Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.587.125ON49149122350.0
Kwal_55.208327.125ON5754264352e-46
SAKL0F05390g7.125ON5954194281e-45
KLTH0F12540g7.125ON5954174238e-45
NCAS0E021307.125ON5264294209e-45
TDEL0H028707.125ON5874314211e-44
Skud_16.187.125ON5504404173e-44
YPL260W7.125ON5514414086e-43
Ecym_83527.125ON5794184052e-42
KLLA0D14355g7.125ON5884294035e-42
ZYRO0C05192g7.125ON5884184001e-41
NDAI0E036707.125ON5224193934e-41
Smik_6.4677.125ON5482503771e-38
Suva_16.447.125ON5492073752e-38
TPHA0C016107.125ON5512073726e-38
KAFR0L004607.125ON5114153697e-38
ADL019W7.125ON5252103592e-36
CAGL0H09108g7.125ON5322413541e-35
KNAG0L009407.125ON5492033425e-34
TBLA0A009307.125ON5862253392e-33
Kpol_322.77.125ON5342013346e-33
ZYRO0G10670g4.129ON127041751.5
NCAS0B019108.585ON32539713.8
TPHA0L018208.562ON174150706.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.58
         (491 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   865   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   172   2e-46
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   169   1e-45
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   167   8e-45
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   166   9e-45
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   166   1e-44
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   165   3e-44
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   161   6e-43
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   160   2e-42
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   159   5e-42
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   158   1e-41
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   155   4e-41
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   149   1e-38
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   149   2e-38
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   147   6e-38
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   146   7e-38
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   142   2e-36
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   140   1e-35
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   136   5e-34
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   135   2e-33
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   133   6e-33
ZYRO0G10670g Chr7 complement(857355..861167) [3813 bp, 1270 aa] ...    33   1.5  
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      32   3.8  
TPHA0L01820 Chr12 complement(377285..382510) [5226 bp, 1741 aa] ...    32   6.9  

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/491 (90%), Positives = 442/491 (90%)

Query: 1   MNIADKYNVILNKLKILSGTDDFELDSLDQLYYEFNNIFNLHPFNPNAEIIQDXXXXXXX 60
           MNIADKYNVILNKLKILSGTDDFELDSLDQLYYEFNNIFNLHPFNPNAEIIQD       
Sbjct: 1   MNIADKYNVILNKLKILSGTDDFELDSLDQLYYEFNNIFNLHPFNPNAEIIQDCLYLLSL 60

Query: 61  XXXXXXXXXKSISIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLL 120
                    KSISIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLL
Sbjct: 61  CYLNLGELEKSISIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLL 120

Query: 121 QECXXXXXXXXXXXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYI 180
           QEC                 IQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYI
Sbjct: 121 QECEENDNEDNEDNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYI 180

Query: 181 FQELDDCYKVHNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCFVLKDP 240
           FQELDDCYKVHNVIELKTDNIDVN                YIVFSRVKSVFPQCFVLKDP
Sbjct: 181 FQELDDCYKVHNVIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCFVLKDP 240

Query: 241 NHMSNSTFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVI 300
           NHMSNSTFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVI
Sbjct: 241 NHMSNSTFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVI 300

Query: 301 HDVKLLAIDKIDDEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRT 360
           HDVKLLAIDKIDDEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRT
Sbjct: 301 HDVKLLAIDKIDDEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRT 360

Query: 361 IRHYNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKI 420
           IRHYNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKI
Sbjct: 361 IRHYNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKI 420

Query: 421 AGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEID 480
           AGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEID
Sbjct: 421 AGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEID 480

Query: 481 FEGRTREIEKI 491
           FEGRTREIEKI
Sbjct: 481 FEGRTREIEKI 491

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  172 bits (435), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 138/426 (32%), Positives = 221/426 (51%), Gaps = 56/426 (13%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  L++SN+FT +DL P+K RLDEI +I+    S  +E          
Sbjct: 110 ATYASLSTVQRLLEHLDESNVFTHHDLRPIKERLDEISEIV-TQSSFFKE---------- 158

Query: 133 XXXXXXXXIQGVNEIGG--NSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKV 190
                          GG  N+G I   + S + +  K++  +D  L+     +L  C + 
Sbjct: 159 ---------------GGEINNGSIDFTKISDEKDRNKIE--EDLLLRA----KLKHCLQE 197

Query: 191 HNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCFVLKDPNHMSNSTFDK 250
           +  IE K + ID                   +  S  ++      +LKD +    S   +
Sbjct: 198 YAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKRNA-----MLKDGHKAPESPLSQ 252

Query: 251 KLNEIQRNLDVIKEKNTEYDEGQSQRNK-------NEGNI--NGQRILNGLVDYCQEVIH 301
           +   ++  L  ++ K T+    +SQRN        + G I   GQ +LNGL+D C ++I+
Sbjct: 253 E--SVKEKLHSLEAKLTQI---ESQRNASGYFVSADTGEIVERGQSVLNGLLDDCHDLIN 307

