Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.577.126ON21921910451e-146
Smik_9.1847.126ON2142146671e-88
YIL010W (DOT5)7.126ON2152166523e-86
SAKL0F05368g7.126ON2312256509e-86
Suva_9.1947.126ON2152176453e-85
Skud_9.1627.126ON2172146438e-85
KAFR0K012007.126ON2021536071e-79
KLLA0D14333g7.126ON2052185966e-78
KNAG0G010207.126ON2072185941e-77
CAGL0C03850g7.126ON2091515923e-77
NDAI0H013107.126ON2611765931e-76
TBLA0A009407.126ON2881525924e-76
TDEL0H028807.126ON3541485811e-73
ZYRO0C05214g7.126ON2701475644e-72
NCAS0F008107.126ON2312255571e-71
TPHA0C043307.126ON2092195472e-70
Ecym_83517.126ON2241565465e-70
ADL018W7.126ON2441565399e-69
Kwal_55.208397.126ON3051485135e-64
KLTH0F12562g7.126ON2931494771e-58
TDEL0C015907.388ON249181930.002
KLLA0E20285g7.388ON249142850.016
ZYRO0B03256g7.388ON254171820.037
KLTH0C06798g7.388ON249136770.14
SAKL0B04686gna 1ON223164760.20
Kpol_1004.598.300ON176111750.23
Ecym_46877.388ON252117760.24
NDAI0D03540na 2ON110742750.40
Kwal_27.108617.388ON249161730.47
KNAG0D008206.264ON284103730.52
Suva_2.537.388ON26180720.80
CAGL0A04433g7.388ON260108711.0
SAKL0F12320g7.388ON248117701.1
NDAI0E042007.388ON25480691.7
Smik_2.527.388ON26152682.0
Skud_2.407.388ON26152672.7
YBL064C (PRX1)7.388ON26194663.8
NCAS0E026307.388ON23148654.9
Kwal_23.44272.17ON66965665.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.57
         (219 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   407   e-146
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   261   1e-88
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   255   3e-86
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   254   9e-86
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   253   3e-85
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   252   8e-85
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   238   1e-79
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   234   6e-78
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   233   1e-77
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   232   3e-77
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   233   1e-76
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   232   4e-76
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   228   1e-73
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   221   4e-72
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   219   1e-71
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   215   2e-70
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   214   5e-70
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   212   9e-69
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   202   5e-64
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   188   1e-58
TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON...    40   0.002
KLLA0E20285g Chr5 (1803791..1804540) [750 bp, 249 aa] {ON} simil...    37   0.016
ZYRO0B03256g Chr2 (268100..268864) [765 bp, 254 aa] {ON} highly ...    36   0.037
KLTH0C06798g Chr3 complement(590991..591740) [750 bp, 249 aa] {O...    34   0.14 
SAKL0B04686g Chr2 complement(412707..413378) [672 bp, 223 aa] {O...    34   0.20 
Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON} (12783...    33   0.23 
Ecym_4687 Chr4 complement(1340392..1341150) [759 bp, 252 aa] {ON...    34   0.24 
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    33   0.40 
Kwal_27.10861 s27 complement(530889..531638) [750 bp, 249 aa] {O...    33   0.47 
KNAG0D00820 Chr4 (129739..130593) [855 bp, 284 aa] {ON} Anc_6.26...    33   0.52 
Suva_2.53 Chr2 complement(97422..98207) [786 bp, 261 aa] {ON} YB...    32   0.80 
CAGL0A04433g Chr1 (436143..436925) [783 bp, 260 aa] {ON} highly ...    32   1.0  
SAKL0F12320g Chr6 (963021..963767) [747 bp, 248 aa] {ON} highly ...    32   1.1  
NDAI0E04200 Chr5 complement(949094..949858) [765 bp, 254 aa] {ON...    31   1.7  
Smik_2.52 Chr2 complement(94285..95070) [786 bp, 261 aa] {ON} YB...    31   2.0  
Skud_2.40 Chr2 complement(84030..84815) [786 bp, 261 aa] {ON} YB...    30   2.7  
YBL064C Chr2 complement(100371..101156) [786 bp, 261 aa] {ON}  P...    30   3.8  
NCAS0E02630 Chr5 complement(526821..527516) [696 bp, 231 aa] {ON...    30   4.9  
Kwal_23.4427 s23 complement(716698..718707) [2010 bp, 669 aa] {O...    30   5.6  

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  407 bits (1045), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 202/219 (92%), Positives = 202/219 (92%)

Query: 1   MVAVRRSTRIANSKRKLEADEAERDVAXXXXXXXXXXXXXXXXXDVRVTKVDDKESKAEN 60
           MVAVRRSTRIANSKRKLEADEAERDVA                 DVRVTKVDDKESKAEN
Sbjct: 1   MVAVRRSTRIANSKRKLEADEAERDVASKSGEETTSSKKLKKEKDVRVTKVDDKESKAEN 60

