSP 507

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  484 bits (1245), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 235/474 (49%), Positives = 329/474 (69%), Gaps = 5/474 (1%)

Query: 41  YRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCYI 100
           Y+K++VHEGI+FCVELSE MF++  +LN KV                +I  PGTG+GC+ 
Sbjct: 16  YKKFEVHEGIIFCVELSEAMFKEPFDLN-KVQLLEILETLLELMTQVIIILPGTGIGCFF 74

Query: 101 YNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESL 160
           + C  + +   I+ F+PL DVN ++MKK+NDLLDDL    TTL + FP++  Q T LE++
Sbjct: 75  FQCSHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPFNDKQNTSLEAV 134

Query: 161 LELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFVP 220
             L Q++  ++V   K +NNKK+FLFTDND P E+ D+  K RLR++ DD +++FI  +P
Sbjct: 135 FVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLDDSFINIIP 194

Query: 221 FFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKR 280
           FF+  E +PFD SFYSDI KLG ++  +SD   +++GP+T PISA  IKSRVLRK+EIKR
Sbjct: 195 FFVGSEQRPFDQSFYSDILKLG-AKKKASDGPFKYEGPNTTPISAKLIKSRVLRKKEIKR 253

Query: 281 VLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAE 340
           V FQCSLILN+  +F V+IKGY+ +S E+ GS+YK VY+H+ +RKEA S RK L+  T E
Sbjct: 254 VRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKEALSHRKYLDANTGE 313

Query: 341 EVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPS 400
           +V E + KVF + +++IELSE++I K+   Y     FLKL+GFR     + Y+NNI+  S
Sbjct: 314 DVTERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDTNRCVFYFNNISNSS 373

Query: 401 FVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFF 460
           FVVPD+S   GSI+ +ASLFR +R+K K AV+WGKLK NS+P L+ L+ SN +D NEGF+
Sbjct: 374 FVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYTLTPSNFNDHNEGFY 433

Query: 461 LYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           L R+PF+DEIRKFP    +++  N   T  +E + + TE ++ YF+L+H Y PS
Sbjct: 434 LTRVPFIDEIRKFP---PTAYHGNLSKTKTFEQMCKITETLISYFSLRHSYRPS 484

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  484 bits (1245), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 251/514 (48%), Positives = 343/514 (66%), Gaps = 28/514 (5%)

Query: 26  NHFDESEVPDGKRPS--YRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXX 83
           N  DE E      PS  Y+KYD+HEGI+FC+ELS++MFQ++PELNY V            
Sbjct: 8   NEDDEYEPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLEL 67

Query: 84  XXXXVITRPGTGVGCYIYNCHKDNSN---------NNIFNFIPLEDVNVKAMKKVNDLLD 134
               VI RP TGVGCYI+ C+K ++N         + I+   PL DVN   MKK++DL +
Sbjct: 68  MSHLVIIRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFE 127

Query: 135 DLSNERTTLTKYFPYDKTQ----RTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDND 190
           DL +ER TL KYF +D  +    + PLE L     D+          ++++K+FLFTDND
Sbjct: 128 DLQHERITLMKYFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDND 187

Query: 191 SPTEASDKAGKARLRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSD 250
           SP E+ +   K R+RRL DD N+N+I F  FFI   ++PFD SFYSD+ KLG     +SD
Sbjct: 188 SPIESEEHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSD 247

Query: 251 YEI---------EFDGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIKG 301
            +          EFDGP+T+PI A YIKSR+LRK+EIKR+ FQ  LILN++  F + I+G
Sbjct: 248 QDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRG 307

Query: 302 YSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAEEVK-EGLTKVFPYGDLNIELS 360
           Y + S EK  +RYK+VYE E+VRKEAFS RK LN  T EE++ +   K+FPYGD+NIEL+
Sbjct: 308 YMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELN 367