Query: 302 DVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRT 360
           D+   A + +  D K   +++  + +K  LE +LVT R +L+  DLF   K LS+++K  
Sbjct: 308 DLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVTRRWTLRETDLFAYQKRLSEIDKLR 367

Query: 361 IRHYNIEDSFQAK--SIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKL 418
           +      +S  AK  +I+++ LRRC+ IIYK+LE SEPV   L+ ++NQLST+ R LL+L
Sbjct: 368 VGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVRRCLLEL 427

Query: 419 KIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILE 478
           K  GGVE   +L P ++KL ++ + R++  F DE GNIP GQ  LNALL EC ++L  L+
Sbjct: 428 KRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFDILHELK 487

Query: 479 IDFEGR 484
           I+ E R
Sbjct: 488 IEAEYR 493

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  169 bits (428), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 132/419 (31%), Positives = 210/419 (50%), Gaps = 39/419 (9%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  LN+SN+FT +DL P+K RLDE+ +I+E +                
Sbjct: 111 ATYASLSTVQRLLEHLNESNVFTHHDLRPIKERLDEVSEIVEKN---------------- 154

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQE------LDD 186
                       NE   N G    P+   D ++ +L+K D    K  + ++      L  
Sbjct: 155 ---------SYRNEPENNKGKPQEPEAQEDEQDIELKKADIEKDKNKVEEDLLLRAKLKH 205

Query: 187 CYKVHNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFP-QCFVLKDPNHMSN 245
           C + +  IE K + ID                   +  S  ++    +    K   H  +
Sbjct: 206 CLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSLAASTKRNARSKESLEDKKRTHTVS 265

Query: 246 STF-DKKLNEIQRNLDVIKEKNTEYDEGQS-QRNKNEGNINGQRILNGLVDYCQEVIHDV 303
             F + KLNE+Q  L  ++       + +S + +K E    GQ +LNGL+D C ++I+D+
Sbjct: 266 PNFVNSKLNELQVELSELESHRDPSGKFKSLETDKVEE--RGQSVLNGLLDDCHDLINDL 323

Query: 304 KLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTIR 362
                  I  D K   +++  + +K  LE +LVT R +L+  DLF   K L +++   + 
Sbjct: 324 SHQTSRGISLDHKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFTYQKRLGEIDNLRVH 383

Query: 363 HYNIEDSFQAK--SIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKI 420
                +S  +K  SI+++ LRRC+ IIYK+LESSEPV   L+ ++NQLST+ R LL+LK 
Sbjct: 384 GKFPTESGDSKGQSILLYLLRRCYAIIYKLLESSEPVSEALQRIHNQLSTVRRCLLELKR 443

Query: 421 AGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEI 479
            GGV    +L P ++KL ++ + R++  F D  GNIP GQ  LNALL EC ++L  L+I
Sbjct: 444 MGGVNNDRELYPYQMKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHELKI 502

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  167 bits (423), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 129/417 (30%), Positives = 209/417 (50%), Gaps = 39/417 (9%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  L++SN+FT +DL P+K RLDEI +I+     L             
Sbjct: 110 ATYASLSTVQRLLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYL------------- 156

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192
                        EI     D    Q   D       K ++  L +   Q    C + + 
Sbjct: 157 ----------DGTEISDGRIDFAKIQDEKDR-----NKIEEDLLLRAKLQH---CLQEYE 198

Query: 193 VIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCFVLKDPNHMSNSTFDKKL 252
            IE K + ID                   +  S  ++   +  V    + +      ++L
Sbjct: 199 HIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQGVKTPDSLLPQEGIKQRL 258

Query: 253 NEIQRNLDVIKEKNTEYDEGQSQRNKNEGNI--NGQRILNGLVDYCQEVIHDVKLLAIDK 310
           +E++  L  I+   +  D      +   G I   GQ +LNGL+D C ++I+D+   A + 
Sbjct: 259 HELEAELTEIE---SHRDSSGKFVSLETGEIAGKGQNVLNGLLDDCHDLINDLSHHANNF 315

Query: 311 ID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEK-RTIRHYNIED 368
           +  D K   +++  + +K  LE +LVT R +L+  DLF+  K LS+++K R    +  E+
Sbjct: 316 VSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRLSEIDKLRVGGKFPTEN 375

Query: 369 S-FQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEKM 427
           +  + ++I+++ LRRC+ IIYK+LE SEPV   L+ ++NQLST+ R LL+LK  GGVE  
Sbjct: 376 ADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVEND 435

Query: 428 DDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEIDFEGR 484
            +L P ++KL ++ + R++  F DE GNIP GQ  LNALL EC ++L  L+I+ E R
Sbjct: 436 RELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECFDILHELKIEAEER 492

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  166 bits (420), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 127/429 (29%), Positives = 214/429 (49%), Gaps = 57/429 (13%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  L++SN+FT +DLSP+K RL+EI  I+E      + C         
Sbjct: 116 ATYASLSTVQSLLEHLSESNIFTHHDLSPIKDRLNEISKIVE------KSC--------- 160