Query: 61  KPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFR 120
           KPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFR
Sbjct: 61  KPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFR 120

Query: 121 DTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIR 180
           DTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIR
Sbjct: 121 DTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIR 180

Query: 181 SHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219
           SHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK
Sbjct: 181 SHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  261 bits (667), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 132/214 (61%), Positives = 162/214 (75%), Gaps = 6/214 (2%)

Query: 3   AVRRSTRIANSKRKLEADEAERDVAXXXXXXXXXXXXXXXXXDVRVTKVDDKESKAENKP 62
           A+RRSTRIA SKR LE +E++ D                   D++V KV + E + +N  
Sbjct: 4   ALRRSTRIAASKRSLEDEESKFD-----PISPPEVLKKRVKTDLKV-KVSETEDQGDNSA 57

Query: 63  SGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDT 122
           S   E++IGD IPDL L ++D   ISL+++A++N I+VFF YP+A TPGCTRQACGFRD 
Sbjct: 58  STSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDN 117

Query: 123 YDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSH 182
           YDDLKKH+AVFGLS+DS  SQK+FQ K +LPY LLSDPKREFIGLLGAKKTP SG IRSH
Sbjct: 118 YDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSH 177

Query: 183 FIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEE 216
           F+FVDGKLRFKR+KISPE+SVND KKE+LE+ E+
Sbjct: 178 FVFVDGKLRFKRVKISPEVSVNDAKKEILELAEK 211

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  255 bits (652), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 157/216 (72%), Gaps = 8/216 (3%)

Query: 3   AVRRSTRIANSKRKLEADEAE-RDVAXXXXXXXXXXXXXXXXXDVRVTKVDDKESKAENK 61
           A+RRSTRIA SKR LE +E++   ++                 +  V +         N+
Sbjct: 4   ALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQ-------EANR 56

Query: 62  PSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRD 121
            S + E+EIGD IPDL L N+D   ISL+++ ++N ++VFF YPRA TPGCTRQACGFRD
Sbjct: 57  SSDVNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRD 116

Query: 122 TYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRS 181
            Y +LKK+AAVFGLSADS  SQKKFQ K +LPY LLSDPKREFIGLLGAKKTP SG IRS
Sbjct: 117 NYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRS 176

Query: 182 HFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEF 217
           HFIFVDGKL+FKR+KISPE+SVND KKEVLE+ E+F
Sbjct: 177 HFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKF 212

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  254 bits (650), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 163/225 (72%), Gaps = 6/225 (2%)

Query: 1   MVAVRRSTRIANSKRKLEADEAERDVAXXXXXXXXXXXXXXXXXDVRVTKVDDKES-KAE 59
           MV +RRS R+A SK+  + ++   +                   D    +V DK + K+E
Sbjct: 1   MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE 60

Query: 60  NKPS-----GIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTR 114
           ++P+        E+E+GD+IPDL L+NQD   ISL++LAK N I+VFFAYP+A TPGCTR
Sbjct: 61  DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR 120

Query: 115 QACGFRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTP 174
           Q CG+RD Y+DLK+HAAVFGLSAD+T +QK FQ K SLPYDLLSDPKREFIGLLGAKKTP
Sbjct: 121 QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP 180

Query: 175 QSGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219
           QSG+IRSH++F +GKLRFKR+KISPE SV DGKKEVLE+ ++  K
Sbjct: 181 QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEK 225

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  253 bits (645), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 128/217 (58%), Positives = 157/217 (72%), Gaps = 6/217 (2%)

Query: 3   AVRRSTRIANSKRKLEADEAERDVAXXXXXXXXXXXXXXXXXDVRVTKVDDKESKAENKP 62
           A+RRS RIA SKR LE +E  + V                  D+     ++   + ++  
Sbjct: 4   ALRRSARIATSKRLLE-NEGSKLVPVSPPEPAKKKIKTVPKLDI-----EEPVKREDHSS 57

Query: 63  SGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDT 122
            G  E+++GD+IPDL L N+D   +SL+++AK+N I+VFF YP+A TPGCTRQACGFRD 
Sbjct: 58  LGANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDN 117

Query: 123 YDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSH 182
           Y+DLK+HAAVFGLSADS  SQKKFQ K  LPY LLSDPKREFIGLLGAKKTP SG IRSH
Sbjct: 118 YEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSH 177

Query: 183 FIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219
           F+FVDGKLRFKR+KISPE+SV D KKEV+E+ E+F K
Sbjct: 178 FVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEK 214

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  252 bits (643), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 132/214 (61%), Positives = 154/214 (71%), Gaps = 8/214 (3%)

Query: 3   AVRRSTRIANSKRKLEADEAER-DVAXXXXXXXXXXXXXXXXXDVRVTKVDDKESKAENK 61
           A+RRSTRIA SKR LE +E++   ++                    V   DD  S A   
Sbjct: 4   ALRRSTRIAASKRLLEDEESKLVPISPPEVPKKKVKTAPKVKTSEPVKSEDDSLSAA--- 60