Query: 361 EEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGSIRMLASLF 420
           ++++ KV+E       FLK++GFRS    L+Y+NNIT  +FVVPDES+ +GSIR +ASLF
Sbjct: 368 DKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLF 427

Query: 421 RTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRKFPVITTSS 480
           RT++KK+KVA++WGK+K NS P L++L  ++ SD NEGF+LYR+PFL+EIRKFP +    
Sbjct: 428 RTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLL--D 485

Query: 481 FKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           +K+ + N  +Y N+ + T  IV YF+L++GYIPS
Sbjct: 486 YKDRSSNP-DYTNLIKITSKIVEYFHLRNGYIPS 518

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  476 bits (1226), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 232/474 (48%), Positives = 329/474 (69%), Gaps = 4/474 (0%)

Query: 41  YRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCYI 100
           Y+KY+VH GI+FC+EL+  M++++ ELN+K+                ++T P TGVGCY 
Sbjct: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78

Query: 101 YNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESL 160
           + C+KDNS + I+ F+PL+DVN K MKK+NDLL+DL  +R TL + FP+  +    LES+
Sbjct: 79  FQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESV 138

Query: 161 LELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFVP 220
           L   +++ +K +   K +NN KVFLFTDN  P    +   ++ LR++ +D N+ +I F P
Sbjct: 139 LVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTP 198

Query: 221 FFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKR 280
           FFI+ E KPFD SFYSDI KL    +     E+ FDGP+T PI ASYIKSRV RK+E +R
Sbjct: 199 FFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEM-FDGPNTTPIPASYIKSRVSRKKETRR 257

Query: 281 VLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAE 340
           V FQC LIL+   NFT++IKGY+I+S EK G+RYK+VYE+E +RKEAFS R+ L+  T  
Sbjct: 258 VKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGV 317

Query: 341 EVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPS 400
           +V + + K+FPYGD NIELS+ED+ K+ +       FLK++GFRS +  L YYNN+ K +
Sbjct: 318 DVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTA 377

Query: 401 FVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFF 460
           FVVPDE   +GSIR +ASL+R +R K K AV+WGKLK NS+PG+++++ S  +DPNEGF+
Sbjct: 378 FVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFY 437

Query: 461 LYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           L RIPF+DEIR+FP +       + +++ +Y ++ + TE I+ YFNL++GY PS
Sbjct: 438 LTRIPFIDEIRRFPSVPQYG---DVLSSQDYGHMCQATETIIAYFNLRNGYKPS 488

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  462 bits (1190), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 225/474 (47%), Positives = 320/474 (67%), Gaps = 5/474 (1%)

Query: 41  YRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCYI 100
           Y+K++VHEGI+FC+ELS+ MF++  ++N KV                +I+ PGTG+GCY 
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDMN-KVQLVEILETLLELMSQVIISLPGTGIGCYF 68

Query: 101 YNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESL 160
           ++C  +N+   I+  +PL DVN ++MKK+NDLLDD++   TTL K FP D+   TPLE++
Sbjct: 69  FHCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLDEQLSTPLETV 128

Query: 161 LELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFVP 220
             L Q++ +  V   K +NNKK+FLFTDNDSP EA D   + RLR++ DD ++  I F  
Sbjct: 129 FILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHINFTT 188

Query: 221 FFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKR 280
           FFI  E KPFD SFYSDI KLG  +  S      F+GPST PI+A+ IK+R LRK+EIKR
Sbjct: 189 FFIGTEQKPFDQSFYSDILKLGAKKTASQGGST-FNGPSTAPINANLIKARALRKKEIKR 247

Query: 281 VLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAE 340
           + FQC L LN+  +F V+IKGY++VS E+ G++YK VY+H  +RKE  S RK LN  T E
Sbjct: 248 IRFQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNANTGE 307

