Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.567.127ON45045023180.0
TPHA0C043207.127ON45445319590.0
TBLA0A009507.127ON46946619510.0
TDEL0H028907.127ON44245019390.0
ZYRO0C05236g7.127ON44745019120.0
SAKL0F05346g7.127ON44745418590.0
YPL259C (APM1)7.127ON47547318530.0
Smik_6.4667.127ON47647418510.0
KNAG0L009507.127ON46145918480.0
NCAS0E021407.127ON48145018470.0
Suva_16.457.127ON47847618400.0
NDAI0E036807.127ON44445118230.0
Skud_16.197.127ON47647418240.0
KLLA0D14311g7.127ON44345017970.0
Ecym_83507.127ON44545017870.0
KLTH0F12584g7.127ON44145017820.0
Kwal_55.208437.127ON44145017800.0
ADL017C7.127ON44345017760.0
KAFR0L004707.127ON46546917570.0
CAGL0K00539g7.127ON45645717410.0
Ecym_52393.165ON4644755599e-66
SAKL0C07414g3.165ON4824905111e-58
KLTH0F06534g3.165ON4664785092e-58
Kwal_33.141823.165ON4674805041e-57
KLLA0C03894g3.165ON4754815013e-57
SAKL0D13090g2.555ON4995254884e-55
NCAS0C035803.165ON4914984841e-54
TDEL0D045803.165ON4824944752e-53
CAGL0C05203g3.165ON4754894655e-52
NDAI0G029203.165ON4864944604e-51
Kwal_26.81462.555ON5055374605e-51
Kpol_1045.443.165ON4694814551e-50
YOL062C (APM4)3.165ON4915014562e-50
TBLA0F008403.165ON4814954524e-50
ABR047W2.555ON4984734517e-50
ZYRO0B04840g3.165ON4764974499e-50
ADR315W3.165ON4923904501e-49
KLTH0D07502g2.555ON5044874441e-48
Smik_15.963.165ON4915014342e-47
Skud_15.913.165ON4914984272e-46
Suva_15.1033.165ON4914984253e-46
TPHA0P006603.165ON4734864157e-45
KLLA0F25432g2.555ON5075394072e-43
Ecym_45912.555ON5015344002e-42
KNAG0K011503.165ON4744843772e-39
TPHA0I023902.555ON5593633539e-36
TDEL0B064302.555ON5253353467e-35
ZYRO0E05874g2.555ON5493433468e-35
Kpol_1056.132.555ON5413513414e-34
CAGL0K03223g2.555ON5983743301e-32
NCAS0A126502.555ON5883643302e-32
KAFR0A020602.555ON5403443263e-32
Skud_8.262.555ON5963683241e-31
Smik_8.232.555ON6033683241e-31
KNAG0C055502.555ON5823543203e-31
YHL019C (APM2)2.555ON6053723115e-30
Suva_8.332.555ON5963703072e-29
KAFR0C010203.165ON4284872933e-28
TBLA0B067602.555ON6572422337e-20
NDAI0B016102.555ON6722662222e-18
SAKL0A09218g2.522ON4732741685e-12
AGL061W2.522ON4114041641e-11
TDEL0A029702.522ON4963301571e-10
KLTH0D06556g2.522ON4563141543e-10
TPHA0C041302.522ON5331501526e-10
Kwal_26.79572.522ON4561371401e-08
KAFR0D035602.522ON4553181401e-08
ZYRO0B01738g2.522ON4921451365e-08
TBLA0I006202.522ON6091541366e-08
KLLA0E18789g2.522ON4973261321e-07
Kpol_1018.422.522ON5751511188e-06
NCAS0A048702.522ON4893341116e-05
Ecym_60073.575ON5371431106e-05
ZYRO0E09746g3.575ON5381361062e-04
Skud_2.4192.522ON4841391062e-04
KLLA0D11396g3.575ON5361431044e-04
Suva_4.5482.522ON4841391026e-04
AFR274C3.575ON5321431019e-04
TBLA0E001403.575ON5431351010.001
KLTH0G00528g3.575ON6331431010.001
CAGL0A04741g3.575ON5361971000.001
SAKL0F00594g3.575ON545143980.002
Smik_2.4302.522ON484136980.002
YBR288C (APM3)2.522ON483141980.002
NCAS0F040103.575ON547135970.003
Kwal_47.192923.575ON538143970.003
NDAI0K019302.522ON612160930.008
NDAI0B063203.575ON540114930.009
Smik_7.3713.575ON598114900.017
TDEL0D064303.575ON536135900.017
Ecym_72662.522ON517137890.022
Skud_6.1423.575ON546114890.027
YFR051C (RET2)3.575ON546114890.027
CAGL0L02145g2.522ON543154880.032
Suva_12.63.575ON546114870.046
TPHA0G037003.575ON539133850.071
Kpol_380.133.575ON535133850.074
Kpol_507.73.575ON533132800.31
KNAG0A069702.522ON50545780.51
KAFR0J001303.575ON543102770.67
AFR124W1.388ON15691692.9
KLTH0H11770g1.388ON15695684.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.56
         (450 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   897   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   759   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   756   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   751   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   741   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   720   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   718   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   717   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   716   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   716   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   713   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   706   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   707   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   696   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   692   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   691   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   690   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   688   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   681   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   675   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   219   9e-66
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   201   1e-58
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   200   2e-58
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   198   1e-57
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   197   3e-57
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   192   4e-55
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   191   1e-54
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   187   2e-53
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   183   5e-52
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   181   4e-51
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   181   5e-51
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   179   1e-50
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   180   2e-50
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   178   4e-50
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   178   7e-50
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   177   9e-50
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   177   1e-49
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   175   1e-48
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   171   2e-47
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   169   2e-46
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   168   3e-46
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   164   7e-45
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   161   2e-43
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   158   2e-42
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   149   2e-39
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   140   9e-36
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   137   7e-35
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   137   8e-35
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   135   4e-34
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   131   1e-32
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   131   2e-32
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   130   3e-32
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   129   1e-31
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   129   1e-31
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   127   3e-31
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   124   5e-30
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   122   2e-29
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   117   3e-28
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    94   7e-20
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    90   2e-18
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    69   5e-12
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    68   1e-11
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    65   1e-10
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    64   3e-10
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    63   6e-10
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    59   1e-08
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    59   1e-08
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    57   5e-08
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    57   6e-08
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    55   1e-07
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    50   8e-06
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    47   6e-05
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    47   6e-05
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    45   2e-04
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    45   2e-04
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    45   4e-04
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    44   6e-04
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    44   9e-04
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    44   0.001
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    44   0.001
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    43   0.001
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    42   0.002
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    42   0.002
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    42   0.002
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    42   0.003
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    42   0.003
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    40   0.008
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    40   0.009
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    39   0.017
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    39   0.017
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    39   0.022
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    39   0.027
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    39   0.027
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.032
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     38   0.046
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    37   0.071
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    37   0.074
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    35   0.31 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    35   0.51 
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    34   0.67 
AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic hom...    31   2.9  
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    31   4.0  

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/450 (97%), Positives = 439/450 (97%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKLI           PPVALTNSVSWRQEGIKYKKNEAYL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
           VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK
Sbjct: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW
Sbjct: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR
Sbjct: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLKINEPKLQYKSFPWVRYITQSGDDYTIR
Sbjct: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/453 (81%), Positives = 404/453 (89%), Gaps = 5/453 (1%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           MVSG+YFCD +GKPIL+RRYRDDI ++AID FSQ+LL+ EEE+ V+PPC++++GIHYLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           +HSDIYVVALTTSYQTN+AQIFMFLHQLV VL +Y+K V EES+RDNFVIIYELLDEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXX--XXXXPPVALTNSVSWRQEGIKYKKNEA 178
           +GIPQITETKMLK+YITQKSFKLI             PP  LTNSVSWR EGI YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 YLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLE-NEEDF 237
           +LDIIESINML+ QQGQVLRSEI+G V+V+SRLSGMPDLKLGIND+GIFS YLE N  D 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 238 SKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTT 297
           S     I +      KK  IELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LMNYRLTT
Sbjct: 241 SSSSTPIPEG--VEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTT 298

Query: 298 PIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGS 357
           PIKPLIWCD+NIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTP F+YSHGS
Sbjct: 299 PIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGS 358

Query: 358 IKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGI 417
           IKWLPEKNAILWKLRSFAGGKEYSM+AQL LPSVDG+EPPKV+RPVQ+KFQIPYFTTSGI
Sbjct: 359 IKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGI 418

Query: 418 QVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           QVRYLK+NEPKLQYKS+PWVRYITQSG+DYTIR
Sbjct: 419 QVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/466 (77%), Positives = 399/466 (85%), Gaps = 16/466 (3%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           MVS + FCD+ GK +LSR+YRDDIPL+AID F+ +L++ EEESSVVPPCL + GIHYLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VALTTS  TN +Q+F FLH+LV V+ +YLK VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKL+           PP ALTNSVSWR EGIKYKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLE-------- 232
           DI+ESINMLM QQGQVLRSEIIGEVKV+SRLSGMPDLKLGINDKGIFSKYLE        
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 233 --------NEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 284
                   N    S P      D  ++ K SN+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 285 DGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPD 344
           DG FELM+YRLTTPIKPLIWCD+NI VHSKSR+EIHCRAKAQIKKKSIANNVEILIPVPD
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 345 DADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQ 404
           DADTP+F+YSHGSIKW+PEKNAILWK+RSFAGGKEYSM AQLGLPS+D  E PK+KRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 405 IKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           IKFQIPYFTTSGIQVRYLK+NEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/450 (78%), Positives = 395/450 (87%), Gaps = 10/450 (2%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           MVSG+YFCD  G+PILSRRYRDDIPLSAID+F+ +L + EEESSV+PPCL ++GI YLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           +H D+YVVAL+TS  TN AQ+F FLH+LV  LGDYLK+VEEES+RDNFVIIYELLDEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKLI           PP  LTNSVSWR +GI YKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DI+ESINM+MNQQGQVLRSEIIG+V V+SRLSGMPDLKLGINDKGIF++  E  E     
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRDPETGES---- 236

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
                   T   KKS+ ELEDLKFHQCVRLSKFENEKIITFIPPDGEFELM+YRLTTP+K
Sbjct: 237 ------QVTAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVK 290

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD+N+QVHSKSRIEIHCRAKAQIKKKS+ANNVEILIPVPDDADTP+F+YSHGSIKW
Sbjct: 291 PLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKW 350

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           +PEKNAILWK+RSF GGKEYSM AQ+GLPS++G+E PK KRPVQ+KFQIPYFTTSGIQVR
Sbjct: 351 VPEKNAILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQVR 410

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLKINEPKLQYKS+PWVRYITQ+GDDYTIR
Sbjct: 411 YLKINEPKLQYKSYPWVRYITQNGDDYTIR 440

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/450 (77%), Positives = 397/450 (88%), Gaps = 6/450 (1%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           MVS VYFCD  G+PILSRRYRDDIP+SAIDKF+ +LL+ EEESSV+PPCL + GI YLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+YVVAL TS  TN+AQ+F FLH+L+ VL +YLKSVEEES+RDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKL+           PP  +TNSVSWR   I +KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DI+ESINMLMNQQGQVLRSEIIG++KVKS+LSGMPDLKLGINDKGIFSKY+E + D   P
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---P 237

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
           V       T   KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDG FELMNYRL+ P+K
Sbjct: 238 V---TTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVK 294

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD+N+QVHS+SRIEIHCRA+AQIKK+SIAN+VEILIPVPDDADTP+FKY+HGS+KW
Sbjct: 295 PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKW 354

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           +P+KNAILWK+RSF GGKEYSM+AQ+GLPS++ ++ PKVKRPVQIKFQIPYFTTSGIQVR
Sbjct: 355 VPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVR 414

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLKI EPKL YKS+PWVRYITQSGDDYTI+
Sbjct: 415 YLKITEPKLLYKSYPWVRYITQSGDDYTIK 444

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/454 (75%), Positives = 390/454 (85%), Gaps = 13/454 (2%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S +YFCD+ GK ILSRRY+DDIP +AIDKF  +L+E E+ESSV+PPCL + GI YLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+YV+ +T S  TN+AQ+F FL+++V VL +Y+K VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKL+           PP+ALTNSVSWR EGI YKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYL----ENEED 236
           D++ESINML+ QQGQVLRSEI+G+VKVKS LSGMPDLKLG+NDKGIFS ++    E+E D
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 237 FSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLT 296
                    D S T  KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDG+FELM+YRLT
Sbjct: 241 ---------DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLT 291

Query: 297 TPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHG 356
           TPIKPLIWCDI IQVHSKSRIE+HCRAKAQIKKKS ANNVEILIPVP+DAD+P F+YSHG
Sbjct: 292 TPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG 351

Query: 357 SIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSG 416
           SIKW PEKNAILWK++SF GGKEYSM AQLGLPSV   E P +KRPVQ+KFQIPYFTTSG
Sbjct: 352 SIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSG 411