Query: 62  PSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRD 121
                E+EIGD IPDL L ++D   ISL+++AK+N I+VFF YP+A TPGCTRQACGFRD
Sbjct: 61  ----TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRD 116

Query: 122 TYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRS 181
            Y+DLKKHAAVFGLSAD   SQKKFQ K +LPY L+SDPKREFIGLLGAKKTP SG IRS
Sbjct: 117 NYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRS 176

Query: 182 HFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVE 215
           HF+FV+GKLRFKRIKISPE+SV+D KKEVLEI E
Sbjct: 177 HFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAE 210

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  238 bits (607), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 135/153 (88%)

Query: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126
           E++IGD +PD+ L NQD  KISL+++AK+N ILV FAYP+A TPGCTRQACGFRD YD++
Sbjct: 50  ELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEI 109

Query: 127 KKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFV 186
           KKHAAVFGLSADS  SQK+FQ+K +LP++LLSDPKRE IG+LGAKKTPQSGIIRSH++F+
Sbjct: 110 KKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFL 169

Query: 187 DGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219
           DGKLRF+ IK+SPE S+++ KKEV+E+ E+ S+
Sbjct: 170 DGKLRFRNIKVSPERSISESKKEVMELAEKNSR 202

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  234 bits (596), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 154/218 (70%), Gaps = 14/218 (6%)

Query: 1   MVAVRRSTRIANSKRKLEADEAERDVAXXXXXXXXXXXXXXXXXDVRVTKVDDK-ESKAE 59
           MV +RRS RI+  K  L+++ AE                     + +VTK + K E K E
Sbjct: 1   MVELRRSNRISAKKEPLDSESAE-------------PIKVKAKTESKVTKPNGKKEVKNE 47

Query: 60  NKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGF 119
           +  + + E++IGD+IPDL L NQD   ISL+++A  N ++VFFAYP+A TPGCTRQACG+
Sbjct: 48  DSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGY 107

Query: 120 RDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGII 179
           RD Y +LK+HAAVFGLSAD+  SQK FQ K +LP+DLLSDPKREFIG LGAKKT  SG++
Sbjct: 108 RDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVV 167

Query: 180 RSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEF 217
           RSH+IF +GKL  KR+++SPE+S+ +GKKEVLE+ +  
Sbjct: 168 RSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  233 bits (594), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 119/218 (54%), Positives = 150/218 (68%), Gaps = 12/218 (5%)

Query: 1   MVAVRRSTRIANSKRKLEADEAERDVAXXXXXXXXXXXXXXXXXDVRVTKVDDKESKAEN 60
           MV +R+S R+AN K+     +                        V++       ++ E+
Sbjct: 1   MVELRKSARVANIKK-----QTTLTTPATSNKIVKKTSNAASHKKVKIV------AETED 49

Query: 61  KP-SGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGF 119
           KP    K +EIGDEIPDL L +Q+G  +SL ++A +N ILV FAYPRA TPGCTRQACGF
Sbjct: 50  KPLVDAKVLEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGF 109

Query: 120 RDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGII 179
           RD Y +LKKHAAV+GLSAD+  SQKKFQ K +LPY+LLSDPKREFIG+LGAKKT QSGII
Sbjct: 110 RDNYAELKKHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGII 169

Query: 180 RSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEF 217
           RS++IF +GKLR K+IK+SPE SV + K EVLE+V+E 
Sbjct: 170 RSYWIFFNGKLRIKKIKVSPEASVAESKAEVLELVKEL 207

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  232 bits (592), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 102/151 (67%), Positives = 128/151 (84%)

Query: 68  VEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDLK 127
           +E+GD+IPD+ L+NQDG  +SL+ LAK+N +++ F YP+A TPGCTRQACGFRD +DDLK
Sbjct: 58  LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLK 117

Query: 128 KHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFVD 187
           +H  V GLS D+  +Q KF++KYSLPYDLL DP REFIG+LGAKKTP SG IRSHF+F D
Sbjct: 118 EHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFAD 177

Query: 188 GKLRFKRIKISPEISVNDGKKEVLEIVEEFS 218
           GKL+FKR+KISPEISV DGKKEVLE+ +++S
Sbjct: 178 GKLKFKRLKISPEISVADGKKEVLELAKQYS 208

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  233 bits (593), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 112/176 (63%), Positives = 143/176 (81%), Gaps = 3/176 (1%)

Query: 45  DVRVTKVDDKE--SKAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFF 102
           +V+  K D+++   K+ N  S I E+EIGD+IPD+ L NQ+G +ISL+++AK N I+V F
Sbjct: 85  EVKKVKFDEQQVSDKSANNDS-IIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIF 143

Query: 103 AYPRAMTPGCTRQACGFRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKR 162
           A+PRA TPGCTRQACGFRD YD+LKK+A VFGLSAD+  SQKKF++K  LPYDLLSDPKR
Sbjct: 144 AFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKR 203

Query: 163 EFIGLLGAKKTPQSGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFS 218
           + IGLLGAKKTPQSG +RS++IFV+GKL  KRIK+SPEISV + KKEV+E  ++ S
Sbjct: 204 QLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKLS 259

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  232 bits (592), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 1/152 (0%)

Query: 62  PSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRD 121
           PS +KE+E+GDE+PD EL+NQ+   ISL+++ ++N I+V FAYP+A TPGCTRQACG RD
Sbjct: 122 PS-VKELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRD 180

Query: 122 TYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRS 181
            Y+DLKK+A VFG+SADS  +QK FQ+K +LPYDLLSD  RE IG LG KKTP SGIIRS
Sbjct: 181 NYNDLKKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRS 240

Query: 182 HFIFVDGKLRFKRIKISPEISVNDGKKEVLEI 213
           HFI V+GKL+FKR+KISPE+SV+D KKEVLEI
Sbjct: 241 HFIIVNGKLKFKRVKISPEVSVSDCKKEVLEI 272

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  228 bits (581), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 125/148 (84%)

Query: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126
           E++IGDEIPD+ L+NQDG  +SLR +AK++ I++ FAYP+A TPGCTRQACG+RD YD+L
Sbjct: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260

Query: 127 KKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFV 186
           K+HAAVFGLS D+  +QKKFQ K SLP+DLL DP R  IG LGAKKT QSG +RSH++F 
Sbjct: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320

Query: 187 DGKLRFKRIKISPEISVNDGKKEVLEIV 214
           DGKL++KR+K+SPE+S+ DGKKEVLE+ 
Sbjct: 321 DGKLKYKRVKVSPEVSIQDGKKEVLELA 348

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  221 bits (564), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 129/147 (87%)

Query: 71  GDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDLKKHA 130
           GD IPD+ L+NQDG +ISL++++ ++ I+V F YP+A TPGCTRQACGFRD Y+D+K+HA
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 131 AVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFVDGKL 190
           AVFGLSAD+ ++QKKFQ+K  LP+DLLSDP+R  +GLLGAKK+P+SGIIRSH++F DG L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 191 RFKRIKISPEISVNDGKKEVLEIVEEF 217
           + KR+KISPE+S+ +GKKEVLE+V++F
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQF 241

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  219 bits (557), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 154/225 (68%), Gaps = 15/225 (6%)

Query: 1   MVAVRRSTRIANSKRK---LEADEAERDVAXXXXXXXXXXXXXXXXXDVRVT-KVDDKE- 55
           MV +RRS RI+  K+     E D  E   A                 + ++  K+D KE 
Sbjct: 1   MVELRRSGRISTLKKTHFLTEEDSEEVKPAIKKQRVSKTKKIVIKKSNGKMKPKLDGKEE 60

Query: 56  ----------SKAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYP 105
                     +  +N  S  KE++IGD+IPD+ L +++GV +SL+++ ++N I+VFFA+P
Sbjct: 61  IVKSVKELDSTAVKNTDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFP 120

Query: 106 RAMTPGCTRQACGFRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFI 165
           +A TPGCTRQACGFRD Y +LK+HAAV+G+SAD   +QKKF+ K +LPY LLSD KR+FI
Sbjct: 121 KANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFI 180

Query: 166 GLLGAKKTPQSGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEV 210
           GLLGAKKTPQSG+IRS+FIFVDGKL+ KR+KISPE+SV + +KEV
Sbjct: 181 GLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEV 225

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  215 bits (547), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 150/219 (68%), Gaps = 12/219 (5%)

Query: 1   MVAVRRSTRIANSKRKLEADEAERDVAXXXXXXXXXXXXXXXXXDVRVTKV--DDKESKA 58
           M  VRRS+RIAN K   +AD     V                   + V+K+  D KE++ 
Sbjct: 1   MTEVRRSSRIANKKIIHQAD-----VKAEHSSKVSKKAKTTVKKTLSVSKIETDLKETQK 55

Query: 59  ENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACG 118
           ++     +E+++GDEIPDL LENQ+G ++SLR LA+ N I+  F YPRA TPGCTRQACG
Sbjct: 56  DD----YEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACG 111

Query: 119 FRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGI 178
           FRD +DDLKK++ + GLS DS  +QK F+ K +LPYDLL D +++ I +LG KK P SGI
Sbjct: 112 FRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGI 170

Query: 179 IRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEF 217
           IRS+FIFVDGKL+ KR+K+SPE+S+ + KKE+L++V+E 
Sbjct: 171 IRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  214 bits (546), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 129/156 (82%)

Query: 61  KPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFR 120
           K  G KE+E+GD +P++ L+NQD  +++L+ +AK N I++ FAYP+A TPGCTRQACGFR
Sbjct: 64  KVGGPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQACGFR 123

Query: 121 DTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIR 180
           D Y++L+KHA +FG+S+DS  SQK FQ K  LP+DLLSDP RE IG+LGAKKT Q+G+IR
Sbjct: 124 DNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAGVIR 183