Query: 341 EVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPS 400
           +V + + +VF + +++IE SEE++ K+ + Y  +  FLKL+GFR     L +Y+NI   S
Sbjct: 308 DVTDSIARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFFYDNIGNSS 367

Query: 401 FVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFF 460
           FVVPDES ++GSI+ ++SLFR++ KK K AV+WGKLK NS+P +++LS S + D NEGF+
Sbjct: 368 FVVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTSKDLNEGFY 427

Query: 461 LYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           L R+PF+DE+RKFP I     +    N   +E + + TE ++ YF+L+  Y PS
Sbjct: 428 LTRVPFVDEVRKFPPIPRYDEELGGKN---FEQMCKITETLISYFSLRRPYKPS 478

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  457 bits (1177), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 231/486 (47%), Positives = 330/486 (67%), Gaps = 10/486 (2%)

Query: 30  ESEV-PDGKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXV 88
           +SEV  D +  SY+K++ HE ++F VELS+ MF+ +PELN K+                +
Sbjct: 5   DSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KIQLIEILESLEELMSQLI 63

Query: 89  ITRPGTGVGCYIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFP 148
           + RP   +GCY + C K+ ++  I+ F PL D+N K MKK++DLL+DL  +R  L  +F 
Sbjct: 64  VVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDFFQ 123

Query: 149 YDKTQRTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLF 208
           Y+  ++T +E L     ++    V+  + +  +++FLFTDNDSP +  DK  K+ LR++ 
Sbjct: 124 YNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIV 183

Query: 209 DDNNENFITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYI 268
           DD +E+ + FVPFFI R + PF+S+ YS+I KLG  ++ S++Y    DGP+T PI ASYI
Sbjct: 184 DDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSSTEY----DGPNTTPIQASYI 239

Query: 269 KSRVLRKQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAF 328
           KS+VLRK+EIKRV F+C LILN++ NF V ++GY  VS EKV +RYK+VYE+E++R+EAF
Sbjct: 240 KSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAF 299

Query: 329 SKRKILNCITAEEVK-EGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLE 387
           S+RK L+  TAEE+K + LTK+F  GDL+IE+ E    +V++A  +   FLK++GFRS++
Sbjct: 300 SRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIK 359

Query: 388 ISLHYYNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVL 447
             + Y NNI K  FVVPDE +   SI++L SLF+T+R K K A++WGKLK NS+P L+VL
Sbjct: 360 SCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVL 419

Query: 448 SASNASDPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNL 507
             S   DPNEGF+L+R+PFLDEIRK P + T    E   NT +YEN+ + TE I+ YFNL
Sbjct: 420 EPSGEKDPNEGFYLHRVPFLDEIRKLPTMITY---ECGENTSDYENLIKVTEYIMAYFNL 476

Query: 508 KHGYIP 513
           K GY P
Sbjct: 477 KGGYNP 482

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  447 bits (1151), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 216/476 (45%), Positives = 318/476 (66%), Gaps = 11/476 (2%)

Query: 40  SYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCY 99
            Y+KYD HEGI+FC+EL+  +F+ +  L  +                 VI RPG+ VGC 
Sbjct: 15  GYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLVIVRPGSSVGCI 74

Query: 100 IYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLES 159
            +    + + + ++ F+PL DVN K MK ++D L+D+  +R  + +YF +D ++   LE 
Sbjct: 75  FHYTDINGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQYFKFDGSKHVSLER 134

Query: 160 LLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFV 219
           L +L  ++  +     K F +K+ FLFTDND+P E++D     R+ ++ DD +E  ++F 
Sbjct: 135 LFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISKIVDDLDETAVSFT 194

Query: 220 PFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIK 279
            FFI  E  PFD+ FYS++ KLG ++   SDY    DGPS RPI+ S IK+R+LR +EIK
Sbjct: 195 TFFIGSEEAPFDNRFYSNVLKLG-AQLKHSDY----DGPSVRPITGSDIKARILRGKEIK 249