Query: 417 IQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           IQVRYLKINEPK+QY+S+PWVRYITQSGDDYTIR
Sbjct: 412 IQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIR 445

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/473 (73%), Positives = 395/473 (83%), Gaps = 23/473 (4%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S VYFCD +GKP+LSRRYRDDIPLSAIDKF  +L + EE+S+++PPCL + G+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+YVVA+ TS   N A IF FLH+LV VL DYLK+VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKL+           PPVALTNSVSWR EGI +KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DI+ESINMLM Q+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL+++ +    
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 241 VQIINDDST-------------TNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGE 287
               +D++T             TN KK NIELEDLKFHQCVRLSKFENEKIITFIPPDG+
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 288 FELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDAD 347
           F+LMNYRL+T IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KS A NVEILIPVPDDAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 348 TPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEP-----PK---- 398
           TPTFKYSHGS+K++PEK+AILWK+RSF GGKEYSM+A+LGLPS+   E      PK    
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 399 -VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
            +K PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/474 (73%), Positives = 395/474 (83%), Gaps = 24/474 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S VYFCD +GKP+LSRRYRDD+PLSAIDKFS +L + EE+S+++PPCL + G+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VA+ TS   N A IF FLH+LV VL DYLK+VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKL+           PPVALTNSVSWR EGI +KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DI+ESINMLM Q+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL+N+ +    
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 241 VQIINDDSTTNG--------------KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 286
           V     D+ T+               +K NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 287 EFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDA 346
           +F+LMNYRL+T IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KS A NVEILIPVPDDA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 347 DTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSV----DGIEP-PK--- 398
           DTPTFKYSHGS+K++PEK+AILWKLRSF GGKEYSM+A+LGLPS+    DG    PK   
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 399 --VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
             +K PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/459 (74%), Positives = 395/459 (86%), Gaps = 9/459 (1%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S VYFCD  GKP+LSRRY+DD+PLSAIDKFS +L + E+ES+V+PPC+ + GI YLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+YVVAL TS   NIA++F FLH+L+ VLG+YLK+VEEESIRDNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITE +MLK+YITQKSFKL            PP  L NSVSWR EGIKYKKNEA+L
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLE------NE 234
           DI+ESINML+ Q+GQVLRSEIIG VK+KSRLSGMPDLKLGIND+GIF+KYLE      N 
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 235 EDFSKPVQIINDDSTTNG---KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELM 291
            D  +    + + S TN    +K+NIELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 292 NYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTF 351
           NYRLTT IKPLIWCD++IQVHSKSRIEI CRAKAQIKKKS+A NV+ILIPVPDDADTP+F
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 352 KYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPY 411
           KYSHGSIK++PE++AILWK++SF GGKEY+M A++GLPS+D  E PKVKRPVQ+KF+IPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 412 FTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           FTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 459

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/450 (75%), Positives = 391/450 (86%), Gaps = 2/450 (0%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S VYFCD+ G P+L+RRYRDDIP+SAI+KF  +L + EEE+++VPPCL Y G+ YLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VA+  S   N AQIF FL++LV VLG+YLK+VEEESIRDNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKL+           PP ALTNSVSWR   IKYKKNEA+L
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DIIESINMLM Q+GQ+LRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSK+++++   ++ 
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
             + +  STT+ KK+NIELEDLKFHQCVRLSKFE EKIITFIPPDG+FELMNYRL+T IK
Sbjct: 272 ASVAS--STTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK 329

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD+NIQVHS+SRIEIHCRAKAQIKKKS A NV+I+IPVP+DADTP FKYSHGSIK+
Sbjct: 330 PLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKY 389

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           +PEKN I+WK+RSF GGKEYSM+AQ+ LPS+  IE  K KRPVQIKFQIPYFTTSGIQV+
Sbjct: 390 VPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVK 449

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 450 YLKINEPKLQYKSYPWVRYITQSGDDYTIR 479

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/476 (72%), Positives = 392/476 (82%), Gaps = 26/476 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S VYFCD  GKP+LSRRYRDDIPLSAIDKF  +L + EE+S+++PPCL + G+ YLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VA+ TS   N A IF FLH+LV VL DYLK+VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKL+           PPVALTNSVSWR EGI +KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DI+ESINMLM Q+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL++  +    
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 241 VQIINDD----------------STTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 284
                 D                ST + +K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 285 DGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPD 344
           DG+F+LMNYRL+T IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 345 DADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSV----DGIEP-PK- 398
           DADTPTFKYSHGS+K++PEK+AILWKLRSF GGKEYSM+A+LGLPS+    DG +  PK 
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 399 ----VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
               +K PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/451 (74%), Positives = 387/451 (85%), Gaps = 10/451 (2%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S +YFCD  G+P+LSR+YRDDIPL+AIDKF+ +L + EEESSV+PPCL Y    YLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QHSDIY+VA+T   +TNIA++F FL++++ VLGDYLK+VEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKSFKL+           PP ALT+SVSWR EGIKYKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DI+ESINMLM Q+GQ+LRSEI+G VK+KSRLSGMPDLKLGINDKGIFSK L  E+D    
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQL-TEDD---- 235

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
                +++ T+ K++ IELEDLKFHQCVRLSKFE EKIITFIPPDG+FELMNYRL+T IK
Sbjct: 236 ----TNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK 291

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD+N+QVHS SRIEIHCRAKAQIKKKS A NVEILIPVP+DADTP FKYSHGSIKW
Sbjct: 292 PLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKW 351

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDG-IEPPKVKRPVQIKFQIPYFTTSGIQV 419
           +PEK+AILWK+RSF GGKEYSM A+L LPS     E  + K+PVQ+KFQIPYFTTSGIQV
Sbjct: 352 VPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQV 411

Query: 420 RYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           RYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 412 RYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/474 (72%), Positives = 395/474 (83%), Gaps = 24/474 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S VYFCD +GKP+LSRRYRDDIPLSAIDKF  +L + EE+S+++PPCL + G+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VA+ TS + N A IF FLH+LV VL DYLK+VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQI ETKMLKQYITQKSFKL+           PPVALTNSVSWR EGI +KKNEA+L
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DI+ESINMLM Q+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL+++ +   P
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 241 VQIINDDSTTNG--------------KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 286
                 D+ T+               +K NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 287 EFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDA 346
           +F+LMNYRL+T IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KS A NVEI+IPVPDDA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 347 DTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSV-DGIEP----PK--- 398
           DTPTFKYSHGS+K++PEK+AILWKLRSF GGKEYSM+A+LGLPS+ + IE     PK   
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 399 --VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
             +K PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/450 (72%), Positives = 380/450 (84%), Gaps = 8/450 (1%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S V FCD+ GKP+LSRRY+DD+  SA++ F  +LLE E+ESSV+PPC  + GIHY+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           Q++D+YV+ALT S   N   +F F+++L++V+ +Y+K VEEESIRDN++IIYELLDEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
            G+PQ+TETKMLKQYITQKSFKL            PP  LTNSVSWR EGIKYKKNEA+L
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           D+IESINMLM QQGQVLRSEI+G VKV+SRLSGMPDLKLG+NDKGIF+    ++ED  +P
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT--TNDQEDSPEP 238

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
           V       ++  K SNIELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LM YRL+TPIK
Sbjct: 239 V------VSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIK 292

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD+ +QVHS SRIEIHCRAKAQIKKKS+ANNVEILIP+P+DAD+PTFKYS G+IKW
Sbjct: 293 PLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKW 352

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           +PEKNAILWK  SF GGKEYSM AQLGLPSV   EPPK+KRPVQIKFQIPYFTTSGIQVR
Sbjct: 353 VPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVR 412

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLKI EPKLQY S+PWVRYITQSGDDYTIR
Sbjct: 413 YLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/450 (72%), Positives = 384/450 (85%), Gaps = 6/450 (1%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M SG+YFCDA GK +LSRRY+DDIP+SAI++F  +L+E E+ES+V+PPC  + G+ YLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y++ LT S   N+AQ+F FLH LV VL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
            GIPQIT+TKML+QYITQKSFKLI           PP +LT +VSWR EGIKYKKNEA+L
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           D+IESINM+M QQGQVLRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF++  E EED  +P
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEED--EP 238

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
               +   +   KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDG+FELM+YRL+TPIK
Sbjct: 239 ----SSQPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIK 294

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD  IQVHS+SR+E+HCRAKAQIK KS ANNVEILIPVP+DAD+P F+YSHGSIKW
Sbjct: 295 PLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKW 354

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           +PEKNAILWK++SF GGK+YSM A++GLPSV+ I     KRPVQIKFQIPYFTTSGIQVR
Sbjct: 355 VPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVR 414

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLKINEPKLQY S+PWVRYITQSG+DY IR
Sbjct: 415 YLKINEPKLQYNSYPWVRYITQSGEDYIIR 444

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/450 (72%), Positives = 378/450 (84%), Gaps = 11/450 (2%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S +YFCD  GK ILSRRYRDD+P SAI+KF  +LLE E+ESS+VPPCL + G+ YLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+DIYV+ ++ S   N+AQ+F FL++LV VL +Y+K+VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKS+KLI           PP  LT SVSWR EGI YKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           D+ ESINML+   GQVLRSEI+G+V V+SRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTS----------- 229

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
           V+  +    T GKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDG+FELMNYRL+TPIK
Sbjct: 230 VESASSSEATEGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIK 289

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD  IQVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P F+YSHGS+K+
Sbjct: 290 PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKY 349

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           +PEK+AILWK+++F GGKEYS  AQLGLPS+   E P+ KRP+Q+KFQIPYFTTSGIQVR
Sbjct: 350 VPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQVR 409

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLKINEPKLQY+S+PWVRYITQSGDDYTIR
Sbjct: 410 YLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/450 (72%), Positives = 383/450 (85%), Gaps = 11/450 (2%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S +YFCD +GK ILSRRYRDD+P SAI++F  +LLE E+ESSVVPPCL + G+ Y+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+DIYV+ ++ S   N+AQ+F FL++LV VL +YLK+VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITETKMLKQYITQKS+KLI           PP  LT SVSWR EGI YKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           D+ ESINML+   GQVLRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF+    +EE     
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFT----SEEGG--- 233

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
               N+    +GKKSNIELEDL+FHQCVRLSKFENEKII+FIPPDG+F+LMNYRL+TPIK
Sbjct: 234 ----NNAEGGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIK 289

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD  IQVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P F+YSHGS+K+
Sbjct: 290 PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKY 349

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           +PEK+AILW++++F GGKEYS  AQLGLPS+  +E PK KRP+Q+KFQIPYFTTSGIQVR
Sbjct: 350 VPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVR 409

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLK++EPKLQY+S+PWVRYITQSGDDYTIR
Sbjct: 410 YLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/450 (71%), Positives = 384/450 (85%), Gaps = 8/450 (1%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M SG+YFCD+ GK +LSRRY+DDIP +AI++F  +L+E E+ESSV+PPC  + G+ YLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+YV+ LT S   N+AQ+F +LH+L+ VL +Y+K VEEESI+DNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           +GIPQIT+TKML+QYITQKSFKLI           PP  LTNSVSWR EGI YKKNEA+L
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           D++ESINML+ QQGQVLRSEI+G+VKVKSRLSGMPDLKLG+NDKGIF++  +++++    
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGA- 239

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300
                  S    KKSNIELEDLKFHQCVRL+KFENEKIITFIPPDG+FELM+YRL+TPIK
Sbjct: 240 -------SGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIK 292

Query: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360
           PLIWCD+ +QVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P F+YSHG+IKW
Sbjct: 293 PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKW 352

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           +P +NAILWK++SF GGK+YSM A++GLPSV      K+KRPVQIKFQIPYFTTSGIQVR
Sbjct: 353 VPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVR 412

Query: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           YLKINEPK+QY S+PWVRYITQSGDDYTIR
Sbjct: 413 YLKINEPKMQYNSYPWVRYITQSGDDYTIR 442

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/469 (69%), Positives = 386/469 (82%), Gaps = 24/469 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S VYFCD  GKP+LSR+YRDDIPLSAIDKFS +L + EEES+++PPC+ + GI Y+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+ AL TS Q NI+ IF FLH+++ VL  YLK+VEEESIRDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YG+PQITETKMLK+YIT KSFKL            PP  LTNSVSWR EGIKYKKNEA+L
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYL--------- 231
           DIIESINML+ Q+GQVLRSEI+G V+VKSRLSGMPDLKLGIND+GIF+KYL         
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 232 ----ENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGE 287
               E+ +D +    I+++ S  N +K+NIELEDLKFHQCVRLSKFENEKII+FIPPDGE
Sbjct: 241 NGDDEDADDTNNESSIVSEGS--NKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGE 298