Query: 181 SHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEE 216
           SH+IF +GKL++KR+K+SPE S+++G +EVL ++++
Sbjct: 184 SHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIKK 219

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  212 bits (539), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 96/156 (61%), Positives = 120/156 (76%), Gaps = 2/156 (1%)

Query: 56  SKAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQ 115
           ++A   P G  E+++GD +P++ L+NQD   + L  + K N I+V FAYP+A TPGCTRQ
Sbjct: 77  AEASTGPGG--ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQ 134

Query: 116 ACGFRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQ 175
           ACGFRD Y +L+KHA VFG+SADS  SQK FQ K  LP+DLLSDPKRE IG LGA+KT Q
Sbjct: 135 ACGFRDNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQ 194

Query: 176 SGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVL 211
           +G+IRSH++FVDGKL  KRIKISPE+S+ DG  EVL
Sbjct: 195 TGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVL 230

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  202 bits (513), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 120/148 (81%), Gaps = 1/148 (0%)

Query: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126
           E+E+GDE+PD+ L+NQD  ++SL+++A++N +++ F+YP+A TPGCT QACGFRD Y+DL
Sbjct: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105

Query: 127 KKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFV 186
           K+  AVFGLSAD+  +Q+KFQD +SLP+DLLSDPKRE IGLLGAKK+P SG  RSH++F 
Sbjct: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFA 164

Query: 187 DGKLRFKRIKISPEISVNDGKKEVLEIV 214
           +GKL  KRI +SPE+S+ D K E  E  
Sbjct: 165 NGKLINKRIAVSPEVSIRDAKTEAHEAA 192

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  188 bits (477), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 122/149 (81%), Gaps = 1/149 (0%)

Query: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126
           E+E GDE+PD+ L+NQ+G ++SL+ + + N ++V FAYP+A TPGCT+QACGFRD Y++L
Sbjct: 43  ELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEEL 102

Query: 127 KKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFV 186
           KK+AAVFGLS D+ ++Q+KF++K SLP+DLLSDP+R+ IG LGA K+P SG  RS+++FV
Sbjct: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161

Query: 187 DGKLRFKRIKISPEISVNDGKKEVLEIVE 215
            GKLR KRI +SPE SV++ KKE +E  +
Sbjct: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON}
           Anc_7.388 YBL064C
          Length = 249

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 80/181 (44%), Gaps = 28/181 (15%)

Query: 57  KAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQA 116
           K E++P     + I   +P+ + E   G KI+      D+   VFF++P   TP CT + 
Sbjct: 31  KQEDQP----RLRINTVVPNFDAETTKG-KINFHDYLGDS-WGVFFSHPADFTPVCTTEL 84

Query: 117 CGFRDTYDDL-KKHAAVFGLSADSTHSQKKF---------QDKYSLPYDLLSDPKREFIG 166
             F     +  K+   + GLSA+   S KK+          +K+  P  +++D  +E   
Sbjct: 85  GAFSKLKPEFDKRGVKLIGLSAEDVESHKKWIKDIEEVNGLNKFEFP--IIADVDKEIAF 142

Query: 167 LL------GAKKTPQSGI--IRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFS 218
           L       G K+  ++ +  IRS FI +D   +  RI  +   SV     EVL +++   
Sbjct: 143 LYDMVDEEGFKQLGKAPVATIRSVFI-IDPSKKL-RISFTYPPSVGRNTSEVLRVIDALQ 200

Query: 219 K 219
           K
Sbjct: 201 K 201

>KLLA0E20285g Chr5 (1803791..1804540) [750 bp, 249 aa] {ON} similar
           to uniprot|P34227 Saccharomyces cerevisiae YBL064C PRX1
           Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin
           peroxidase activity has a role in reduction of
           hydroperoxides induced during respiratory growth and
           under conditions of oxidative stress
          Length = 249

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 22/142 (15%)

Query: 96  NNILVFFAYPRAMTPGCTRQACGFRDTYDDL-KKHAAVFGLSADSTHSQKKF-------- 146
           N+  V F++P   TP CT +   F     +  +++  + GLSA+   S +K+        
Sbjct: 64  NSWAVLFSHPADFTPVCTTELGAFAKLKPEFDQRNVKLIGLSAEGIESHQKWIKDIEEVS 123

Query: 147 -QDKYSLPYDLLSDPKREFIGLLG-----AKKTPQSGI---IRSHFIFVDGKLRFKRIKI 197
             DK++ P  +++D  RE   L         K   +GI   IRS +I +D   + + I  
Sbjct: 124 QLDKFTFP--IIADVDREVSFLYDMVDEEGFKNLNNGIVATIRSVYI-IDPSKKIRLIIT 180