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQEL------DD 186
                              G +P  Q + D E   L+  D    K  I Q+L        
Sbjct: 161 -------------------GKLPDEQLNDDEEQN-LKDIDTERNKNKIEQDLLLRAKLQH 200

Query: 187 CYKVHNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCFV----LKDPNH 242
           C   +  IE K + ID +                 +  S  K++          L++ + 
Sbjct: 201 CLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAASTKKNMNQGSLTSEKELENKHL 260

Query: 243 MSNSTFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHD 302
           +S    +KKL+ ++  +  ++    E  + +S    NE   NGQ +LNGL+D C ++I+D
Sbjct: 261 VSQEYVNKKLHALEAEVQALEANRDESGKFKSLET-NEVAENGQNVLNGLLDDCLDLIND 319

Query: 303 VKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTI 361
           +       ++ D     ++E  + +K  LE +++T R +L+  DLF   K+L +++   +
Sbjct: 320 LSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMITRRWTLRETDLFTYQKQLGEIDNMRV 379

Query: 362 ------RHYNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYL 415
                 +H + +  F    I+++ LRRC+ IIYK+LESSEPV   L+P++NQLST+ R L
Sbjct: 380 EGRFPTKHIDSKGQF----ILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQLSTVRRCL 435

Query: 416 LKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLK 475
           ++LK  GGV+   +L P ++KL ++ + R++  F D  GNIP GQ  LNALL  C +++ 
Sbjct: 436 MELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEGNIPEGQGTLNALLAACFDIMH 495

Query: 476 ILEIDFEGR 484
            L+++ E R
Sbjct: 496 ELKVEAEER 504

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  166 bits (421), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 133/431 (30%), Positives = 211/431 (48%), Gaps = 63/431 (14%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE-ADYSLLQECXXXXXXXX 131
           + Y+S+  ++ LL  LN+SN+FT +DL P++ RL EI  I+E + Y              
Sbjct: 120 ATYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYK------------- 166

Query: 132 XXXXXXXXXIQGVNEIGG-NSGDIPTPQTSYD---YENGKLQKCDDSNLKKYIFQELDDC 187
                        NE+ G N  DI       D   YE     K ++  L +   Q    C
Sbjct: 167 -------------NEVSGDNLEDIDEKLPEADRKFYEERNKNKIEEDLLLRAKLQH---C 210

Query: 188 YKVHNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCFVLKDPNHMSNST 247
              ++  E K + ID +                  +  ++  +      L   +  SN +
Sbjct: 211 LDEYHSTESKVEEIDPHLT---------------TIMEKLFEIRRGLLSLAASSKRSNPS 255

Query: 248 FDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNIN----------GQRILNGLVDYCQ 297
            +K     +   + +++  ++  E +S R++N G             GQ +LNGL+D C 
Sbjct: 256 LEKSPLSQEHVHEQVEKLESQLTELESHRDEN-GKFKSLETDKVEDKGQNVLNGLLDDCH 314

Query: 298 EVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKL 356
           ++I D+       I+ D K   ++E+ + +K  LE +LVT R +L+  DLF   K+LS++
Sbjct: 315 DLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRETDLFTFQKQLSEI 374

Query: 357 EKRTIRHYNIEDSFQAK--SIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARY 414
           +   +      DS  +K  SI+++ LRRC  IIYK+LESSEPV   L+P++NQLST+ R 
Sbjct: 375 DSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKLLESSEPVSESLQPIHNQLSTVRRC 434

Query: 415 LLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELL 474
           LL+LK  GGV    +L P ++KL ++ D R +  F D  GNIP GQ  LNALL EC +++
Sbjct: 435 LLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGTLNALLAECFDIV 494

Query: 475 KILEIDFEGRT 485
             L+I+ + R 
Sbjct: 495 HELKIEAQERA 505

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  165 bits (417), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 129/440 (29%), Positives = 215/440 (48%), Gaps = 65/440 (14%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  LN+SN+FT +DLSP+K RLDEI  I+E   S              
Sbjct: 114 ATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNS-------------- 159

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQEL------DD 186
                                  +P    D  + ++++ D+   +  I ++L        
Sbjct: 160 -----------------------SPMYEEDANDARIREIDNERKQNKIEEDLLLRAKLKH 196

Query: 187 CYKVHNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCF----VLKDPNH 242
           C   ++ +E K + ID +                 +V S  K++         +L++ N 
Sbjct: 197 CKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSSANINSLLQEHND 256

Query: 243 MS---NSTFDKK----LNEIQRNLDVIKEKNTEYDEGQSQRNK------NEGNINGQRIL 289
           +    N   D K       +   L V+K + +E +  +    K      +E    GQ +L
Sbjct: 257 LQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLETHEVTEKGQSVL 316

Query: 290 NGLVDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFN 348
           NGL+D C ++I D+       +  D      +E+ + +K  LE +++T R +L+  DLF+
Sbjct: 317 NGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLMITRRWTLRETDLFS 376

Query: 349 LHKELSKLEKRTIRH---YNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLY 405
             K+L++++ + I        +DS + +SI+++ LRRC+ IIYK+LESSEPV   L+P++
Sbjct: 377 YQKKLNEIDSKRINGKFPTKSQDS-KGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIH 435

Query: 406 NQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNA 465
           NQLST+ R LL+LK  GGV    +L P ++KL ++ + R N  F D  GNIP GQ  LNA
Sbjct: 436 NQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSDGNIPEGQGILNA 495

Query: 466 LLHECMELLKILEIDFEGRT 485
           LL EC +++  L+++ E R 
Sbjct: 496 LLAECFDIMHELKVEAEERA 515

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  161 bits (408), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 128/441 (29%), Positives = 220/441 (49%), Gaps = 65/441 (14%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  LN+SN+FT +DLSP+K RL+EI  I+E   S              
Sbjct: 115 ATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNS-------------- 160

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQEL------DD 186
                                  +P    D  + +L++ D+   K  I ++L        
Sbjct: 161 -----------------------SPAYDEDGNDDRLREIDNERKKNKIEEDLLLRAKLKH 197

Query: 187 CYKVHNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCF----VLKDPNH 242
           C   ++++E K + ID +                 +V S  K++         +L++ N 
Sbjct: 198 CKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSDINTNSLLQEQND 257

Query: 243 MSNS----TFDKKL---NEIQRNLDVIKEKNTEYDEGQSQRNK------NEGNINGQRIL 289
           +  +    T DK L     +   L V+K + +E +  +    K      ++    GQ +L
Sbjct: 258 LQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLESHQVAEKGQSVL 317

Query: 290 NGLVDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFN 348
           NGL+D C ++++D+       +  D     ++E+ + +K  LE +++T R +L+  DLF+
Sbjct: 318 NGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMITRRWTLRETDLFS 377

Query: 349 LHKELSKLEKRTIRH---YNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLY 405
             K+L++++ + I        +DS + +SI+++ LRRC+ IIYK+LESSEPV   L+P++
Sbjct: 378 YQKKLNEIDNKRINGKFPTKSQDS-KGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIH 436

Query: 406 NQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNA 465
           NQLST+ R LL+LK  GGV    +L P ++KL ++ + R    F D  GNIP GQ  LNA
Sbjct: 437 NQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDGNIPEGQGILNA 496

Query: 466 LLHECMELLKILEIDFEGRTR 486
           LL EC ++L  L+++ E + +
Sbjct: 497 LLAECFDILHELKVEAEEKAQ 517

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  160 bits (405), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 126/418 (30%), Positives = 213/418 (50%), Gaps = 37/418 (8%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL+ LN+SN++T  DL P+K RLDEI +I+E +                
Sbjct: 115 ATYASLSTVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKN---------------- 158

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192
                      +   GG+         + D E+ + +   + NL   +  +L+ C K +N
Sbjct: 159 -------SYWNIPTDGGDGNAF-----ADDLEDKRKENNIEENL--LLRAKLEYCLKGYN 204

Query: 193 VIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCFVLKDPNHM---SNSTFD 249
            IE K + I  +                 +  S  KS   Q    ++ + +   S+   +
Sbjct: 205 QIEAKLEAIPEDLQPFMERLFQIRRGLLSLAAS-AKSRVEQEEQDENDDELCILSHEKIN 263

Query: 250 KKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHDVKLLAID 309
           ++L  ++  L  ++    E  +  S  + N+    GQ +LNGL+D C ++I D+      
Sbjct: 264 ERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSA 323

Query: 310 KID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEK-RTIRHYNIE 367
            +D D     +++  + +K  LE +LVT R +L+  DLF   K+L++L+  R    +  E
Sbjct: 324 GLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSE 383

Query: 368 DS-FQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEK 426
            S  + ++I+++ LRRC+ IIYK+LESSEPV   L  ++NQLST+   LL+LK  GGV+ 
Sbjct: 384 SSDSKGQAILLYLLRRCYAIIYKLLESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDN 443

Query: 427 MDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEIDFEGR 484
             +L P ++KL ++ + R++  F D  GNIP GQ  LNALL EC ++L  ++I+ E R
Sbjct: 444 ERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVR 501

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  159 bits (403), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 126/429 (29%), Positives = 214/429 (49%), Gaps = 55/429 (12%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  LN+SN++T +DL P+K RL+E+  I+E +  +             
Sbjct: 112 ATYASLSTVQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYV------------- 158

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKK-----YIFQELDDC 187
                    Q VN    + G+              LQK ++ N  K      +  +L  C
Sbjct: 159 ----SNSDTQSVNADADDIGEFA------------LQKDEELNKNKIEEDLLLRAKLKHC 202

Query: 188 YKVHNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFS----RVKSVFPQCFVL------ 237
              +N IE K + I  +                 +  S      K + P   VL      
Sbjct: 203 IDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPHQKQLVPDPAVLSVESEA 262

Query: 238 -KDPNHMSNSTFDKKLNEIQRNLDVI---KEKNTEYDEGQSQRNKNEGNINGQRILNGLV 293
            +  N + +   D+KL ++Q  L+ +   ++ N ++   ++ + + +G    Q +LNGL+
Sbjct: 263 SEKKNVLPDQVIDEKLKQLQEQLEKLESHRDINGKFKSLETDKVEEKG----QNVLNGLL 318

Query: 294 DYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKE 352
           D C ++++D+       I  D K   ++++ + +K  LE +LVT R +L+  DLF   K+
Sbjct: 319 DDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVTRRWTLRETDLFTYQKK 378

Query: 353 LSKLEKRTIRHYNIEDSFQAK--SIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLST 410
           L +++   +      D   +K  SI+++ LRRC+ IIYK+LESSEPV   L+ ++NQLST
Sbjct: 379 LGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKLLESSEPVSESLQRVHNQLST 438

Query: 411 LARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHEC 470
           + R LL+LK  GGV+   +L P ++KL ++ + R++  F D  GNIP GQ  LNALL EC
Sbjct: 439 VRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDGNIPEGQGTLNALLAEC 498

Query: 471 MELLKILEI 479
            +++  L+I
Sbjct: 499 FDIIHELKI 507

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  158 bits (400), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 120/418 (28%), Positives = 208/418 (49%), Gaps = 27/418 (6%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + YSS+  ++ LL  LN+SN+FT +DL P+K RL EI  I+E      + C         
Sbjct: 121 AAYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVE------KSCEKNKEAAKE 174

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192
                            N+ D+     +   E  + +  +D  L+  +   LD+ Y    
Sbjct: 175 EEEYLK-----------NAPDLDEADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYST-- 221

Query: 193 VIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCF--VLKDPNHMSNSTFDK 250
             E K + +D +                 +  S  K+         L++ + ++  + + 
Sbjct: 222 --EAKVETVDPSLSNIMDKLFQIRRELLSLAASAKKTTSSASAEKELENKHVLAPESVNT 279

Query: 251 KLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHDVKLLAIDK 310
           ++  +Q+ L+ I+    E  + +S  ++      GQ +LNGL+  C +++ D+       
Sbjct: 280 RVELLQKELNEIESYRDETGKFKSPESEQSAE-KGQNVLNGLLSDCYDLLGDLSHQKNGG 338

Query: 311 ID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTIRHYNIEDS 369
           I+ D +   ++ K + +K  LE +L+T R +L+  DLF   KEL +++   +      DS
Sbjct: 339 IELDPRLQPIYAKLIDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDS 398

Query: 370 F--QAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEKM 427
              + ++I+++ LRRC+ IIYK+LESSEPV   L+PL+NQLST+ R LL L+  GG+   
Sbjct: 399 GDNKGQTILLYLLRRCYAIIYKLLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNS 458

Query: 428 DDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEIDFEGRT 485
            +L P ++KL ++   R++  F D  GNIP GQ  LNALL EC +++  ++I+ E +T
Sbjct: 459 RELYPYQMKLASLDGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKT 516

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 280 EGNI-NGQRILNGLVDYCQEVIHDVKLLAIDKIDDEKKA 317
           +GNI  GQ  LN L+  C ++IH++K+ A +K + E ++
Sbjct: 484 DGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQS 522

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  155 bits (393), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 125/419 (29%), Positives = 208/419 (49%), Gaps = 35/419 (8%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  LN+SN+FT +DL P+K RLD+I  I+E   S  QE          
Sbjct: 120 ATYASLSTVQSLLEHLNESNIFTHHDLGPIKERLDQISKIVEESCS--QEIKL------- 170

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192
                            N GD    Q   + E  + Q   + +L   +  +L  C   ++
Sbjct: 171 ----------------DNEGDDQFNQYLDETELEQNQNKIEQDL--LLRAKLQHCLDEYH 212

Query: 193 VIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCFVLKDPNHMSNSTFDKKL 252
            IE K + ID +                 +V S  K+       L + + +S    +KKL
Sbjct: 213 EIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAKKNSLLSQKELDEKHLISPEYLNKKL 272

Query: 253 NEIQRNLDVIKEKNTEYDEGQSQRNKNEGNI--NGQRILNGLVDYCQEVIHDVKLLAIDK 310
            E+++    ++    E+ + +S      G I  NGQ +L GL D C ++I+D+      +
Sbjct: 273 LELEKEFKDLESNRDEFGKFKSLET---GEIPENGQNVLKGLEDDCNDLINDLSHQTNGR 329

Query: 311 ID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTIRHYNIEDS 369
           +  D     ++E+ + +K  LE +++T R +L+  DLF   K+L +++   ++      S
Sbjct: 330 LTLDPDLQPVYEQLIEIKTTLEKLMITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKS 389

Query: 370 FQAKS--IIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEKM 427
             +K   II++ LRRC+ IIYK+LE SEPV   L+P++NQLST+ R LL +K  GGV   
Sbjct: 390 SDSKGQFIILYLLRRCYAIIYKLLECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNE 449