Query: 288 FELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDAD 347
           F+LMNYRL+T IKPLIWCD++IQ +   RIEIHC+AKAQIKKKSIA NVEILIPVP+DAD
Sbjct: 299 FDLMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDAD 355

Query: 348 TPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIE------PPKVKR 401
           +P FKYSHG IK+LPEKN +LWK+ SF GGKEYSM AQ+GLPS+ G +        + K+
Sbjct: 356 SPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKK 415

Query: 402 PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           PVQ+KF+IPYFTTSGIQVRYLK+NEPKLQYK++PWVRYITQSGDDYTIR
Sbjct: 416 PVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIR 464

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/457 (72%), Positives = 384/457 (84%), Gaps = 10/457 (2%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S +YFCD  G+P+LSR+YRDDIP SAID+F  +L   EEE++++PPC+ + GI +LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VA+ TS   N A IF FLH+++ VL +YLK+VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYL 180
           YGIPQITE KMLKQYITQKSFKL            PP +LTNSVSWR EGIK+KKNEA+L
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           DIIESINMLM Q+GQVLRSEIIGEVKVKS+LSGMPDLKLGINDKG+FSKYLE +E+    
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDEN---G 237

Query: 241 VQIINDDSTTNGKK------SNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYR 294
           V I  DDS+ +  K      +N+ELEDLKFHQCVRLSKFENEK ITFIPPDG+FELM+YR
Sbjct: 238 VPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYR 297

Query: 295 LTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYS 354
           L+T IKPLIWCD+NI+ HSKSRIEI CRAKAQIKKKS A NVEILIPVP+DADTP FKYS
Sbjct: 298 LSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYS 357

Query: 355 HGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVD-GIEPPKVKRPVQIKFQIPYFT 413
           HGSIK++PEKNAILWK+R+F G KEYSM A++GLPS + G E  K+KRPVQ+KFQIPYFT
Sbjct: 358 HGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFT 417

Query: 414 TSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           TSGIQVRYLKI E  LQYKS+PWVRYIT+SGDDYTIR
Sbjct: 418 TSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIR 454

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  219 bits (559), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 146/475 (30%), Positives = 241/475 (50%), Gaps = 37/475 (7%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M+S ++     G  I+S+  +D+I L   + F   ++ + +   V  P L      +  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120
           + +    +   +   T+ A I+ FL+    +L  Y  +  E+S++ +F++ YE+LD ++D
Sbjct: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDIN-SEDSLQGDFMLCYEILDIVLD 116

Query: 121 YGIPQITETKMLKQYITQKSFK---------------LIXXXXXXXXXXXPPVALTNSVS 165
            GIP+ TE   +  YI++K                  L+             +   +   
Sbjct: 117 NGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCL 176

Query: 166 WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKG 225
           WR EGI+YKKNE YLD+ E I++L+N+ G +L+S + G V+  + LSGMP  + G ND  
Sbjct: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYL 236

Query: 226 IFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPD 285
             S   ++  +     +     +  N    ++ LED KFHQCV+L KF+ E++I F+PPD
Sbjct: 237 SPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPD 296

Query: 286 GEFELMNYR----LTTPIK--PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEIL 339
           G FELM Y     L  P K  P++       +  KS +E     K+    K  A +VE+ 
Sbjct: 297 GLFELMKYHVRDNLNLPFKVTPMV-----TTLKGKS-VEYRITLKSLFPSKLCAKDVELY 350

Query: 340 IPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKV 399
           IP P D        S G  K++PE+NAI+WK+  + G  E   +A + +P  +G +   +
Sbjct: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNL 409

Query: 400 KR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           ++    P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  201 bits (511), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 139/490 (28%), Positives = 243/490 (49%), Gaps = 49/490 (10%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M++ ++     G+ ++S+  RD I  S  + F   ++ + +   V  P L      +  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  QHS-DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDY-LKSVEEESIRDNFVIIYELLDEM 118
           + S ++++VA+T S   + A I+ FL++  ++L  Y L S  EES+++ F+  YELLD +
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAYGLNS--EESLKEEFMTCYELLDVV 114

Query: 119 MDYGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTN---------------- 162
           ++ G+P  TE   +   ++++    +              A  +                
Sbjct: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSS 174

Query: 163 ----------------SVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVK 206
                           +  WR  GIKYKKNE +LD+ E IN+L+++ G +L+S + G V 
Sbjct: 175 SSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234

Query: 207 VKSRLSGMPDLKLGINDK-GIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFH 265
           + + LSG P  + G+ND   +    L  + DF    ++ N  +       +++LED KFH
Sbjct: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFH 294

Query: 266 QCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEIHCRAK 324
           QCV+L++F  ++II F+PPDG FELM Y +   +  P     I     +   +E     K
Sbjct: 295 QCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALK 354

Query: 325 AQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTA 384
           +    K  A +V + IPVP          S+G  +++PE+NA+LWK   + G  E +++A
Sbjct: 355 SLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA 414

Query: 385 QLGLPSVDGIEPPKVKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYI 440
            L +P +D      +++    P+ + F+I  F+ SG+ VR+ K++E    Y +  WV+YI
Sbjct: 415 -LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYI 472

Query: 441 TQSGDDYTIR 450
           ++SG  Y +R
Sbjct: 473 SRSG-AYEVR 481

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  200 bits (509), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 136/478 (28%), Positives = 243/478 (50%), Gaps = 41/478 (8%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M+S ++     G+ ++S+  R  +P S  + F   ++ + +   V  P L      +  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLD---VRSPVLTLGSTTFHHV 57

Query: 61  QH-SDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMM 119
           +   ++++VA++ S   + A I+ FL++L ++L  +    E E ++++F+  YELLD ++
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115

Query: 120 DYGIPQITE-----TKM-LKQYITQKSFKLIXXXXXXXXXXXPPVA-------------- 159
           + G+P  TE     +KM +K   + +                 PVA              
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 160 ----LTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMP 215
               + +++ WR  GIKYKKNE +L++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDK-GIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE 274
             + G+ND   + + + +NE          N  +       ++ LED KFHQCV+L KF+
Sbjct: 236 VCRFGLNDSLSVSTPFGDNES------PTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ 289

Query: 275 NEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIAN 334
           +E+ I FIPPDG FELM Y +   +         + +   + I+     K+    K  A 
Sbjct: 290 SERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAK 349

Query: 335 NVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGI 394
           +V++ IPVP +        S+G  K++PE++AI+WK   + G  E S++A   +P  D  
Sbjct: 350 DVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVPMKDSA 408

Query: 395 EPPK--VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
                  K P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 409 LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  198 bits (504), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 136/480 (28%), Positives = 246/480 (51%), Gaps = 44/480 (9%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M++ ++     G+ ++S+  +  +  S  + F   ++ + +   V  P L      +  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  QHS-DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMM 119
           + + ++++VA++ S   + A I+ FL++L  +L +      E  +++ F+I YELLD ++
Sbjct: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115

Query: 120 DYGIPQITETKMLKQYITQK------SFKLIXXXXXXXXXXXPPVA-------------- 159
           + G+P  TE   +   ++ K      +F +             PV+              
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 160 ----LTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMP 215
                 +++ WR  GIKYKKNE +L++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFEN 275
             + G+ND    S    +++++    Q+ N  +       ++ LED KFHQCV+L KF++
Sbjct: 236 VCRFGLNDALSVSTPFGDDDEY----QVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS 291

Query: 276 EKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIAN 334
           E+ I FI PDG FELM Y +   +  P     I   V S S I+     K+    K  A 
Sbjct: 292 ERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTAK 350

Query: 335 NVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGI 394
           +V++ IPVP +  +     S+G  K++PE++AI+WK   + G  E S++A   +P  D  
Sbjct: 351 DVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT-AVPMKDST 409

Query: 395 ----EPPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
               + P  + P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 410 LNIEQWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  197 bits (501), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 136/481 (28%), Positives = 242/481 (50%), Gaps = 38/481 (7%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKF-SQILLEHEEESSVVPPCLLYQGIHYLF 59
           M+S ++  +A G  ++S+  +D +  S  D F +Q++ +    S ++   L      ++ 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58

Query: 60  IQHSD---IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLD 116
            + SD   +++VA++ S   + + I+ +LH+L  ++  +  + +E+ ++D F+++YE+L+
Sbjct: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGIN-DEDVLKDEFMLLYEILE 116

Query: 117 EMMDYGIPQITE---------TKMLKQYITQKSFKLIXXXXXXXXXXXPPVA-------- 159
             ++ GIPQ T+          K ++     KS  L            P ++        
Sbjct: 117 LTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSIA 176

Query: 160 --LTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDL 217
               +   WR  G+KYKKNE YLDI E I +L+ + G +++S + G V   S LSGMP  
Sbjct: 177 LSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLC 236

Query: 218 KLGINDKGIFSKYLENEEDFS-----KPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSK 272
           +LG+ND   +S +   + + S         I N  +  N    ++ LED KFHQCV+L+K
Sbjct: 237 QLGLNDT--YSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQLNK 294

Query: 273 FENEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSI 332
           +E   +I F+PPDG F+LM YR+   I         +++   S +      ++       
Sbjct: 295 YEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVS 354

Query: 333 ANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSV- 391
           A +V + IPVP       F  S G  K+   +  ++WK   + G  E +++ ++ +P+  
Sbjct: 355 AKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATS 414

Query: 392 -DGIEPPKVKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTI 449
            D  +  +  R P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI+ SG  Y I
Sbjct: 415 HDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AYEI 473

Query: 450 R 450
           R
Sbjct: 474 R 474

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  192 bits (488), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 147/525 (28%), Positives = 240/525 (45%), Gaps = 106/525 (20%)

Query: 1   MVSGVYFCDASGKPILSRRYRD-DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLF 59
           M S +Y  D + +P++ + ++       +I+ F Q   +H      + P   Y+GIH+++
Sbjct: 1   MSSCIYILDETLQPLIYKNFKAISNGEESIELFQQAHSKHP-----MVPVFHYKGIHFVY 55

Query: 60  IQHSDIYVV--------ALTTSYQTNIAQIFMFLHQLVSVLGDYLKS--VEEESIRDNFV 109
           I+    Y +        A       N+  I  +L    ++L  Y  S  +    I DNF 
Sbjct: 56  IRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFH 115

Query: 110 IIYELLDEMMDYGIPQITETKMLKQYIT---------QKSFKLIXXXXXXXXXXXPPVAL 160
           +IYELLDE +D+G+PQ+T+  +++ YI            S K I               +
Sbjct: 116 LIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYM 175

Query: 161 --------TNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRL 211
                   T+++SWR +GI Y KNE +LD+IE I   M+     +R   + G ++ +S L
Sbjct: 176 NSFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYL 235

Query: 212 SGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLS 271
           SGMP LK+G++   I S   +  E F                     + + KFHQCV L 
Sbjct: 236 SGMPKLKIGLS--KITSSLPKEREQF---------------------MNNAKFHQCVSLE 272

Query: 272 KFENEKIITFIPPDGEFELMNYRLTT-----PIKPLIWCDINIQVHSKSRIEIHCRAKAQ 326
             + + I++FIPPDGEF+L  Y+L       P+  L+  D+  +   + +I I       
Sbjct: 273 DLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTD 331

Query: 327 IKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGK 378
            K ++  + + I IP+         D A  P FK   G++ +    + +LW++ S  GG 
Sbjct: 332 FKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGH 391

Query: 379 ---EYSMTAQLGLPS-----------VDGIEPPKVK---------------------RPV 403
              E+SM  +  L              + ++PP ++                     R V
Sbjct: 392 AQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLV 451

Query: 404 QIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYT 448
            ++F+IPY+T SG++V+YLKI E +LQY SFPWVRY T + ++Y 
Sbjct: 452 SMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYA 496

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  191 bits (484), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 142/498 (28%), Positives = 248/498 (49%), Gaps = 56/498 (11%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M++ +    A G+ ++S+ ++  +  S  D F   ++ + +   V  P L      +  I
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QHS---DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           + +   ++++VA++ +   + A I+ FL++L S+L  Y  +  EE +++ F+I++ELLD 
Sbjct: 58  KSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSYGLN-HEEYLKEEFMIVHELLDV 115

Query: 118 MM--DYGIPQITETKMLKQYITQKSFKLIXXXXXXXX------------------XXXPP 157
           MM    GIP +TE  ++   ++ K  K I                             P 
Sbjct: 116 MMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPK 175

Query: 158 VALTNSVS------------WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEV 205
           +   NS S            WR +GI +KKNE  L + E IN+L+++ G VL++ + G +
Sbjct: 176 LLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 206 KVKSRLSGMPDLKLGIND----KGIFSKYLENEEDFSKPVQIINDDSTTNGKKS-----N 256
            +++ LSG P  + G+ND     G+ S  +    + +     +N D T   + S     +
Sbjct: 236 DLETHLSGTPICQFGLNDSLSVSGVDSD-MYGSHNHNHHFGDVNFDKTDKKQLSMASVGS 294