Query: 198 SPEISVNDGKKEVLEIVEEFSK 219
            P  SV     EVL +++   K
Sbjct: 181 YPA-SVGRNSSEVLRVIDALQK 201

>ZYRO0B03256g Chr2 (268100..268864) [765 bp, 254 aa] {ON} highly
           similar to gnl|GLV|KLLA0E20383g Kluyveromyces lactis
           KLLA0E20383g and similar to YBL064C uniprot|P34227
           Saccharomyces cerevisiae YBL064C PRX1 Mitochondrial
           peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase
           activity has a role in reduction of hydroperoxides
           induced during respiratory growth and under conditions
           of oxidative stress
          Length = 254

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 73/171 (42%), Gaps = 26/171 (15%)

Query: 68  VEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL- 126
           + IG  +P+ +     G KI+      D+   VFF++P   TP CT +   F     +  
Sbjct: 43  LRIGSTVPNFDANTTFG-KINFYDYLGDS-WGVFFSHPADFTPVCTTELGAFSKLKPEFD 100

Query: 127 KKHAAVFGLSADSTHSQKKF---------QDKYSLPYDLLSDPKRE--FI-------GLL 168
           K++  + GLS +   S  ++          +K+  P  +++D  +E  F+       G  
Sbjct: 101 KRNVKLVGLSVEGVPSHNEWIKDIEEISKLNKFGFP--VIADENKEVAFLYNMVDEEGFK 158

Query: 169 GAKKTPQSGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219
              K P S  IRS F+ +D   +  RI  +   SV     EVL +V+   K
Sbjct: 159 NLGKGPVS-TIRSVFV-IDPSKKL-RISFTYPPSVGRNSAEVLRVVDALQK 206

>KLTH0C06798g Chr3 complement(590991..591740) [750 bp, 249 aa] {ON}
           similar to uniprot|P34227 Saccharomyces cerevisiae
           YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx)
           with thioredoxin peroxidase activity has a role in
           reduction of hydroperoxides induced during respiratory
           growth and under conditions of oxidative stress
          Length = 249

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 56/136 (41%), Gaps = 18/136 (13%)

Query: 100 VFFAYPRAMTPGCTRQACGFRDTYDDL-KKHAAVFGLSADSTHSQKKF---------QDK 149
           V F++P   TP CT +   F     +  K++  + GLSA+     +K+          DK
Sbjct: 68  VLFSHPADFTPVCTTELGAFAQLKPEFEKRNVKLIGLSAEEVDKHQKWIKDIEEISSLDK 127

Query: 150 YSLPYDLLSDPKREFIGLL------GAKKTPQSGIIRSHFIFVDGKLRFKRIKISPEISV 203
           ++ P  ++ D  RE   L       G K   +  +     ++V    +  R+ I+   SV
Sbjct: 128 FAFP--IVGDADREVAFLYDMVDEEGFKNLSKGVVATIRSVYVIDPAKKVRLIITYPASV 185

Query: 204 NDGKKEVLEIVEEFSK 219
                EVL +++   K
Sbjct: 186 GRNSSEVLRVIDALQK 201

>SAKL0B04686g Chr2 complement(412707..413378) [672 bp, 223 aa] {ON}
           similar to uniprot|P34227 Saccharomyces cerevisiae
           YBL064c mitochondrial peroxiredoxin (1-Cys Prx) with
           thioredoxin peroxidase activity, has a role in reduction
           of hydroperoxides; induced during respiratory growth and
           under conditions of oxidative stress
          Length = 223

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 68/164 (41%), Gaps = 17/164 (10%)

Query: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126
           +V +G   P+ +     G  +   +   D+  L FF++P   TP CT +       + + 
Sbjct: 8   QVYLGSTAPNFQASTSQG-PLDFHKFVGDSWCL-FFSHPGDFTPICTTEIGALSQLFGEF 65

Query: 127 -KKHAAVFGLSADSTHSQKKF------QDKYSLPYDLLSDPKREF---IGLLGAKKTPQS 176
             ++  + GLS +S  S   +           + + ++ D  R+     G++  +   QS
Sbjct: 66  ANRNCKMLGLSTNSRESHLNWIKDIEQVTGCQVKFPIICDEDRKISTTFGMIDFRNMDQS 125

Query: 177 G---IIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEF 217
           G    IR  +I +D K   + +++ P IS      E+L  ++  
Sbjct: 126 GKPIPIRCVYI-IDPKKEIRLLQVYP-ISTGRNTAEILRCLDSL 167

>Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON}
           (127836..128366) [531 nt, 177 aa]
          Length = 176

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 10/111 (9%)

Query: 81  NQDGVK----ISLRQLAKDNNILVFFAYPRAMTPGCT-RQACGFRDTYDDLKKHA-AVFG 134
           NQD  K    I   Q  K+N  +V    P A +P C+     G+ +  D+L K A  +  
Sbjct: 29  NQDACKMPVTIDWTQFVKENKTIVITGAPAAFSPTCSISHIPGYLEKKDELLKKADQIIV 88