Query: 280 RVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITA 339
           R +FQC L LNK+ NF + I+GY+IV+ EK G+RYK+ YE ED+R+EAFSKRK LN  T 
Sbjct: 250 RTMFQCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFSKRKYLNSKTG 309

Query: 340 EEVK-EGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITK 398
           EEV  + ++KV PYGD+NIELS E +++++ +Y E+GPF+K+LGFRS ++ + Y+NNI K
Sbjct: 310 EEVDPKDISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTDLCVKYFNNIDK 369

Query: 399 PSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEG 458
           PSF+VPDE + +GSI+ LASLFRT+R KNK A++WGK K NS+  L+++  S+  D N+G
Sbjct: 370 PSFIVPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIMVPSHREDRNDG 429

Query: 459 FFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           F+++RIPFLDE+RK P+       +N    ++  ++   TE I+ YFNL+ GYIPS
Sbjct: 430 FYMHRIPFLDELRKVPI----KMVDNDWTQLD-NDLLTVTETILKYFNLRQGYIPS 480

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  447 bits (1149), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/522 (46%), Positives = 332/522 (63%), Gaps = 44/522 (8%)

Query: 36  GKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTG 95
            +  SY+K+ +HEGI+FCVELS +MF+ LPEL  K                 +I+RP T 
Sbjct: 18  SRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTA 77

Query: 96  VGCYIYNCHKDNSNNN---IFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKT 152
           +G Y+++   D+   N   I+ F  L D+NVK MKKV DLL+DLS++R  L   F +D +
Sbjct: 78  IGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNS 137

Query: 153 QRTPLESLLELTQDELVK--NVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDD 210
           + T LE +  + Q++ +   ++   K FN KKVFLFT+ND P E+ +   + +LRR+ +D
Sbjct: 138 RPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVND 197

Query: 211 NNENFITFVPFFINRENKPFDSSFYSDIFKL---------------------GN------ 243
            NE+ I F  FFIN+ +  FD +FYSDI KL                     GN      
Sbjct: 198 LNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLIN 257

Query: 244 -----SENPSSDYEI-----EFDGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEM 293
                S++ ++D +I      F  P+T+PI AS IK R+LRKQEI+RV FQC LIL++  
Sbjct: 258 DLKDTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEAS 317

Query: 294 NFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAEEVK-EGLTKVFPY 352
           NF + I GY+I S EK G+RYK+VYEHE+VRKEAFS+RK L+  T EE+K E   KV+ Y
Sbjct: 318 NFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKY 377

Query: 353 GDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGS 412
           GD+NIELS+E  + +K  Y+E+ PF+KLLGFRS +ISL YYNNI K SFVVPDES  +GS
Sbjct: 378 GDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGS 437

Query: 413 IRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRK 472
           I+ +ASLFRT+ KK KVA++WG      HP + +LS SN ++ NEG +L+++PFLDEIR+
Sbjct: 438 IKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRR 497

Query: 473 FPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
           FP +T+ S   N  N  EYE +K+ TE I+G  +L+ GY PS
Sbjct: 498 FPALTSYSPGTNK-NISEYEKMKKLTEYILGTLDLRKGYRPS 538

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  412 bits (1058), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 215/496 (43%), Positives = 313/496 (63%), Gaps = 15/496 (3%)

Query: 26  NHFDE-SEVPDG---KRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXX 81
           N FDE S   DG   K+ S++++++HEGIMFC+ELSE MF+   EL+ K           
Sbjct: 12  NIFDEDSGKEDGEVNKQASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLS 71

Query: 82  XXXXXXVITRPGTGVGCYIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERT 141
                 ++TRP T +GCY YNC +++S  +IF FIPL D+NV+ MKKVNDLL+D+SN+R 
Sbjct: 72  ELMELLIVTRPSTAIGCYFYNCEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRI 131