Query: 428 DDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEIDFEGRTR 486
            +L P ++KL ++ + R +  F D  GNIP GQ  LNALL  C +++  ++++ E   +
Sbjct: 450 RELYPYQMKLASLDNLRKDGIFYDSDGNIPEGQGTLNALLAACFDIVHEMKVEAEANNK 508

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  149 bits (377), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 150/250 (60%), Gaps = 15/250 (6%)

Query: 242 HMSNSTFDKKLNEIQRNLDVIKEKNTEYDEGQSQR-NKNEGNINGQRILNGLVDYCQEVI 300
           H   S    +LNE++ N D         D G+ +    ++  +NGQ +LNGL+D C ++I
Sbjct: 278 HEKLSVLKDELNELESNRD---------DSGKFKSLETHQVAVNGQSVLNGLLDDCHDLI 328

Query: 301 HDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKR 359
           +D+       +  D     ++E+ + +K  LE +++T R +L+  DLF+  K+L++++ +
Sbjct: 329 NDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNK 388

Query: 360 TIRH---YNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLL 416
            I        +DS + +SI+++ LRRC+ IIYK+LESSEPV   L+P++NQLST+ R LL
Sbjct: 389 RINGKFPTKSQDS-KGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLL 447

Query: 417 KLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKI 476
           +LK  GGV    +L P ++KL ++ + R +  F D  GNIP GQ  LNALL EC ++L  
Sbjct: 448 ELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDILHE 507

Query: 477 LEIDFEGRTR 486
           L+++ E R +
Sbjct: 508 LKVEAEERAQ 517

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114
           + Y+S+  ++ LL  LN+SN+FT +DLSP+K RLDEI  I+E
Sbjct: 115 ATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVE 156

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  149 bits (375), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 134/207 (64%), Gaps = 5/207 (2%)

Query: 284 NGQRILNGLVDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLK 342
           NGQ +LNGL+D C ++++D+       +  D     ++E+ + +K  LE +++T R +L+
Sbjct: 311 NGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITRRWTLR 370

Query: 343 SLDLFNLHKELSKLEKRTIRH---YNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPH 399
             DLF+  K+L++++ + ++       +DS + +SI+++ LRRC+ IIYK+LESSEPV  
Sbjct: 371 ETDLFSYQKKLNEIDSKRVKGKFPTKTQDS-KGQSILLYLLRRCYAIIYKLLESSEPVSE 429

Query: 400 CLRPLYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGG 459
            L+P++NQLST+ R LL+LK  GGV    +L P ++KL ++ + R +  F D  GNIP G
Sbjct: 430 ALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGNIPEG 489

Query: 460 QRALNALLHECMELLKILEIDFEGRTR 486
           Q  LNALL EC +++  L+++ E R +
Sbjct: 490 QGILNALLAECFDIMHELKVEAEERAQ 516

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 32/42 (76%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114
           + Y+S+  ++ LL  LN+SN+FT +DLSP+K RL+EI  I+E
Sbjct: 115 ATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVE 156

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  147 bits (372), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 86/207 (41%), Positives = 125/207 (60%), Gaps = 3/207 (1%)

Query: 279 NEGNINGQRILNGLVDYCQEVIHDVKLLAID-KIDDEKKANLFEKSLLLKIKLETILVTN 337
           NE  + GQ  L GLVD C ++I+D    + D +I D+    ++   + +K  L  +++T 
Sbjct: 295 NEVKLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITR 354

Query: 338 RHSLKSLDLFNLHKELSKLEKRTIRHYNIEDSFQAK--SIIIFFLRRCHCIIYKILESSE 395
           R +L+  DLF   K L +++ + +      +S   K  SI+++ LRRC+ IIYK+LESSE
Sbjct: 355 RWTLRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSE 414

Query: 396 PVPHCLRPLYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGN 455
           PV   L+P++NQLST  R LL LK  GGV    +L P +LKL ++ + RI+  F D SG 
Sbjct: 415 PVSESLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGE 474

Query: 456 IPGGQRALNALLHECMELLKILEIDFE 482
           IP GQ  LNALL EC ++L  LEI+ E
Sbjct: 475 IPEGQGTLNALLAECFDMLHELEIESE 501

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 31/42 (73%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114
           + Y+S+  ++ LL  L++SN+FT +DL P+K RLDEI  I++
Sbjct: 125 ATYTSLSTVQKLLEHLDESNIFTNHDLRPIKERLDEISKIVQ 166

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  146 bits (369), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 118/415 (28%), Positives = 200/415 (48%), Gaps = 55/415 (13%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECXXXXXXXXX 132
           + Y+S+  ++ LL  L +S ++T +DL P+K RLDEI  I++      Q C         
Sbjct: 115 ATYASLSTVQSLLEHLIESKIYTHHDLKPIKERLDEIAKIVD------QNC--------- 159