Query: 257 IELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKS 315
           + LED KFHQCV L KF+ ++II F+PPDG  ELM Y +   +  P     I     + +
Sbjct: 295 VILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGT 354

Query: 316 RIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFA 375
            +E     K+    +  A NV + IPVP +        ++GS K++PE++A++W+   F 
Sbjct: 355 ALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFN 414

Query: 376 GGKEYSMTAQLGLPSVDGIEPPK---VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYK 432
           G  E +++A + +P+ D  +       K P+ + F+I  F+ SG+ VRY  I E   +YK
Sbjct: 415 GLTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYK 473

Query: 433 SFPWVRYITQSGDDYTIR 450
           +  W++YI++SG  Y IR
Sbjct: 474 AVKWIKYISRSG-SYEIR 490

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 142/494 (28%), Positives = 245/494 (49%), Gaps = 57/494 (11%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59
           M+S +    + G+ I+++  +  +  S  D F  Q++   +  S ++   L     H++ 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58

Query: 60  IQHSD-IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEM 118
              SD +++VA++ S   N   I+ FL++L +V+ D     +E ++++NF+  YE+LD +
Sbjct: 59  SDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDTV 116

Query: 119 MDYG-IPQITE-----TKML----KQ----------YITQKSFKLIXXXXXXXXXXXPPV 158
           ++ G IP  TE     +KM     KQ           +T  S  L            P  
Sbjct: 117 LEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKF 176

Query: 159 ALTNS--------------VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGE 204
              N+              +SWR  GIKYKKNE  L++ E I++L+++ G +L+S + G 
Sbjct: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236

Query: 205 VKVKSRLSGMPDLKLGINDKGIFSKYLE-NEEDFSKPVQIINDDSTTNGKKSNIELEDLK 263
           + + + LSGMP  + G+ND    S  +E  ++  S+     N  +        + LED K
Sbjct: 237 IDLTTHLSGMPICQFGLND----SLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCK 292

Query: 264 FHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEIHCR 322
           FHQCV L KF  +++I F+PPDG  ELM Y +   +  P     I   +   + I+    
Sbjct: 293 FHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVT 352

Query: 323 AKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSM 382
            K+    K  A +V + IPVP          S+G  K++PE++A++WK   + G  E ++
Sbjct: 353 LKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTL 412

Query: 383 TAQLGLPSVDGIE------PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPW 436
           +A + +PS D  +      P   + P+ + F+I  F+ SG+ VRY K+++   +Y++  W
Sbjct: 413 SA-VTVPSSDTTQLTVQQWP---RPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKW 468

Query: 437 VRYITQSGDDYTIR 450
           ++YI++SG  Y IR
Sbjct: 469 IKYISKSG-SYEIR 481

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  183 bits (465), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 136/489 (27%), Positives = 241/489 (49%), Gaps = 54/489 (11%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M+S V    + G+ I+S+ +++++  S  D F   ++ + +   V  P L      +  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLD---VRSPILTLGSTTFQHI 57

Query: 61  QHS----DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLD 116
           + +    D+++V++T S   N   ++ FL++   +L  Y  +  EE +++ F++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELYGLN-NEEFLKEEFMVCYELLD 115

Query: 117 EMM-DYGIPQITETKMLKQYITQK-------SFKLIXXXXXXXXXXXP------------ 156
            M+ + G P  T+   + + ++ K       +F +            P            
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 157 --------PVALTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVK 208
                      +   + WR +GI +KKNE +L + E I++L++++G +L+S + G + + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCV 268
           + LSG P  + G+ND    S  ++N++       I N  +       ++ LED KFHQCV
Sbjct: 236 THLSGTPVCQFGLND----SLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQCV 291

Query: 269 RLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEIHCRAKAQI 327
            L KF+ ++II F+PPDG  ELM Y + + I  P     I     S + +E     K+  
Sbjct: 292 SLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLF 351

Query: 328 KKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLG 387
             K  A NV + IPVP +        S+GS K+ PE+ A+LW    + G  E +++A   
Sbjct: 352 PSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV-- 409

Query: 388 LPSVDGIEPPKV------KRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYIT 441
             ++   + P++      K P+ + F+I  F+ SG+ VRY  I E + +YK+  W+RY++
Sbjct: 410 --TITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVS 466

Query: 442 QSGDDYTIR 450
           +SG  Y IR
Sbjct: 467 KSG-SYEIR 474

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  181 bits (460), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 140/494 (28%), Positives = 240/494 (48%), Gaps = 53/494 (10%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M++G+      G+ I+S+ ++  +  S  D F   ++ + +   V  P L      +  I
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QHS----DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLD 116
           + S    ++++VA T +   N A I+ FL++L S+L +Y  + +EE +++ F+I++ELLD
Sbjct: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEYGLN-KEEYLKEEFMIVHELLD 115

Query: 117 EMM-DYGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVS---------- 165
            M+   GIP  TE   +   ++ K  KL                  N +S          
Sbjct: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS 175

Query: 166 --------------WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRL 211
                         WR + IK+KKNE  L + E IN+L+ + G +L++ + G + +++RL
Sbjct: 176 SQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 212 SGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDST-----------TNGKKSNIELE 260
           SG P  + G+ND         + E  S+  +  N+ S+           +     N+ LE
Sbjct: 236 SGTPVCQFGLNDSLTLGS--NDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILE 293

Query: 261 DLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEI 319
           D KFHQCV L KF+ E+II F+PPDG  ELM Y +   +  P     I     +   ++ 
Sbjct: 294 DCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDY 353

Query: 320 HCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKE 379
               K+    +  A  V + IPVP          S+G+ K++P +NA++WK   + G  E
Sbjct: 354 RIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTE 413

Query: 380 YSMTAQLGLPS--VDGIEPPKVKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPW 436
            +++A + +PS  V+     +  R P+ + F+I  F+ SG+ VRY  I+E    YK+  W
Sbjct: 414 NTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKW 472

Query: 437 VRYITQSGDDYTIR 450
           ++Y+++SG  Y +R
Sbjct: 473 IKYVSKSG-SYEVR 485

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  181 bits (460), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 143/537 (26%), Positives = 247/537 (45%), Gaps = 120/537 (22%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S ++  D    P++ + ++    +   + F+    E  + S+V  P + ++GI ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHSDIYVVALTT-SYQTNIAQIFMFLHQLVSVLGDYLK--SVEEESIRDNFVIIYELLDE 117
               +Y V+++  S +++I    ++L+    +L  YL+  +++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 MMDYGIPQITETKMLKQYIT--------------------------------QKSFKLIX 145
            +D+GIPQ+T+  +++  I                                 +KS K   
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 146 XXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYLDIIESINMLMN-QQGQVLRSEIIGE 204
                          T ++SWR +GI Y KNE ++D+IES   +M+ +  QV ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKF 264
           +  +S LSGMP +K+ IN      K L++ + F                     L   KF
Sbjct: 236 IICRSYLSGMPVVKICIN------KMLKDRDQF---------------------LSSAKF 268

Query: 265 HQCVRLSKFENEKIITFIPPDGEFELMNYRLT-----TPIKPLIWCDINIQVHSKSRIEI 319
           HQCV L    ++  I FIPPDG+F+L  Y++      +P+  LI   + ++   K +++I
Sbjct: 269 HQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHKLQI 327

Query: 320 HCRAKAQIKKKSIANNVEILIPVPDDADT--------PTFKYSHGSIKWLPEKNAILWKL 371
             + +   K ++ A  ++I +P+ D  +T        P FK   GSI +      +LWK 
Sbjct: 328 SMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKA 387

Query: 372 RSFAGGKE---YSMTAQLGLPSVDG-----------IEPPKVKRPVQI------------ 405
               GG     +SM  +  L   +            ++PP ++  V++            
Sbjct: 388 NGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKG 447

Query: 406 ------------KFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
                       +F++PYFT+SG++V YLKI E +LQY+SFPWVRY T +  +Y  +
Sbjct: 448 QINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQ 504

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  179 bits (455), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 139/481 (28%), Positives = 233/481 (48%), Gaps = 44/481 (9%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59
           M++GV      G+ I+S+  + +   S  D F  Q++   +  S ++   L     H++ 
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPIL--TLGSTTFHHIR 58

Query: 60  IQHSD-IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEM 118
               D +++VA+T S   N   I+ FL++  S+L  +     E ++++ F+  YELLD M
Sbjct: 59  SNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAFGLD-NETTLKEEFMTCYELLDLM 116

Query: 119 MDY-GIPQITETKMLKQYITQKSFKLIX----------------XXXXXXXXXXPPVALT 161
           ++  G+P  TE   +   ++ K    I                             V   
Sbjct: 117 LNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDTM 176

Query: 162 NS----VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDL 217
           N+      WR  GIKYKKNE +L+I E I++L+++   +L++ + G V + S LSG P  
Sbjct: 177 NTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPTC 236

Query: 218 KLGINDKGIFSK---YLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE 274
           + G+ND     +   Y  ++  F       N  +        + LED KFH+CV L KF 
Sbjct: 237 QFGLNDSLSVDEPNYYNSDDNGFR------NQQNIPRATAGTVVLEDCKFHECVSLDKFN 290

Query: 275 NEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCR--AKAQIKKKSI 332
            ++II F+PPDG  ELM Y +   I        N+ ++S+SR  +  R   K+    K  
Sbjct: 291 RDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV-INSRSRTGLDYRITLKSLFPSKLS 349

Query: 333 ANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVD 392
           AN+V + IPVP          S+G  +++PE++ I+WK   + G  E  ++A + + S D
Sbjct: 350 ANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSA-VTVSSND 408

Query: 393 GIE---PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTI 449
             +       + P+ + F+I  F+ SG+ VRYLKI E   +Y++  W++YI++SG  Y +
Sbjct: 409 TTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSG-SYEV 467

Query: 450 R 450
           R
Sbjct: 468 R 468

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  180 bits (456), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 143/501 (28%), Positives = 247/501 (49%), Gaps = 62/501 (12%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59
           M+SGV    + G+ +L++ +++ +  S  D F  Q++   +  S V+   L     H++ 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHSD-IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEM 118
            +H D +++V +T S   N A I+ FL++L +V+  Y +   EE++++ F+I++E+LD M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXP-------------------PV 158
           +   GIP  TE   L   I Q S K +                               P 
Sbjct: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPK 173

Query: 159 ALT-------------------NSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRS 199
            LT                   N ++WR +GI +KK+E +L + E IN+L+++ G +L+S
Sbjct: 174 FLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKS 233

Query: 200 EIIGEVKVKSRLSGMPDLKLGINDK-GIFS----KYLENEEDFSKPVQIINDDSTTNGKK 254
            + G + + + LSG P  + G+ND  G+ S    K+L  ++  S      N +       
Sbjct: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGS-DFGNKNFIPKAAA 292

Query: 255 SNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSK 314
            ++ LED KFH+CV L KF    II F+PPDG  ELM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTHST 351

Query: 315 SRIEIHCR--AKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLR 372
              EI  R   K+    K  A +V + IPVP          S+G  K++PE+NA++W+  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFN 411

Query: 373 SFAGGKEYSMTAQLGLPSVDGIE---PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKL 429
            + G  E +++A + + + D  +       + P+ ++F++  F+ SG+ VRY  I+    
Sbjct: 412 KYNGLTENTLSA-VTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDS 470

Query: 430 QYKSFPWVRYITQSGDDYTIR 450
           ++++  W++YI+++G  Y +R
Sbjct: 471 KHRAVKWIKYISKAG-SYEVR 490

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  178 bits (452), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 130/495 (26%), Positives = 240/495 (48%), Gaps = 60/495 (12%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M++ V      G+ ++ + ++  +  +  D F   ++ ++   ++  P L      + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINND---NIRSPILTLGSTTFHFI 57

Query: 61  Q---HSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           +    S +++VA+T S   +   I+ +L++L S++  Y     E+ ++D F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVY-GLTHEDILKDEFIVCHELLDI 115

Query: 118 MMDY-GIPQITETKMLKQYITQKSFKLIXXXX----------XXXXXXXPPVALT----- 161
            +   G+P  TE   +   +T K  +++                      P+++      
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 162 ----------------NSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEV 205
                           +++ WR   IKYKKNE  +++IE IN+L+ +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVKSRLSGMPDLKLGIND----KGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELED 261
            + + LSGMP  ++G+ND    +G  + +  NE+  S      N D+  +     + LE 
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRAS------NRDAMPDVSGDRVILEG 289

Query: 262 LKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PL-IWCDINIQVHSKSRIEI 319
            KFHQCV L K+  + +I FIPPDG+FELM Y ++  +  P  I   + +  H  + +  
Sbjct: 290 SKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTA-LSY 348

Query: 320 HCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKE 379
             + K+   +K  A NV + IPVP          S G  K++PE+N ++W    F G  E
Sbjct: 349 AIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTE 408