Query: 142 TLTKYFPYDKTQRTPL------ESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEA 195
           T  +Y  Y+  Q   L      E L  L  +   +N+   K FN+KKVFLFTDND P   
Sbjct: 132 TFKEYLNYNIDQNKKLNIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVE 191

Query: 196 SDKAGKARLRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEF 255
           S +     L+ +  D ++N I F  FFI++++KPF+ +FYS +  L N  + +S     +
Sbjct: 192 SQQRSIDVLKGILKDIDDNMINFTNFFISKKDKPFNPAFYSKV--LRNDRDYNSLGSQAY 249

Query: 256 DGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYK 315
            GPST+PI  + IK R+ +++EI+RV+FQC L+L++  NF ++IKGYSI + EK   RYK
Sbjct: 250 FGPSTKPIGVNDIKERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYK 309

Query: 316 MVYEHEDVRKEAFSKRKILNCITAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDG 375
           +VYE++++RKEAFSKRK +N  T E+V +   K+ PYG+  IE+ +++I      Y    
Sbjct: 310 LVYENQEIRKEAFSKRKFINPKTGEDVSKQTVKIIPYGEKEIEMEDKNIANALNVYGNTS 369

Query: 376 PFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGK 435
             L ++GF + + SL +YNNI K  F+ PDE+ I+GS    ASLFRT++K  KV V+WG 
Sbjct: 370 ASLTVIGFLNEDNSLVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGS 429

Query: 436 LKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIK 495
            K NS P L++L  S   D N+GF+L ++PF+DEIRK+P ++  +  E      EY+N+K
Sbjct: 430 TKSNSSPSLYLLWPSKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWE---EYKNVK 486

Query: 496 RTTENIVGYFNLKHGY 511
             T+ I+ +FNLK GY
Sbjct: 487 ELTQGIISHFNLKSGY 502

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  404 bits (1038), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 207/488 (42%), Positives = 309/488 (63%), Gaps = 8/488 (1%)

Query: 29  DESEVPDGKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXV 88
           D+ +  D K+  +R+Y+ H+GI+FC++L+  M+   P+L  K+                V
Sbjct: 18  DDDKESDHKK--WRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLV 75

Query: 89  ITRPGTGVGCYIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFP 148
           +  P T VGCYIYNC   N+ +N++  IPL DVN K MK+V+DLL+D+  +R  L    P
Sbjct: 76  VVMPSTAVGCYIYNCSHPNAEDNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIP 135

Query: 149 Y-DKTQRTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRL 207
             D      L  +L   ++  ++ +   K   NKK+F FTD+D P E  +   ++RLR++
Sbjct: 136 IADPNNPIELSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKV 195

Query: 208 FDDNNENFITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASY 267
            DD  + +I FV FFI  E+KPFD S Y+DI K G+  N +  + +   GPST PI+ASY
Sbjct: 196 VDDLYDYYINFVTFFIGSEDKPFDDSMYADILKWGSKINEAQSW-LSSHGPSTNPINASY 254

Query: 268 IKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEA 327
           IKS+V R +EIKR+ F+C L+L++  +  V++ GY+IVS E  GS+YK+VY +  VR+EA
Sbjct: 255 IKSKVKRTKEIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREA 314

Query: 328 FSKRKILNCITAEEVKEG-LTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSL 386
           +S R+ L+  T E V    L+KV+ +GD  IEL+E++  K++  Y E   FLKL+GFRS 
Sbjct: 315 YSHREYLDAETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRST 374

Query: 387 EISLHYYNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWV 446
           E  LHYY+NI  P+FVVP+E    GSI+ LASL+RTM  K K A++WGKL+ NS P ++V
Sbjct: 375 EQCLHYYDNIDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFV 434

Query: 447 LSASNASDPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFN 506
           L+ S+  D N+GF+LY++PF++E+RK P     S     + + +Y+ + + TE ++ +FN
Sbjct: 435 LTPSSKKDYNQGFYLYKVPFMEEVRKLPDFLNHS---ALIESDDYKVMSKVTETLINFFN 491