Query: 135 LSADSTHSQKKFQDKYSLP----YDLLSDPKREFIGLLGAKKTPQSGIIRS 181
           L+ D+  +Q+ +  +  +         SD    FI  LG +    +G+  S
Sbjct: 89  LTVDNPFAQQAWARQLGVTDTTKLKFASDAGAHFIKSLGLELDVGNGVFWS 139

>Ecym_4687 Chr4 complement(1340392..1341150) [759 bp, 252 aa] {ON}
           similar to Ashbya gossypii AGR368W
          Length = 252

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 52/117 (44%), Gaps = 18/117 (15%)

Query: 57  KAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQA 116
           K E++P     + +    P+   E  DG K++L +    N+  + F++P   TP CT + 
Sbjct: 33  KQEDQP----RLRVNSVAPNFTAETTDG-KLNLYEYF-GNSWGILFSHPADFTPVCTTEL 86

Query: 117 CGFRDTYDDL-KKHAAVFGLSADSTHSQKKF---------QDKYSLPYDLLSDPKRE 163
             F     +  K+   + GLSA+      K+          DK++ P  +++D  RE
Sbjct: 87  GAFAKLKPEFEKRDVKLIGLSAEGVEKHHKWVKDIEEVSELDKFTFP--IIADVDRE 141

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 174 PQSGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVE 215
           P+ G I++ F   DG L FKR   SPE S  +  KEV  I++
Sbjct: 154 PELGTIKAPFAAFDGNLPFKRGPSSPENSSKNDCKEVAPIIQ 195

>Kwal_27.10861 s27 complement(530889..531638) [750 bp, 249 aa] {ON}
           YBL064C - 1:1 [contig 33] FULL
          Length = 249

 Score = 32.7 bits (73), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 67/161 (41%), Gaps = 20/161 (12%)

Query: 75  PDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL-KKHAAVF 133
           P+   ++  G K++L +   D+   V F++P   TP CT +   F     +  +++  + 
Sbjct: 45  PNFTADSTQG-KLNLHEYLGDS-WGVLFSHPADFTPVCTTELGAFAKLKPEFDQRNVKLI 102

Query: 134 GLSADSTHSQKKF---------QDKYSLPYDLLSDPKREFIGLL------GAKKTPQSGI 178
           GLSA+     + +          DK+S P  ++ D +RE   L       G K      +
Sbjct: 103 GLSAEKVDKHQAWIKDIEEISSLDKFSFP--IIGDAEREVAFLYDMVDEEGFKNLNNGVV 160

Query: 179 IRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219
                ++V    +  R+ I+   SV     EVL +++   K
Sbjct: 161 ATIRSVYVIDPSKKVRLIITYPASVGRNSSEVLRVIDALQK 201

>KNAG0D00820 Chr4 (129739..130593) [855 bp, 284 aa] {ON} Anc_6.264
           YPL237W
          Length = 284

 Score = 32.7 bits (73), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 20/103 (19%)

Query: 122 TYDDLKKHAAVFGL----SADSTHSQKKFQDKYSLPY-DLLSDPKREFIGLLGAKKTPQS 176
           T DD +K  A  G+    S DST + +   D+  LPY DLLS   R F            
Sbjct: 94  TLDDFEKELARAGINEESSKDSTPTGEIGNDEVGLPYADLLS---RFF------------ 138

Query: 177 GIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219
            I+R++   + G     + +I P + + DGKK +   +++ S+
Sbjct: 139 SILRTNNPELAGDRSGPKFRIPPPVCLRDGKKTIFSNIQDISE 181

>Suva_2.53 Chr2 complement(97422..98207) [786 bp, 261 aa] {ON}
           YBL064C (REAL)
          Length = 261

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 68  VEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL- 126
           + I  E P+ + +   G KI+      D+   V F++P   TP CT +   F     +  
Sbjct: 49  LRINSEAPNFDADTTAG-KINFYDYLGDS-WGVLFSHPADFTPVCTTEVSAFAKLKPEFD 106

Query: 127 KKHAAVFGLSADSTHSQKKF 146
           K++  + GLS +   S +K+
Sbjct: 107 KRNVKLIGLSVEDVESHQKW 126

>CAGL0A04433g Chr1 (436143..436925) [783 bp, 260 aa] {ON} highly
           similar to uniprot|P34227 Saccharomyces cerevisiae
           YBL064c
          Length = 260

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 18/108 (16%)

Query: 68  VEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGF---RDTYD 124
           + I    P+ + +   G KI+L     D+   + F++P   TP CT +   F   +  +D
Sbjct: 48  LRINSSAPNFDADTSHG-KINLYDYLGDS-WGILFSHPADFTPVCTTEMGAFAKMKPQFD 105

Query: 125 DLKKHAAVFGLSADSTHSQKKF---------QDKYSLPYDLLSDPKRE 163
             K+   + GLS +   S +K+          DK+  P  +++D KR 
Sbjct: 106 --KRGVKLLGLSVEDAESHRKWIKDIEEINGIDKFGFP--IIADTKRH 149