Query: 380 YSMTAQLGLPSVDGIEPPKVKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFP 435
             + AQ  +P+   I    +K+    P+ + F++  F+ +G+ VRYLK+ E  + Y +  
Sbjct: 409 NHLNAQT-VPT-QSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIK 466

Query: 436 WVRYITQSGDDYTIR 450
           W++YI+ +G  Y +R
Sbjct: 467 WIKYISAAG-SYEVR 480

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  178 bits (451), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 124/473 (26%), Positives = 215/473 (45%), Gaps = 108/473 (22%)

Query: 48  PCLLYQGIHYLFIQHSDIYVVALTTSYQTNI-AQIFMFLHQLVSVLGDYL-KSVEEESIR 105
           P L ++G  Y++IQ   +Y ++L+   +T +   +F +L QL  +   YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEMMDYGIPQITETKMLKQYITQKSFKLIX--------------XXXXXX 151
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+  +  +                       
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 152 XXXXPPVA------------LTNSVSWRQEGIKYKKNEAYLDIIESINMLMN-QQGQVLR 198
               P  A             T+++SWR  GI Y KNE +LD++E +  LM+ ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIE 258
           +++ G +  +S LSGMP L +G+N      K +  + DF+  V                 
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLN------KMVAQDRDFTSQVH---------------- 258

Query: 259 LEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLT-----TPIKPLIWCDINIQVHS 313
                FHQCV L +   ++ ITF+PPDGEF+L +Y+L       P+  L  C   ++   
Sbjct: 259 -----FHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRR 313

Query: 314 K----SRIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWL 361
           +     R+ +        K +   + +++ +P+         D +  P FK   G + + 
Sbjct: 314 RPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFN 373

Query: 362 PEKNAILW---KLRSFAGGKEYSMTAQLG--------------------LPSVDGIE--- 395
              + +LW   K +   G + ++M +Q                      LP+  G +   
Sbjct: 374 ITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEA 433

Query: 396 ---------PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRY 439
                    P      +++ F++PY T SG++V +LKI EP+LQY+SFPW+RY
Sbjct: 434 LYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  177 bits (449), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 135/497 (27%), Positives = 231/497 (46%), Gaps = 69/497 (13%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59
           M++ ++     G+ I+S+ + + +  S  D F  Q++   +  S ++   L     H++ 
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58

Query: 60  IQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMM 119
              SD   +   +    N   I+ FL++  ++L  Y    +EE ++++F+I YE+LD ++
Sbjct: 59  SNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDVVI 117

Query: 120 DYG-IPQITETKMLKQYIT---QKSFKLIXXXXXXXXXXXPPVALTNS------------ 163
             G IP  TE   +   I+    KS               P   L+ S            
Sbjct: 118 GAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNN 177

Query: 164 --------------VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKS 209
                           WR  GIKYKKNE +L + E IN+L+++ G +L++ + G + + +
Sbjct: 178 RSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTT 237

Query: 210 RLSGMPDLKLGINDKGIF----SKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFH 265
            LSG P  + G+ND        S +L+ +E         N  +       ++ LED KFH
Sbjct: 238 HLSGTPICQFGLNDSPSVEFGDSLWLDTQE-------FHNKKAVPKAAAGSVMLEDCKFH 290

Query: 266 QCVRLSKFENEKIITFIPPDGEFELMNY----RLTTPIK--PLIWCDINIQVHSKSRIEI 319
           QCV L KF  E+II F+PPDG  ELM Y     L  P K  P++           S +E 
Sbjct: 291 QCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEY 343

Query: 320 HCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKE 379
               K+    K  A +V + IPVP          S+G  K+  E+NA++W+   + G  E
Sbjct: 344 RITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTE 403

Query: 380 YSMTAQLGLPSVDGIE------PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS 433
            +++A + +P+ D  +      P   + P+ + F+I  F+ SG+ VRY ++++   +Y+ 
Sbjct: 404 NTLSA-VTVPTSDTTQLTLQQWP---RPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRV 459

Query: 434 FPWVRYITQSGDDYTIR 450
             W++YI++SG  Y +R
Sbjct: 460 VKWIKYISKSG-SYEVR 475

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  177 bits (450), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 192/390 (49%), Gaps = 32/390 (8%)

Query: 48  PCLLYQGIHYLFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDN 107
           P L      +  I+ S    + +      + A I+ FL+ +  +L  Y  + EE ++ D+
Sbjct: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103

Query: 108 FVIIYELLDEMMDYGIPQITETKMLKQYITQK--------------SFKLIXXXXXXXXX 153
           F++ YELLD ++D G+PQ TE   +   +++K              S +L          
Sbjct: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163

Query: 154 XXPPVALTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSG 213
                   +   WR EGIKYKKNE YLD+IE +++L+N+ G +L++ + G V+  + LSG
Sbjct: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223

Query: 214 MPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKF 273
           MP    G ND    S+ L        P +          ++ ++ LED KFHQCV+L+KF
Sbjct: 224 MPLCHFGFND----SQSLRQR----SPRRQYAPRVFGTDERESVVLEDCKFHQCVQLNKF 275

Query: 274 ENEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIA 333
           + E++I F+PPDGEFELM Y +   ++P       +   ++  IE     ++    K  A
Sbjct: 276 DQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSA 335

Query: 334 NNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTA------QLG 387
            +VE+ IP P    +     S G  K++PE+NAI+WK+  F G  E +++A      Q  
Sbjct: 336 KDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGH 395

Query: 388 LPSVDGIEPPKVKRPVQIKFQIPYFTTSGI 417
              V    P   + P+ +K +I  F+T+ +
Sbjct: 396 YAQVLDQWP---RPPISMKLEIMMFSTAAL 422

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  175 bits (444), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 137/487 (28%), Positives = 220/487 (45%), Gaps = 114/487 (23%)

Query: 48  PCLLYQGIHYLFIQHSDIYVVALTTS-YQTNIAQIFMFLHQLVSVLGDYLK--SVEEESI 104
           P +  +GI Y++I    +Y V+++    + N+  I  +L+   ++L  YLK   V+   I
Sbjct: 43  PVIYSKGIIYIYILRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGI 102

Query: 105 RDNFVIIYELLDEMMDYGIPQITETKMLKQYITQKSF--KLIXXXXXXXXXXXPPVAL-- 160
            DNF +IYEL DE +DYGIPQ+T+  +++  I  ++   K+             P  L  
Sbjct: 103 IDNFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQS 162

Query: 161 ---------------------------TNSVSWRQEGIKYKKNEAYLDIIESINMLMN-Q 192
                                      T ++SWR +GI Y KNE ++DIIE  + LM+ +
Sbjct: 163 KENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFK 222

Query: 193 QGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNG 252
             QV ++ + G++  +S LSGMP +++ IN      K L++++ F               
Sbjct: 223 NSQVRQTFVYGKINCRSYLSGMPIVRVCIN------KMLKDKDLF--------------- 261

Query: 253 KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLT-----TPIKPLIWCDI 307
                 L   KFHQCV L    ++  I FIPPDG+F+L  Y+L      +PI  LI   I
Sbjct: 262 ------LGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKI 315

Query: 308 NIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIK 359
           N +   K R+ +    +   K ++ A  ++I IP          D    P FK  HGS+ 
Sbjct: 316 N-ERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVF 374

Query: 360 WLPEKNAILWKLRSFAGGK---EYSMTAQLGLPSVD-----------GIEPPKVKRPVQI 405
           +      +LW  +   GG     YSM  +  L   +            ++PP ++    +
Sbjct: 375 FNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHL 434

Query: 406 ------------------------KFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYIT 441
                                   +F++PY+T+SG++V YLKI+E  L+Y+SF WVRY T
Sbjct: 435 EELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKT 494

Query: 442 QSGDDYT 448
            +  +Y 
Sbjct: 495 INDTEYA 501

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  171 bits (434), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 141/501 (28%), Positives = 242/501 (48%), Gaps = 62/501 (12%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59
           M+SGV    + G+ +L++ +++ +  S  D F  Q++   +  S V+   L     H++ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHSD-IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEM 118
            +H D +++V +T S   N A I+ FL++L  V+  Y +   EE++++ F+I++E+LD M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 M-DYGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXP-------------------PV 158
           +   GIP  TE   L   I Q S K +                               P 
Sbjct: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPK 173

Query: 159 ALTNSVS-------------------WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRS 199
            L  S S                   WR +GI +KK+E +L + E +N+L+++ G +L+S
Sbjct: 174 FLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233

Query: 200 EIIGEVKVKSRLSGMPDLKLGINDK-GIFS----KYLENEEDFSKPVQIINDDSTTNGKK 254
            + G + + + LSG P  + G+ND  G+ S    K+L  ++  S+     + +       
Sbjct: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRG-NFESKNFIHKAAA 292

Query: 255 SNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSK 314
            ++ LED KFH+CV L KF     I F+PPDG  ELM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHST 351

Query: 315 SRIEIHCR--AKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLR 372
              EI  R   K+    K  A +V + IPVP          S+G  K++PE+NA++W+  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFN 411

Query: 373 SFAGGKEYSMTAQLGLPSVDGIE---PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKL 429
            + G  E +++A + + + D  +       + P+ + F++  F+ SG+ VRY  I     
Sbjct: 412 KYNGLTENTLSA-VTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDS 470

Query: 430 QYKSFPWVRYITQSGDDYTIR 450
           ++++  W++YI++SG  Y +R
Sbjct: 471 KHRAVKWIKYISRSG-SYEVR 490

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  169 bits (427), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 138/498 (27%), Positives = 241/498 (48%), Gaps = 56/498 (11%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59
           M+SGV    + G+ IL++ +++ +  S  D F  Q++   +  S V+   L     H++ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHSD-IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEM 118
            +H D +++V +T S   N A I+ FL++L +V+  Y +   EE++++ F+I++E+LD M
Sbjct: 59  SKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 M-DYGIPQITETKMLKQYITQKSFK----------------LIXXXXXXXXXXXPPVALT 161
           +   GIP  TE   +   ++ K  +                              P  L 
Sbjct: 117 LGGNGIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLK 176

Query: 162 NSVS-------------------WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII 202
            S S                   WR  GI +KK+E +L + E +N+L+++ G +L+S + 
Sbjct: 177 KSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVD 236

Query: 203 GEVKVKSRLSGMPDLKLGINDK-GIFSK----YLENEEDFSKPVQIINDDSTTNGKKSNI 257
           G + + + L+G P  + G+ND  G+ S+    +L  +   S+     N +        ++
Sbjct: 237 GTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRS-DFGNKNFLPKAAAGSV 295

Query: 258 ELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRI 317
            LED KFH+CV + KF    II FIPPDG  ELM Y +   I  L +    I  HS    
Sbjct: 296 LLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSHSTRDN 354

Query: 318 EIHCR--AKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFA 375
           EI  R   K+    K  A +V + IPVP          S+G  K++PE+NA++W+   + 
Sbjct: 355 EIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYN 414

Query: 376 GGKEYSMTAQLGLPSVDGIE---PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYK 432
           G  E +++A   + + D  +       + P+ + F++  F+ SG+ VRY  I+    +++
Sbjct: 415 GLTENTLSAAT-VSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHR 473

Query: 433 SFPWVRYITQSGDDYTIR 450
           +  W++YI++SG  Y +R
Sbjct: 474 AVKWIKYISKSG-SYEVR 490

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  168 bits (425), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 138/498 (27%), Positives = 239/498 (47%), Gaps = 56/498 (11%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M+SGV    + G+ IL++ +++ +  S  D F   ++ + +  S V         H   +
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMM- 119
           +  ++++V +T S   N A I+ FL++L SV+  Y +   EE++++ F+I++E+LD M+ 
Sbjct: 61  RGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLDIMLG 118

Query: 120 DYGIPQITETKMLKQYITQKSFKLIXXXXXXXXX--------------------XXPPVA 159
             GIP  TE   L   I Q S K I                               P   
Sbjct: 119 GNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFL 175

Query: 160 LTNSVSWRQEG------------------IKYKKNEAYLDIIESINMLMNQQGQVLRSEI 201
              S S+  +G                  I +KK+E +L + E +N+L+++ G +L+S +
Sbjct: 176 KKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 202 IGEVKVKSRLSGMPDLKLGINDK-GIFSKYLEN---EEDFSKPVQIINDDSTTNGKKSNI 257
            G + + + LSG P  + G+ND  G+ S+  EN   ++D        N +        ++
Sbjct: 236 DGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSV 295

Query: 258 ELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRI 317
            LED KFH+CV + KF    II F+PPDG  ELM Y +   I  L +    I  HS    
Sbjct: 296 LLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVAHSARDN 354

Query: 318 EIHCR--AKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFA 375
           E+  R   K+    K  A +V + IPVP          S+G+ K++PE+NA++W+   F 
Sbjct: 355 EVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFN 414

Query: 376 GGKEYSMTAQLGLPSVDGIE---PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYK 432
           G  E +++A + + + D  +       + P+ + F++  F+ SG+ VRY  I+    +++
Sbjct: 415 GLTENTLSA-VTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHR 473