Query: 507 LKHGYIPS 514
           LK+GY PS
Sbjct: 492 LKNGYRPS 499

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  358 bits (920), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/482 (41%), Positives = 283/482 (58%), Gaps = 8/482 (1%)

Query: 35  DGKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGT 94
           D KR  + +Y+VHEGI+FCVELS  M++  PEL  K                 V   P T
Sbjct: 21  DDKR--HLRYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVAVMPDT 78

Query: 95  GVGCYIYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQR 154
           GVGCY + C    +   I+   PL DVNV  MKKV  LL+ +   + +L +  PYD    
Sbjct: 79  GVGCYFFQCRHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELPYDGRHP 138

Query: 155 TPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNEN 214
           T L+ +    QD+ ++ V   + +NNKK+FLFTDNDSP E      + RLR++ DD N+ 
Sbjct: 139 TSLDVVFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVVDDLNDY 198

Query: 215 FITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLR 274
           +I F  FFI  E +PFD SFYSDI KLG         +  +DGPST+PIS SYI+SRVLR
Sbjct: 199 YINFSTFFIGTEQRPFDESFYSDILKLGAQVAAEGSSKPLYDGPSTKPISVSYIRSRVLR 258

Query: 275 KQEIKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKIL 334
           K+E++R+ + C L LN+E    V++KGY+  + E+ G+RY+MVY+HEDV++EAFS R+ L
Sbjct: 259 KKEVRRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQREAFSHRRYL 318

Query: 335 NCITAEEVKEGLTKVFPYG--DLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHY 392
           +  T EE  E L KV+  G   L++    E++     A   D  FL++LG R+    L Y
Sbjct: 319 DPDTGEEATEDLCKVYQIGDDCLDLPDDLENLITNFAAPTSDS-FLRMLGSRTAVAVLPY 377

Query: 393 YNNITKPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNA 452
           YNNI   +F+VPD+S   GS  +LASL RT+R   +  VL+GKL+  S P L+ L+ + A
Sbjct: 378 YNNIHHVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSLPALYALAPAAA 437

Query: 453 SDPNEGFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYI 512
             P+  F L R+PF +E+RKFP ++     + ++ + +Y  +++ T  I+    L   Y 
Sbjct: 438 PLPDAVFILARLPFQEEVRKFPALSPP---QASLASPDYAVLQKITSRIIDLLVLSSPYA 494

Query: 513 PS 514
           P+
Sbjct: 495 PA 496

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 167/474 (35%), Positives = 278/474 (58%), Gaps = 14/474 (2%)

Query: 43  KYDVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCYIYN 102
           K++  + I+ C+ELS +++Q   E++ K                  +  P + V CY+Y 
Sbjct: 17  KHERRQSIIVCIELSSRVYQS-SEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQ 75

Query: 103 CHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESLLE 162
           C + N  + I+  +PLE VNV+ + K++ LL D+ N++  L    P+++   +PL S+L 
Sbjct: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLA 135

Query: 163 LTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASD----KAGKARLRRLFDDNNENFITF 218
             Q +L    +    F NK++ L T ND P E  D    K  K  +  L+DD+     + 
Sbjct: 136 KIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDS----FSI 191

Query: 219 VPFFINRENKPFDSSFYSDIFK-LGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQE 277
           V FFI+ + +PF+ +FY+D+ K L   E+   + +  +DGP+T+PI    +K ++L+K+E
Sbjct: 192 VTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQY-YDGPNTKPIEIKELKGKLLQKKE 250

Query: 278 IKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCI 337
             +  F+C+ I+NK+ +F +++KG+  ++QEK G R+K +Y+     ++AFS RK  N  
Sbjct: 251 GNKFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNAN 310