>SAKL0F12320g Chr6 (963021..963767) [747 bp, 248 aa] {ON} highly
           similar to gnl|GLV|KLLA0E20383g Kluyveromyces lactis
           KLLA0E20383g and similar to YBL064C uniprot|P34227
           Saccharomyces cerevisiae YBL064C PRX1 Mitochondrial
           peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase
           activity has a role in reduction of hydroperoxides
           induced during respiratory growth and under conditions
           of oxidative stress
          Length = 248

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 18/117 (15%)

Query: 57  KAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQA 116
           K E +P     + I    P+       G KI   +   D+   V F++P   TP CT + 
Sbjct: 30  KQEEQP----RLRINSLAPNFTANTTQG-KIDFHEYIGDS-WTVLFSHPADFTPVCTTEL 83

Query: 117 CGFRDTYDDL-KKHAAVFGLSADSTHSQKKF---------QDKYSLPYDLLSDPKRE 163
             F     +  K++  + GLSA+     K++          DK++ P  ++ D +RE
Sbjct: 84  GAFAKLKPEFDKRNVKLIGLSAEGVEKHKEWVKDIEEVSQLDKFTFP--IIGDVERE 138

>NDAI0E04200 Chr5 complement(949094..949858) [765 bp, 254 aa] {ON}
           Anc_7.388
          Length = 254

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 68  VEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL- 126
           + I  + P+ ++++  G K++  +   D+   V F++P   TP CT +   F     +  
Sbjct: 28  LRINSQAPNFDVDSTIG-KLNFYEYLGDS-WGVLFSHPADFTPVCTTEMSAFAKLKPEFD 85

Query: 127 KKHAAVFGLSADSTHSQKKF 146
           K++  + GLS +   S  K+
Sbjct: 86  KRNVKLIGLSVEDVESHNKW 105

>Smik_2.52 Chr2 complement(94285..95070) [786 bp, 261 aa] {ON}
           YBL064C (REAL)
          Length = 261

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 96  NNILVFFAYPRAMTPGCTRQACGFRDTYDDL-KKHAAVFGLSADSTHSQKKF 146
           N+  V F++P   TP CT +   F     +  K++  + GLS +   S +K+
Sbjct: 75  NSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKW 126

>Skud_2.40 Chr2 complement(84030..84815) [786 bp, 261 aa] {ON}
           YBL064C (REAL)
          Length = 261

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 96  NNILVFFAYPRAMTPGCTRQACGFRDTYDDL-KKHAAVFGLSADSTHSQKKF 146
           N+  V F++P   TP CT +   F     +  K++  + GLS +   S +K+
Sbjct: 75  NSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKW 126

>YBL064C Chr2 complement(100371..101156) [786 bp, 261 aa] {ON}
           PRX1Mitochondrial peroxiredoxin (1-Cys Prx) with
           thioredoxin peroxidase activity, has a role in reduction
           of hydroperoxides; reactivation requires Trr2p and
           glutathione; induced during respiratory growth and
           oxidative stress; phosphorylated
          Length = 261

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 54  KESKAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCT 113
           K+ K  ++P     + I  + P+ + +   G KI+      D+   V F++P   TP CT
Sbjct: 39  KQFKQSDQP----RLRINSDAPNFDADTTVG-KINFYDYLGDS-WGVLFSHPADFTPVCT 92

Query: 114 RQACGFRDTYDDL-KKHAAVFGLSADSTHSQKKF 146
            +   F     +  K++  + GLS +   S +K+
Sbjct: 93  TEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKW 126

>NCAS0E02630 Chr5 complement(526821..527516) [696 bp, 231 aa] {ON}
           Anc_7.388
          Length = 231

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 100 VFFAYPRAMTPGCTRQACGFRDTYDDL-KKHAAVFGLSADSTHSQKKF 146
           + F++P   TP CT +   F     +  K++  + GLS +S  S  K+
Sbjct: 45  ILFSHPADFTPVCTTEMGAFAQLKPEFDKRNVKLVGLSLESVESHDKW 92

>Kwal_23.4427 s23 complement(716698..718707) [2010 bp, 669 aa] {ON}
           YNL224C - Hypothetical ORF [contig 1] PARTIAL
          Length = 669

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 45  DVRVTKVDDKESKAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNI--LVFF 102
           DVRV  VD+K  ++E +  G+ ++E   +IPD EL   D    S +Q  K  NI   V  
Sbjct: 108 DVRVLIVDEKRQESERRGEGVVQIE---DIPDEELFFVDEKPASRKQKVKTVNIDPPVRP 164

Query: 103 AYPRA 107
           ++PRA
Sbjct: 165 SHPRA 169

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,581,773
Number of extensions: 898949
Number of successful extensions: 2718
Number of sequences better than 10.0: 51
Number of HSP's gapped: 2755
Number of HSP's successfully gapped: 51
Length of query: 219
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 114
Effective length of database: 41,441,469
Effective search space: 4724327466
Effective search space used: 4724327466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)