Query: 433 SFPWVRYITQSGDDYTIR 450
           +  W++YI++SG  Y +R
Sbjct: 474 AVKWIKYISKSG-SYEVR 490

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  164 bits (415), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 138/486 (28%), Positives = 224/486 (46%), Gaps = 50/486 (10%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M++GV    + G  I+    +  +  +  D F   ++   E  S   P L      +  I
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKS---PILTLGSTTFHHI 57

Query: 61  QHSD---IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           + S    +++VA+T S   N   I+ FL++L S+L  Y  +  EE + + F++ YE++D 
Sbjct: 58  RSSSESKLWIVAITRS-NANSGVIWEFLYKLDSMLTAYDLN-NEEKLMEKFMVYYEMIDV 115

Query: 118 MM-DYGIPQITETKMLKQYITQKSFKLIXXX-----XXXXXXXXPPVALTNSVS------ 165
           M+    +P  TE   +   I+ +  K I                P     NS S      
Sbjct: 116 MLTSNAMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFS 175

Query: 166 --------WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDL 217
                   WR  GIKYKKNE +L + E IN+L+++   +L++ + G + + S LSG P  
Sbjct: 176 NITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPIC 235

Query: 218 KLGINDK-GIFSKYLENEED-FSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFEN 275
           + G+ND   +    + N  D F        D ST     S++++ED  FHQCV L KF +
Sbjct: 236 QFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFND 295

Query: 276 EKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEI---HCRAKAQIKKKSI 332
           E++I F+PPDG FELM Y +          D+NI      R+ I    C  + +I  KS+
Sbjct: 296 ERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCSMRYKIILKSL 347

Query: 333 ------ANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQ- 385
                 A +  + IP+P          S G   +    N  +WK   + G  E  +  + 
Sbjct: 348 FPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILET 407

Query: 386 LGLPSVDGIEPPKVKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSG 444
           +   S D +   +  R P+ + F+I  F+ SG+ V+YLK+ E   +Y+   W++Y+++SG
Sbjct: 408 VPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSG 467

Query: 445 DDYTIR 450
             Y IR
Sbjct: 468 -SYEIR 472

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  161 bits (407), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 137/539 (25%), Positives = 227/539 (42%), Gaps = 130/539 (24%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAID-KFSQILLEHEEESSVVPPCLLYQGIHYLF 59
           M S     D + +P++ R  R   P+  +D    Q+    +       P     G HY  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IQHSDIY-VVALTTSYQTNIAQIFMFLHQLVSVLGDYLK-SVEEESIRDNFVIIYELLDE 117
           I   ++Y  + +  +   +   +  +L ++  +   ++   + + ++RDNF +I+E+++E
Sbjct: 58  ITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIEE 117

Query: 118 MMDYGIPQITETKMLKQYITQKSFKLI--XXXXXXXXXXXPP-------------VALTN 162
             DYGI Q+T   ++  +I  +  K               PP               +T+
Sbjct: 118 SSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMTS 177

Query: 163 SVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGI 221
           +VSWR +GI Y KNE +LD+IE +  +M+ +  V+R+ +I G +  +S LSGMP L +G+
Sbjct: 178 AVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGL 237

Query: 222 NDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKF--ENEKII 279
           N      K ++    F K                      LKFH+CV L     E   +I
Sbjct: 238 N------KLMQKNVHFMK---------------------RLKFHECVDLHTLIKEESPVI 270

Query: 280 TFIPPDGEFELMNYRLTTPI---------------KPLIWCDINIQVHSKSRIEIHCRAK 324
            FIPPDGEFEL NY+L  P+               KP    +   ++  K+ I  H +A+
Sbjct: 271 KFIPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQ 330

Query: 325 AQIKKKSIANNVEILIPVP----------DDADTPTFKYSHGSIKWLPEKNAILWKLRSF 374
              K        E+LI +P          D    P FK   G + +     +I+WK+ + 
Sbjct: 331 DSAK--------ELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNL 382

Query: 375 AGG---KEYSMTAQ-----------LGLPSVDGIEPPKVKRP------------------ 402
            GG   K Y +              L +   + ++PP ++                    
Sbjct: 383 KGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYD 442

Query: 403 --------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDY 447
                         + + F+IPY+  SG++V Y KI EP+L Y+SFPWVRY T + ++Y
Sbjct: 443 GNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEY 501

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  158 bits (400), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 136/534 (25%), Positives = 240/534 (44%), Gaps = 122/534 (22%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M+S ++  D   + +  R  +   P+ ++ +  +  + H ++S    P L      Y+FI
Sbjct: 1   MISCLFILDEELQLLTVRLLK---PVPSLLEPLEWFIRHPKKS----PILQNMDYDYIFI 53

Query: 61  QHSDIYVVALTTSYQ-TNI--AQIFMFLHQLVSVLGDYL-KSVEEESIRDNFVIIYELLD 116
           Q   +Y ++L  SYQ TN+    +F +L+QL  +   YL +++ +  I  NF +I+EL+D
Sbjct: 54  QRDGLYFLSL--SYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELID 111

Query: 117 EMMDYGIPQITETKMLKQYITQKSFK----------------------------LIXXXX 148
           E +  G PQ+T+  +++ YI  +  K                                  
Sbjct: 112 ESIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDTEATD 171

Query: 149 XXXXXXXPPVALTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKV 207
                       T+++SWR +GI Y KNE YLD+IE +  L++ Q   ++S  + G ++ 
Sbjct: 172 ENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQC 231

Query: 208 KSRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQC 267
           +S LSGMP L +G+N                     +N ++    +++N       FHQC
Sbjct: 232 RSYLSGMPMLTIGLNK--------------------LNSENEYFMRRAN-------FHQC 264

Query: 268 VRLSKFENEKIITFIPPDGEFELMNYRLTT-----PIKPLIWCDINIQVHSK----SRIE 318
           V L +   +K+I+F PPDGEF+L NY+LT      P+  L  C + ++         R+ 
Sbjct: 265 VNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLI 324

Query: 319 IHCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWK 370
           +        K +   + + I +P+         D +  P FK   G + +    + +LW+
Sbjct: 325 LAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWE 384

Query: 371 LRSFAGG---KEYSMTAQLGLPS-----------VDGIEPPKVKRP-------------- 402
           +    GG   K   M ++  L +            + ++P  ++R               
Sbjct: 385 VGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELN 444

Query: 403 --------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYT 448
                   ++++F+IPY+T SG++V +LKI E +LQ++SFPWVRY T + D Y 
Sbjct: 445 SPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHDIYA 498

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  149 bits (377), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/484 (25%), Positives = 227/484 (46%), Gaps = 45/484 (9%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59
           M++ V    A G+ I+S+ ++  +  S  D F  Q++   +  S ++   L     HY+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 60  IQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMM 119
                ++VV+++ + + N A  + FL++  ++L  Y +   EE +++ F++ +ELLD M+
Sbjct: 59  TPGEGLWVVSVSRNNE-NSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTMV 116

Query: 120 DYG-IPQITETKML--------------------KQYITQKSFKLIXXXXXXXXXXXPPV 158
           + G IP  T+   +                    +Q  T  +                P 
Sbjct: 117 EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNPG 176

Query: 159 ALTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLK 218
            ++       +G + K+NE  + + ESI++L+++ G +L++ + G + + ++L G    +
Sbjct: 177 GISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVCQ 236

Query: 219 LGINDKGIFSKYLENEED--FSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENE 276
            G+ND         ++ D   SK  Q  N +   N     + L D KFHQCV L +F+ +
Sbjct: 237 FGLNDSLSTDNSSNSKWDPLRSKETQGTNLE-MKNAHVGTVLLRDCKFHQCVSLERFDRD 295

Query: 277 KIITFIPPDGEFELMNYR----LTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSI 332
           +II F PP+G  ELM Y     L  P K            +  R+ I    K+    K  
Sbjct: 296 RIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTI----KSLFPGKLS 351

Query: 333 ANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVD 392
           A NV + IPVP          S+G+ K+LPE+NA++WK   + G  E  ++A + +P+ D
Sbjct: 352 AKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPTRD 410

Query: 393 GIEPPK---VKRPVQIKFQIPYFTTSGIQVRYLKI---NEPKLQYKSFPWVRYITQSGDD 446
             +       + P+ + F+I  ++ +G+ VRY  +   +    ++K+  W++Y++ SG  
Sbjct: 411 TTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSG-S 469

Query: 447 YTIR 450
           Y +R
Sbjct: 470 YEVR 473

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  140 bits (353), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 168/363 (46%), Gaps = 101/363 (27%)

Query: 161 TNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKL 219
           T +VSWR +GI Y KNE +LD++ES+  LMN + +V+R  +I G++K KS LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 220 GINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLS-------- 271
            +N                   +I+ DD    G          KFHQCV L+        
Sbjct: 282 ALN-------------------KILQDDKQFLGHA--------KFHQCVSLNSINIKDLE 314

Query: 272 ------------KFENEKIITFIPPDGEFELMNYRLTTPIK--PLI-WCDINIQVH-SKS 315
                        F N+K I FIPPDGEF L  Y L   +K  P+I     +I+ +  K 
Sbjct: 315 KDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKF 374

Query: 316 RIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNAI 367
           R++I  + +   K+++  + + I IP+         D +  P FK   G + +   ++ +
Sbjct: 375 RVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFL 434

Query: 368 LWKLRSFAGG---KEYSMTAQLGLPSVD-----------GIEPPKVKRP----------- 402
           +W++ +  GG    E  M A+  L + +            + PP ++             
Sbjct: 435 IWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMH 494

Query: 403 ----------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDD 446
                           V ++F+IPY T SG++V YLKI E  L+Y+SFPWVRY T + D+
Sbjct: 495 ENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDE 554

Query: 447 YTI 449
           Y  
Sbjct: 555 YAF 557

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 71/144 (49%), Gaps = 10/144 (6%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S ++  D   +P++S+  +    L  I K  +     E  +   PP +     HY+++
Sbjct: 1   MSSCLFILDELLEPLISKNTKPVRNLPDIIKSFK-----ESWTPTSPPIITVSNWHYVYV 55

Query: 61  QHSDIYVVALTTSYQ---TNIAQIFMFLHQLVSVLGDYLKS--VEEESIRDNFVIIYELL 115
           +   ++ VA          N+  I  +L QL  +L +Y K   + +  I DN +++ EL+
Sbjct: 56  KRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTELM 115

Query: 116 DEMMDYGIPQITETKMLKQYITQK 139
           DE +D+GI Q+T+  +++ YI  K
Sbjct: 116 DESIDFGIIQMTDPSIIRDYIRVK 139

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  137 bits (346), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 100/335 (29%), Positives = 156/335 (46%), Gaps = 80/335 (23%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           VSWR +GI Y +NE +LD++E +  LM+    +++  +I G++  KS LSGMP LK+   
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIA-- 273

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFI 282
               F+K  + +E F                     +   KFHQCV      NEK I FI
Sbjct: 274 ----FNKLSQKDEQF---------------------ISHSKFHQCVTWPS-SNEKEIEFI 307

Query: 283 PPDGEFELMNYRLT-----TPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVE 337
           PPDG+F L  Y L       P+  L+   +  ++  K +I++ C  +   K ++  + + 
Sbjct: 308 PPDGDFVLCQYELKRHVKDQPMLKLVSFGVKPKL-KKYKIQMSCTIETHFKARNSTSTLN 366

Query: 338 ILIPVPD-------DADTPT-FKYSHGSIKWLPEKNAILWKLRSFAGGK---EYSMTAQL 386
           + IP+         D   P  FK   G + +    + +LW +    GG    + SM A+ 
Sbjct: 367 LKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEF 426

Query: 387 GLPSV-----------DGIEPPKVK-----------------------RPVQIKFQIPYF 412
            L +            + + PP ++                       R + +KF+IPY 
Sbjct: 427 SLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYS 486

Query: 413 TTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDY 447
           T SG+QV YLKI+E +LQY+SFPWVRY T + ++Y
Sbjct: 487 TCSGLQVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 75/143 (52%), Gaps = 9/143 (6%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S ++  D + +P++S+  +    L  I +  + +   E +     P +     H++ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPESQ-----PVISASSFHFVHI 55

Query: 61  QHSDIYVVALTTSY--QTNIAQIFMFLHQLVSVLGDYL--KSVEEESIRDNFVIIYELLD 116
           + S +  V++  +Y    N+  I  FL Q  S+L  YL   ++++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 EMMDYGIPQITETKMLKQYITQK 139
           E +D+G+ QIT+  +++ YI  K
Sbjct: 116 ESIDFGVIQITDASIMRDYIRVK 138

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  137 bits (346), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 106/343 (30%), Positives = 157/343 (45%), Gaps = 84/343 (24%)