Query: 133 XXXXXXXXIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQ------ELDD 186
                               +     ++ D ++ ++ + D+   K  I Q      +L+ 
Sbjct: 160 ------------------ESNTYQDASTLDDDDNEVSRIDNERNKNKIEQNLLLQAKLNH 201

Query: 187 CYKVHNVIELKTDNIDVNXXXXXXXXXXXXXXXXYIVFSRVKSVFPQCFVLKDPNHMSNS 246
           C   +N IE + + +D +                     +++        +   N     
Sbjct: 202 CLHEYNYIESQLEEVDPSSNSLVEK------------LFQIRRNLVSLVEISKSNTGVQD 249

Query: 247 TFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHDVKLL 306
             DKKL  +Q  L+ I E N + D            I G  +LNGL D C ++I D+   
Sbjct: 250 QIDKKLKHLQLQLNEI-ENNRDPDGNFVSIESGNPIIKGSNVLNGLSDDCHDLISDLTHH 308

Query: 307 AIDKIDDEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTI--RHY 364
               +D + + N+++  + +K  LE ++VT R +L+  DLF+  K+L++++   +  +  
Sbjct: 309 TKTFLDPDLQ-NVYDNLIDVKGSLENLMVTRRWTLRETDLFSYLKKLNEIDNLRVDGKFP 367

Query: 365 NIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGV 424
               S + ++I+++ LRRC+ +IYK+LESSEPV   L+P++NQLST+ R LL LK  GGV
Sbjct: 368 TKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSEALQPIHNQLSTVRRCLLDLKRMGGV 427

Query: 425 EKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEI 479
               +L P ++KL ++ + R +  F D  GNIP GQ  LNALL  C ++L  L+I
Sbjct: 428 NNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEGQGILNALLAGCFDILHELKI 482

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  142 bits (359), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 129/210 (61%), Gaps = 3/210 (1%)

Query: 285 GQRILNGLVDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKS 343
           GQ  LNGL+D C+ +  D+       +  D +   ++E+ L +K  LE +LVT R +L+ 
Sbjct: 248 GQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLENLLVTRRWTLRE 307

Query: 344 LDLFNLHKELSKLEKRTI--RHYNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCL 401
            DLF   K L++L+   +  +  +   + + +++I++ LRRC+  IYK+LESSEPV   L
Sbjct: 308 TDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRRCYATIYKLLESSEPVSESL 367

Query: 402 RPLYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQR 461
           + ++NQLST+ R L +LK  GGV+   DL P ++KL ++ + R++  F D  GNIP GQ 
Sbjct: 368 QKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFYDADGNIPEGQG 427

Query: 462 ALNALLHECMELLKILEIDFEGRTREIEKI 491
            LNALL EC ++L  ++I+ E R  ++ ++
Sbjct: 428 TLNALLAECFDILHEMKIEAEVREEQLPQV 457

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 30/42 (71%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114
           + Y+S+  ++ LL  + ++N++T  DL P+K RLDEI +I+E
Sbjct: 69  ATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVE 110

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  140 bits (354), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 145/241 (60%), Gaps = 9/241 (3%)

Query: 242 HMSNSTFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIH 301
           ++SNS  +K   E+ + ++ ++++N ++      ++  +    GQ ILNGL+D C ++I+
Sbjct: 266 YLSNS-LEKYKKEVAK-MEAMRDENGQF----VSKSTGKAEQRGQNILNGLLDDCNDLIN 319

Query: 302 DVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRT 360
           D+       +  D     ++EK + +K  LE +++T R +L+  DLF   K+L++++   
Sbjct: 320 DLSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEIDNMR 379

Query: 361 IRHYNIEDSFQAK--SIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKL 418
           +       S  +K  SII++ LRRC+ IIYK+LESSEPV   L+P++NQLST+ R LL+L
Sbjct: 380 VHGKFPTKSPDSKGQSIILYLLRRCYAIIYKLLESSEPVSESLQPVHNQLSTVRRCLLEL 439

Query: 419 KIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILE 478
           K  GGV    +L P ++KL ++ + R +  F D  GNIP GQ  LNALL  C ++L  L+
Sbjct: 440 KRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDILHELK 499

Query: 479 I 479
           +
Sbjct: 500 V 500

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114
           + Y+S+  ++ LL  L +SN+FT +DL P+K RLDEI  I+E
Sbjct: 121 ATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVE 162

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  136 bits (342), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 126/203 (62%), Gaps = 7/203 (3%)

Query: 284 NGQRILNGLVDYCQEVIHDVKLL-----AIDKIDDEKKANLFEKSLLLKIKLETILVTNR 338
           NGQ +LNGL+D C +++ D+         +    D     ++E+ L +K  LE +++T R
Sbjct: 324 NGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLLEIKTTLENLMITRR 383

Query: 339 HSLKSLDLFNLHKELSKLEK-RTIRHYNIEDS-FQAKSIIIFFLRRCHCIIYKILESSEP 396
            +L+  DLF+  K+L++++  R    +  E +  + +SI+++ LRRC+ IIYK+LESSEP
Sbjct: 384 WTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRRCYAIIYKLLESSEP 443

Query: 397 VPHCLRPLYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNI 456
           V   L+P++NQLST+ R LL+LK  GGV    +L P ++KL ++ + R +  F D  GNI
Sbjct: 444 VSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRQDGIFYDSDGNI 503

Query: 457 PGGQRALNALLHECMELLKILEI 479
           P GQ  LNALL  C +++  L++
Sbjct: 504 PEGQGILNALLAGCFDIIHELKV 526

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 29/42 (69%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114
           + Y+S+  ++ LL  L ++ ++T +DL P+K RL+EI  I+E
Sbjct: 117 ATYASLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVE 158

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 135/225 (60%), Gaps = 12/225 (5%)

Query: 271 EGQSQRNKN------EGN---INGQRILNGLVDYCQEVIHDVKLLAIDKIDDEKKANLFE 321
           E +SQR++N      E N   + GQ I+N LVD C ++I+D+       I  +       
Sbjct: 287 EIESQRDENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIY 346

Query: 322 KSLL-LKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTI--RHYNIEDSFQAKSIIIF 378
           K+L+ +K  L  ++VT R +L+  DLF+  K+L++++   +  +  +     + +SII++
Sbjct: 347 KNLIDIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILY 406

Query: 379 FLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLN 438
            LRRC+ IIYK+LESSEP+   L+ ++ QLST+ R L+ LK  GGV  + +L P ++KL 
Sbjct: 407 LLRRCYAIIYKLLESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLA 466

Query: 439 NIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEIDFEG 483
           ++ + RI+  F D +G+IP GQ  LNA+L EC +++  L+ D E 
Sbjct: 467 SLDELRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELKCDAEA 511

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114
           + YSS+  ++ LL  LN+S +FT +DL P+K RLDEI +I+E
Sbjct: 120 ATYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVE 161

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  133 bits (334), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 121/201 (60%), Gaps = 5/201 (2%)

Query: 283 INGQRILNGLVDYCQEVIHDVKLLA--IDKIDDEKKANLFEKSLLLKIKLETILVTNRHS 340
           + GQ +L GLVD C ++I+D        D +D E +  ++++ + +K  L  +++T R +
Sbjct: 294 LKGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEP-IYDELINIKTNLANLMITRRWT 352

Query: 341 LKSLDLFNLHKELSKLEKRTI--RHYNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVP 398
           L+  DLF   K+L  ++ + +  +        + ++I+++ LRRC+ IIYK+LESS PV 
Sbjct: 353 LRDTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVS 412

Query: 399 HCLRPLYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPG 458
             L+ ++NQLST  R LL LK  GGV    +L P +LKL ++ + RI+  F D +G IP 
Sbjct: 413 ESLQSIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPE 472

Query: 459 GQRALNALLHECMELLKILEI 479
           GQ  LNALL EC +++  LEI
Sbjct: 473 GQGTLNALLAECFDIMHELEI 493

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114
           + YSS+  ++ LL  L++SN+FT +DL P+K RLDEI  I+E
Sbjct: 122 ATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVE 163

>ZYRO0G10670g Chr7 complement(857355..861167) [3813 bp, 1270 aa]
           {ON} similar to uniprot|P39702 Saccharomyces cerevisiae
           YAL002W VPS8 involved in vacuolar protein sorting
           required for localization and trafficking of the CPY
           sorting receptor Vps8p is a membrane-associated
           hydrophilic protein which contains a C-terminal
           cysteine-rich region that conforms to the H2 variant of
           the RING finger Zn2 binding motif.
          Length = 1270

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 452 ESGNIPGGQRALNALLHECMELLKILEI--DFEGRTREIEK 490
           ++GN PG  + + +LL E M L  +L +  DF  R +E+EK
Sbjct: 431 QTGNYPGALKFIKSLLQEYMPLWPLLRLTQDFSKREQELEK 471

>NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585
          Length = 325

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 148 GGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDD 186
           G NS  +PTP     YE G++  C DSN K+ ++   +D
Sbjct: 253 GSNSEKLPTPLVVSGYETGQIY-CWDSNTKELLYSSAND 290

>TPHA0L01820 Chr12 complement(377285..382510) [5226 bp, 1741 aa] {ON}
            Anc_8.562 YPL085W
          Length = 1741

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 5/50 (10%)

Query: 254  EIQRNLDVIKEKNTEYDEGQSQRNKNEG-----NINGQRILNGLVDYCQE 298
            EI  ++  I++KN +YDE   + NKN G     ++NG+RI +G   + ++
Sbjct: 1537 EIIPDVQGIEKKNADYDEFPDKNNKNGGDSDTNSLNGERIESGWFTWLKK 1586

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.139    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,511,944
Number of extensions: 2289558
Number of successful extensions: 9449
Number of sequences better than 10.0: 82
Number of HSP's gapped: 9744
Number of HSP's successfully gapped: 107
Length of query: 491
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 377
Effective length of database: 40,409,475
Effective search space: 15234372075
Effective search space used: 15234372075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)