Query: 338 TAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNIT 397
             E     LTKVF  G LNIE +EE  +K+  ++ E   FL+L+GFRS++    YYNNI+
Sbjct: 311 DGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNIS 370

Query: 398 KPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNE 457
             S+V+PD++  +GS + L+ L+ +M KK K A++WGKL   +HP L+++ A +  + N+
Sbjct: 371 TSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQ 430

Query: 458 GFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGY 511
           GF+L R+PF++EIR+FP       K  ++N  EY  +K+ T NI+ +FNLK  Y
Sbjct: 431 GFYLVRLPFIEEIRRFPQTLQ---KNRSVNIQEYALMKKITGNIIAFFNLKSSY 481

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  210 bits (534), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 127/475 (26%), Positives = 240/475 (50%), Gaps = 27/475 (5%)

Query: 45  DVHEGIMFCVELSEQMFQQLPELNYKVXXXXXXXXXXXXXXXXVITRPGTGVGCYIYNCH 104
           D ++ I+ C+ELS+ +      L                    +I +P + VGC  +  +
Sbjct: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFR-N 83

Query: 105 KDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESLLELT 164
              + + I    PL  ++   ++ ++D + DL  E   + ++FP+  T    L+ +L  +
Sbjct: 84  GRRAEDGIVEAFPLRPLDANYVRNISDCVADL-EETGMVGQHFPFTATVPASLDVMLAAS 142

Query: 165 QDELVKNVSTPKPFNNKKVFLFTDNDSPTEASD----KAGKARLRRLFDDNNENFITFVP 220
                ++        + ++FL TD D+P E +D    +  +ARL  L+       I    
Sbjct: 143 DRYFTEDTQNA----DNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLY----RRRIDITT 194

Query: 221 FFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKR 280
           FF++ E+  F+ S Y++I K       + ++ I     ST P+S   ++ ++L ++++ R
Sbjct: 195 FFLHTEHAAFNDSSYAEILK-------TREWGIPGAPQSTSPLSICKLREKMLSQKDLNR 247

Query: 281 VLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAE 340
             F C L++NK  +  V++ GY   + E+ G+RYK + +H+   K     RK       +
Sbjct: 248 AYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEK 307

Query: 341 EVKEG-LTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKP 399
            +++   + V+  G   IE+++ +++K+     +   FL++LGFR++  +  YY+NI + 
Sbjct: 308 YIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRA 367

Query: 400 SFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGF 459
            +++P E    GS ++LASL R+M +K K A++WG+LK   HP L+ L  S+        
Sbjct: 368 YYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGE--TCAL 425

Query: 460 FLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514
            L RIPF++E+R FP   T   ++   +T EYE +K  ++N++ +F+L+  Y PS
Sbjct: 426 RLVRIPFIEEVRCFP---TLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPS 477

>TPHA0C00300 Chr3 complement(50015..51142) [1128 bp, 375 aa] {ON}
           Anc_5.633 YDR268W
          Length = 375

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 19/117 (16%)

Query: 140 RTTLTKYFPYDKTQRTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKA 199
           RT  T YFP   T  TP + +L L   E  K +S   P     +++   ND P + + K 
Sbjct: 210 RTYKTNYFPVPVTTLTPTKKILSLNNPE--KKMSKSDPNQQGVIYV---NDEPEQITVKI 264

Query: 200 GKARLRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFD 256
            KA    + D           F+ + EN+P  S+  + +  +   E P    EIE D
Sbjct: 265 NKALTDNISDR----------FYYDNENRPGVSNLINIVSGIQRKEIP----EIEKD 307

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,536,920
Number of extensions: 2775310
Number of successful extensions: 9050
Number of sequences better than 10.0: 65
Number of HSP's gapped: 9286
Number of HSP's successfully gapped: 66
Length of query: 514
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 400
Effective length of database: 40,409,475
Effective search space: 16163790000
Effective search space used: 16163790000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)