Query: 161 TNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKL 219
           T  VSWR +GI Y KNE +LD++E +  L + + +V+R  +I G++  KS LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKII 279
            +N      K L+ +  F                     +   KFHQCV L    NEK +
Sbjct: 293 ALN------KLLQRDAQF---------------------MSHSKFHQCVALETL-NEKEL 324

Query: 280 TFIPPDGEFELMNYRLT-----TPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIAN 334
            FIPPDGEF L  Y L      TPI  +   +I  Q+  K ++ I    +   K ++  +
Sbjct: 325 EFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTS 383

Query: 335 NVEILIPVPD-------DADTPT-FKYSHGSIKWLPEKNAILWKLRSFAGGK---EYSMT 383
            + + IP+         D   PT FK + G + +    + +LW++    GG    ++SM 
Sbjct: 384 ILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMV 443

Query: 384 AQLGL-----------PSVDGIEPPKVKRP---------------------------VQI 405
           A+  L                + PP ++                             V +
Sbjct: 444 AEFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGM 503

Query: 406 KFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYT 448
            F+IPY T SG++V YLKI E +LQY+SFPWVRY T S ++Y 
Sbjct: 504 DFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 73/140 (52%), Gaps = 9/140 (6%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S +Y  D + +P++S+  +    L+ + +  Q     E  SS  PP +  +  +++  
Sbjct: 1   MSSCLYILDENLEPLISKNIKSIPNLNTLVEVFQ-----EVYSSNAPPIVFNRNWYFIHT 55

Query: 61  QH-SDIYVVAL-TTSYQTNIAQIFMFLHQLVSVLGDYL--KSVEEESIRDNFVIIYELLD 116
           +  S I++ A+  T    N   I +++ Q   +L  YL    ++   + DN +++ ELL+
Sbjct: 56  KRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNLVLDNVLLVLELLE 115

Query: 117 EMMDYGIPQITETKMLKQYI 136
           E  ++G+PQ+TE  ++K YI
Sbjct: 116 ESSEFGVPQMTEPSVMKDYI 135

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  135 bits (341), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 104/351 (29%), Positives = 163/351 (46%), Gaps = 94/351 (26%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMN-QQGQVLRSEIIGEVKVKSRLSGMPDLKLGIN 222
           VSWR +GI Y KNE +LD+IE +  LM+   G++ ++ I GE+K K  LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE-------- 274
                 K ++N+E F                     + + KFHQCV ++  +        
Sbjct: 276 ------KLIKNDEQF---------------------ISNSKFHQCVSINSLKREINNEEE 308

Query: 275 ----NEKIITFIPPDGEFELMNYRLTTPIK--PLIWCDINIQVH---SKSRIEIHCRAKA 325
               + K I FIPPDGEF L  Y L   ++  P+I    NI++     K +I+IH   + 
Sbjct: 309 ENTYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLS-NIEIKPKLKKYKIQIHVTIET 367

Query: 326 QIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGG 377
             KK++  + + I IP+         D    P FK   G + +    + ++W++ S  GG
Sbjct: 368 HFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGG 427

Query: 378 KEYS---MTAQLGLPSVD-----------GIEPPKVKRP--------------------- 402
              S   M A+  + + +            + PP ++                       
Sbjct: 428 NGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNG 487

Query: 403 -----VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYT 448
                + +KF++PY T SG++V YLKI E ++ Y+SFPWVRY T + D+Y 
Sbjct: 488 ISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTINDDEYA 538

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  131 bits (330), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 108/374 (28%), Positives = 162/374 (43%), Gaps = 116/374 (31%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMN-QQGQVLRSEIIGEVKVKSRLSGMPDLKLGIN 222
           VSWR +GI Y KNE +LD+IE +  L++ + G V RS I G++  +S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFEN------- 275
                 K L+N++ F   VQ                     FHQCV L   E        
Sbjct: 309 ------KLLQNDKQFISQVQ---------------------FHQCVSLDSIEKVIKYAEE 341

Query: 276 ---------------EKIITFIPPDGEFELMNYRLTTPIK--PLI-WCDINIQVH-SKSR 316
                          E  I FIPPDG+F L +Y L   I+  P++  C   I     K +
Sbjct: 342 HSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYK 401

Query: 317 IEIHCRAKAQIKKKSIANNVEILIPVPD-------DADTP-TFKYSHGSIKWLPEKNAIL 368
           ++I    +   K  +  + +++ IP+         D   P  FK S+G + +    + +L
Sbjct: 402 LKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLL 461

Query: 369 WKLRSFAGGKEY-------------SMTAQLGL-----------PSVDGIEPPKVK---- 400
           W++    GGK +             +M A+ GL                + PP ++    
Sbjct: 462 WEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPK 521

Query: 401 --------------------RP------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSF 434
                               +P      + + F+IPY T SG++V YLKI+E +LQY+SF
Sbjct: 522 LEDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSF 581

Query: 435 PWVRYITQSGDDYT 448
           PWVRY T + D+Y 
Sbjct: 582 PWVRYKTINDDEYA 595

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 73/141 (51%), Gaps = 10/141 (7%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S +Y  D + +P++S+  +    L  +++   +   H  +S    P +      +++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG---LPNVNELGDLFRYHVRQSQ--NPIIDVYNWRFVYI 55

Query: 61  QHSDIYVVALTTSYQTNIAQ---IFMFLHQLVSVLGDYL--KSVEEESIRDNFVIIYELL 115
           +   +Y VA+  +    IA    I  +L QL  +  DY+  K ++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEMMDYGIPQITETKMLKQYI 136
           DE +DYGI Q+TE  ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  131 bits (330), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 160/364 (43%), Gaps = 107/364 (29%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE +LD+IE +   M+ +  V+R  +I GE+  +S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRL------------ 270
                 K L+ +  F                     L ++KFHQCV L            
Sbjct: 310 ------KILKQDVQF---------------------LSNVKFHQCVSLDSIRARSNPPAV 342

Query: 271 ---SKFENEKI--------ITFIPPDGEFELMNYRLTTPIK--PLIWC---DINIQVHSK 314
               K +NE+         I FIPPDGEF L  Y L   +K  P+I     +I  ++H K
Sbjct: 343 EEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLH-K 401

Query: 315 SRIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNA 366
            +I+IH   +   K  +  + + + IP+         D +  P FK   G++ +      
Sbjct: 402 FKIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKF 461

Query: 367 ILWKLRSFAGG---KEYSMTAQLGL-----------PSVDGIEPPKVKRP---------- 402
           +LW++ +  GG      SM A+  L                + PP ++            
Sbjct: 462 LLWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKI 521

Query: 403 ------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSG 444
                             + + F++PY T SG+++ YLKI E +LQY+SFPWVRY T S 
Sbjct: 522 HEEGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISD 581

Query: 445 DDYT 448
           D+Y 
Sbjct: 582 DEYA 585

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 78/146 (53%), Gaps = 13/146 (8%)

Query: 1   MVSGVYFCDASGKPILSRRYRD--DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYL 58
           M S ++  D + +PI+ +  R   ++P S + KF ++       S+ V P  +   I + 
Sbjct: 1   MSSSIFILDETLEPIICKNIRALPNLP-SLVTKFQELY-----RSNGVSPLPILNDIDWQ 54

Query: 59  FI---QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKS--VEEESIRDNFVIIYE 113
           F+   + S +++  +  + + N+  +F +L +   +L DYL    +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEMMDYGIPQITETKMLKQYITQK 139
           L+DE +D+G+ Q T++ ++K Y+  K
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYVRVK 140

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  130 bits (326), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 97/344 (28%), Positives = 153/344 (44%), Gaps = 86/344 (25%)

Query: 163 SVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGI 221
           SVSWR +GI+Y KNE +LD+IE +   M+    +++  +I GE+  KS LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITF 281
           N                   +II  D           L   KFHQCV     +  K++ F
Sbjct: 282 N-------------------KIIYQDKQF--------LSSCKFHQCVMPDSVDEGKVLEF 314

Query: 282 IPPDGEFELMNYRLTT-----PIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNV 336
           +PPDG+F L  Y L       P+  LI  ++  ++  K ++++    ++  KK +    +
Sbjct: 315 VPPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNSTTKL 373

Query: 337 EILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGK-EYSMTAQLG 387
            I IP+         D +     +   G I +    + +LW++ +  GG  +  M A   
Sbjct: 374 NIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFA 433

Query: 388 LPSVD-----------GIEPPKVKRP--------------------------------VQ 404
           L + +            + PP ++                                  ++
Sbjct: 434 LFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIK 493

Query: 405 IKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYT 448
           + F+IPY T+SG++V YLKI EP LQY++FPWVRY T S D Y 
Sbjct: 494 MDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 78/142 (54%), Gaps = 14/142 (9%)

Query: 1   MVSGVYFCDASGKPILSRRYRD----DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIH 56
           M S +Y  +   + +LS+  +     DIPLS    F +   +H+    V  P ++Y+   
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLSL---FKKQFHKHQ----VTTPVIIYEDYI 53

Query: 57  YLFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDY--LKSVEEESIRDNFVIIYEL 114
           +  IQ   +Y V+ +   +TNI +   +L++   +L +Y  +K +++  I DN V I EL
Sbjct: 54  FTCIQRDTLYFVS-SIDCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 LDEMMDYGIPQITETKMLKQYI 136
           ++E +D+GI QIT++ ++K YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  129 bits (324), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 103/368 (27%), Positives = 162/368 (44%), Gaps = 110/368 (29%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE +LD+IE +  LM+ +  ++R  +I GE+  +S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE-------- 274
                              +I+N D           + +  FHQCV L            
Sbjct: 313 -------------------KILNRDPQF--------MSNSNFHQCVSLDSINTIEKGQEK 345

Query: 275 -----------NEKIITFIPPDGEFELMNYRLTTPIK--PLIWC-DINIQVH-SKSRIEI 319
                      + + I F+PPDGEF L  Y L   +K  P+I   D  I+    KS+I+I
Sbjct: 346 EQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQI 405

Query: 320 HCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWKL 371
             + +   K  +  + + + IP+         D +    FK ++G + +    + +LW++
Sbjct: 406 LTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEI 465

Query: 372 RSFAGGKE----------------YSMTAQLGLPSVD-----------GIEPPKVK---- 400
           ++  G +E                 SM A+  L + +            + PP ++    
Sbjct: 466 QTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPK 525

Query: 401 --------------------RPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYI 440
                               R V I F+IPY T SG++V YLK+ EP+LQY+SFPWVRY 
Sbjct: 526 LEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYK 585

Query: 441 TQSGDDYT 448
           T + ++Y 
Sbjct: 586 TVNDEEYA 593

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 70/145 (48%), Gaps = 12/145 (8%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60
           M S ++  D   +P++S+  R      A+   S +L   ++      P +L+Q   +   
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 61  QHSD----IYVVALTTSYQTNIAQIFMFLHQLVSVLGDY--LKSVEEESIRDNFVIIYEL 114
              D    + V+  T     ++  I  FL Q   +L  Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYIRVK 139

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  129 bits (324), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 102/368 (27%), Positives = 162/368 (44%), Gaps = 110/368 (29%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE +LD+IE +  LM+ +  ++R  +I GE+  +  LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE-------- 274
                              +I+N D+          L +  FHQCV L   +        
Sbjct: 320 -------------------KILNRDAQF--------LSNSSFHQCVSLDSIKTIEKREEK 352

Query: 275 -----------NEKIITFIPPDGEFELMNYRLTTPIK--PLIWC-DINIQVH-SKSRIEI 319
                      + K + F+PPDGEF L  Y L   +K  P+I   D  I+    K +I+I
Sbjct: 353 EDDDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQI 412

Query: 320 HCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWKL 371
             + +   K  +  + + + IP+         D +    FK + G + +    + +LW++
Sbjct: 413 ETKIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEI 472

Query: 372 RSFAGGKEY----------------SMTAQLGLPSVD-----------GIEPPKVK---- 400
           ++  G +E+                SM A+  L + +            + PP ++    
Sbjct: 473 QAMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPR 532

Query: 401 --------------------RPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYI 440
                               + V I F+IPY T SG+++ YLK+ EP+LQY+SFPWVRY 
Sbjct: 533 LEELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYK 592

Query: 441 TQSGDDYT 448
           T S D+Y 
Sbjct: 593 TTSDDEYA 600

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 54/99 (54%), Gaps = 5/99 (5%)

Query: 46  VPPCLLYQGIHYLFIQHSDIYVVAL---TTSYQTNIAQIFMFLHQLVSVLGDY--LKSVE 100
            PP L      ++ ++   ++ V++   T     ++  I  FL Q   +L +Y  +K + 
Sbjct: 41  APPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLT 100

Query: 101 EESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           ++ I DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 101 KDVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  127 bits (320), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 97/354 (27%), Positives = 157/354 (44%), Gaps = 97/354 (27%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE +L++IE +   M+    V++  +I GE++ K  LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE--NEKIIT 280
                              +I+N+D           L + KFHQCV L+  E  + K + 
Sbjct: 313 -------------------KIVNEDKQF--------LANCKFHQCVSLASLESSDHKDVE 345

Query: 281 FIPPDGEFELMNYRLTTPIK--PLIWCDINIQVH---------SKSRIEIHCRAKAQIKK 329
           F+PPDGEF L  Y L   ++  P++   +N +V              IE H +      K
Sbjct: 346 FVPPDGEFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKLLLTIETHFKTTNATSK 404

Query: 330 KSIANNVEILIP--VPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGK---EYSMTA 384
            ++   ++ L      D +     K   G+I +    + +LW++ S +GG    + SM  
Sbjct: 405 LALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGV 464

Query: 385 QLGLPSVD-----------GIEPP------------------------------------ 397
           +  L + +            + PP                                    
Sbjct: 465 EFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQP 524

Query: 398 ---KVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYT 448
              ++ + + + F++PY T+SG++V YLKI EP+L+Y+SFPWVRY T S  +Y 
Sbjct: 525 RTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 54/100 (54%), Gaps = 3/100 (3%)

Query: 43  SSVVPPCLLYQGIH-YLFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYL--KSV 99
            S  PP + Y  +  + +IQ   +  V++     T + +  ++L     VL +YL  K +
Sbjct: 38  GSNAPPVIDYHDLFTFTYIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVL 97

Query: 100 EEESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           ++  + DN V+I EL++E +D+G  Q+T++ +L  YI  K
Sbjct: 98  DKNIVTDNSVLISELIEETIDFGAIQVTDSGLLADYIKMK 137

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  124 bits (311), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 103/372 (27%), Positives = 159/372 (42%), Gaps = 114/372 (30%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE +LD+IE +  LM+ +  V+R  +I GE+  +  LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE-------- 274
                              +I+N D       S        FHQCV L            
Sbjct: 318 -------------------KILNRDPQFMSNSS--------FHQCVSLDSINTIEKDEEK 350

Query: 275 ------------NEKIITFIPPDGEFELMNYRLTTPIK--PLIWC-DINIQVH-SKSRIE 318
                       + + I FIPPDGEF L  Y L   +K  P++   D  I+    K +I+
Sbjct: 351 NSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQ 410

Query: 319 IHCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWK 370
           I  + +   K  +  + + + IP+         D +    FK + G + +    + +LW+
Sbjct: 411 IVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWE 470

Query: 371 LRSFAGGKEY-------------------SMTAQLGLPSVD-----------GIEPPKVK 400
           +++  G +E+                   SM A+  L + +            + PP ++
Sbjct: 471 IQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLR 530

Query: 401 ------------------------RPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPW 436
                                   + V I F+IPY T SG++V YLK+ EP+LQY+SFPW
Sbjct: 531 TGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPW 590

Query: 437 VRYITQSGDDYT 448
           VRY T S ++Y 
Sbjct: 591 VRYKTVSDEEYA 602

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 72/145 (49%), Gaps = 12/145 (8%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAI-DKFSQILLEHEEESSVVPPCLLYQGIHYLF 59
           M S ++  D + +P++S+  R    LS++   F Q   +        PP L      ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIRALPNLSSVLSSFKQCYHDGS------PPILSQNDWFFIH 54

Query: 60  IQHSDIYVVAL---TTSYQTNIAQIFMFLHQLVSVLGDY--LKSVEEESIRDNFVIIYEL 114
           ++   ++ V++   T     ++  I  FL Q   +L  Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYIRVK 139

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  122 bits (307), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 103/370 (27%), Positives = 159/370 (42%), Gaps = 113/370 (30%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE +LD+IE +  LM+ +  ++R  +I GE+  +  LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE-------- 274
                 K L  +  F                     + + KFHQCV L            
Sbjct: 312 ------KLLNRDPQF---------------------MSNSKFHQCVSLDSINIIEEEGRD 344

Query: 275 ----------NEKIITFIPPDGEFELMNYRLTTPIK--PLIWC---DINIQVHSKSRIEI 319
                     + K I FIPPDGEF L  Y L   +K  P+I     +I  ++  K +I+I
Sbjct: 345 TDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKL-KKFKIQI 403

Query: 320 HCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWKL 371
             + +   K  +  + + + IP+         D +    FK + G + +    + +LW++
Sbjct: 404 ITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEI 463

Query: 372 RSFAGGKE---------------YSMTAQLGLPSVD-----------GIEPPKVK----- 400
            +  G +E                SM A+  L + +            + PP ++     
Sbjct: 464 GTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKL 523

Query: 401 ----------------------RPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVR 438
                                 + V + F+IPY T SG++V YLK+ EP+LQY+SFPWVR
Sbjct: 524 EELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVR 583

Query: 439 YITQSGDDYT 448
           Y T S D+Y 
Sbjct: 584 YKTISDDEYA 593

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 71/145 (48%), Gaps = 12/145 (8%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAI-DKFSQILLEHEEESSVVPPCLLYQGIHYLF 59
           M S ++  D   +P++S+  R    LS+I   F Q    H +     PP L   G  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIRAIPNLSSILSSFKQCY--HRDS----PPILSQNGWFFIH 54

Query: 60  IQHSDIY---VVALTTSYQTNIAQIFMFLHQLVSVLGDY--LKSVEEESIRDNFVIIYEL 114
           ++   ++   V+  T     ++  I  FL Q   +L  Y  +  + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYIRVK 139

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  117 bits (293), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 114/487 (23%), Positives = 218/487 (44%), Gaps = 108/487 (22%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59
           M+S +      G+ I+S+ YR++I  S  + F  Q++      S ++   L     H++ 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPIL--TLGSTTFHHIR 58

Query: 60  IQHSD-----IYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYEL 114
              +D     +++V +  +   N A I+ FL +L  +L  Y     E  ++D F+ ++E+
Sbjct: 59  STANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQY-GITSESKLKDEFMTVHEI 116

Query: 115 LDEMM-DYGIPQITETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGI-- 171
           LD M+   GI Q T+   LK  + + S K              P++ TN  +  Q G   
Sbjct: 117 LDNMLLGTGIIQNTD---LKSIVDKMSVK--------------PISRTNETTSTQTGFLK 159

Query: 172 ----------------------KYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKS 209
                                  +KKNE +  + ES+N+L+++ G +L++ + G++++KS
Sbjct: 160 RRNTILTTPGANFSLIPTNRHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKS 219

Query: 210 RLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVR 269
            L+G P  +                       ++++D +         ++ D KF QC+ 
Sbjct: 220 HLNGNPTCQF----------------------ELVDDQT---------KITDFKFDQCIE 248

Query: 270 LSKFENEKIITFIPPDGEFELMNY-----RLTTPIK--PLIWCDINIQVHSKSRIEIHCR 322
             +    + +     DGE E++NY     ++  P K  P++          K  ++    
Sbjct: 249 KVQ---SRTVRVAATDGELEIVNYHVRDDKINIPFKITPIVST-------VKDTVDYRIS 298

Query: 323 AKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSM 382
            K+   K   A +V + IPVP +        S+G  K+  E+NA++W    F G  E ++
Sbjct: 299 LKSLFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTL 358

Query: 383 TAQLGLPSVDGIEPPKVK---RP-VQIKFQIPYFTTSGIQVRYLKINEP-KLQYKSFPWV 437
           +A   +   DG +   ++   RP +Q+ F+I  ++ SG+ +R L I +  K +YK+  W+
Sbjct: 359 SA---ITIADGRQIMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWI 415

Query: 438 RYITQSG 444
           +YI+++G
Sbjct: 416 KYISRAG 422

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 94.4 bits (233), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 118/242 (48%), Gaps = 46/242 (19%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE +LD++E    +M+ +  ++R  +I G++  +  LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFI 282
                 K L+ ++ F                     L  L+FHQCV L   +N K I FI
Sbjct: 347 ------KLLQKDQQF---------------------LSQLRFHQCVSLETIQN-KEIEFI 378

Query: 283 PPDGEFELMNYRLTTPIK-----PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVE 337
           PPDGEF L  Y L   +K      LI  +I  ++  K +I+I+       K ++  + + 
Sbjct: 379 PPDGEFILCEYELKRHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFKVQNSTSILN 437

Query: 338 ILIPVP--------DDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKE---YSMTAQL 386
           + IP+         D   +P FK + G +K+    + +LW++ S  GG      +MTA+ 
Sbjct: 438 LKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKAMTAEF 497

Query: 387 GL 388
            L
Sbjct: 498 FL 499

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%)

Query: 403 VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDY 447
           + + F+IPY+  SG++V YLKI E +L Y+SFPWVRY T +  DY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 78/146 (53%), Gaps = 13/146 (8%)

Query: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQIL---LEHEEESSVVPPCLLYQGIHY 57
           M+S ++  D + +P++S+  R      AI  F  I+    +H   ++   P +     ++
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQH-SDIYVVALT-TSYQTNIAQIFMFLHQLVSVLGDYLKS--VEEESIRDNFVIIYE 113
           + I+  S I++ A+    Y +++  + ++L +   +L  +LK+  +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDEMMDYGIPQITETKMLKQYITQK 139
           L+DE +D+GI Q+T+  ++K Y+  K
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/266 (28%), Positives = 114/266 (42%), Gaps = 68/266 (25%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEII-GEVKVKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE +LD+IE +   M+ +  ++R  +I GE+  K  LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKF--------- 273
                 K L+N+  F                     L +  FHQCV L            
Sbjct: 355 ------KILQNDSQF---------------------LSNAHFHQCVSLDSLHLQSAEDDD 387

Query: 274 --------ENE--------KIITFIPPDGEFELMNYRLTT-----PIKPLIWCDINIQVH 312
                   ENE        K I FIPPDG+F L  Y L       P+  L   DI  ++ 
Sbjct: 388 GDDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL- 446

Query: 313 SKSRIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPTFKYSHGSIKWLPEK 364
           SK +++IH   +   K  +  + + + IP+         D +    FK   G + +    
Sbjct: 447 SKYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSD 506

Query: 365 NAILWKLRSFAGGK-EYSMTAQLGLP 389
           N ++W++ S  GG  E +M+     P
Sbjct: 507 NFLIWEIGSMKGGHGEVTMSMMAEFP 532

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 38/46 (82%)

Query: 403 VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYT 448
           ++I F+IPY+T SG+++ YLKI EP+LQY+SFPWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 77/163 (47%), Gaps = 24/163 (14%)

Query: 1   MVSGVYFCDASGKPILSRRYRD-DIPLSAIDKFSQILLE-----HEEESSVVPPCLLYQ- 53
           M S ++  D + +PIL++  R        + KF +I  +     H  + S V P L    
Sbjct: 1   MSSCIFILDENLEPILNKNIRSIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLPILNTND 60

Query: 54  --------------GIHYLFIQH-SDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLK- 97
                         G  +L I+  S I+V  +  +   ++  IF +L +   +L  YL  
Sbjct: 61  YGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNV 120

Query: 98  -SVEEESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
             +++  + DNF+++ ELLDE +D+GI Q T++ ++K YI  K
Sbjct: 121 TKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 106/274 (38%), Gaps = 68/274 (24%)

Query: 54  GIHYLFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKS--VEEESIRDNFVII 111
           G+ Y  +Q ++I           N  + F+FL  + ++L  Y     ++   I  N+  +
Sbjct: 73  GLRYWCLQRTEI-----GEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDRV 127

Query: 112 YELLDEMMDYGIPQITETKMLKQYITQKS-FKLIXXXXXXXXXXXPPVALTN-------- 162
             L + M+D G P IT+   LK+ +  K+ F  +              A  N        
Sbjct: 128 TLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHSS 187

Query: 163 ---------------SVSWRQEGIKYKKNEAYLDIIESINMLM----NQQGQV-LRSEII 202
                          +V WR  G+KY  NE Y+D+ E++N+++    N    V +   I 
Sbjct: 188 NSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSID 247

Query: 203 GEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDL 262
           GEV  K  LS  P ++L +N  G          D   P                      
Sbjct: 248 GEVGFKCYLSENPLVELDLNTNG---------HDLGIPA--------------------- 277

Query: 263 KFHQCVRLSKFE-NEKIITFIPPDGEFELMNYRL 295
            FH+CVR    + +   + FIPPDG+F LM Y +
Sbjct: 278 -FHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/404 (21%), Positives = 155/404 (38%), Gaps = 69/404 (17%)

Query: 83  MFLHQLVSVLGDYL--KSVEEESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYI---- 136
           MFL Q   VL +Y   +++  + + +N   +  LL  M+D G   +T++  L+Q +    
Sbjct: 40  MFLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRN 99

Query: 137 --------TQKSFKLIXXXXXXXXXXXPPVA-----LTNSVSWRQEGIKYKKNEAYLDII 183
                     K+                PVA        +V WR    +Y  NE Y+D++
Sbjct: 100 DLSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLV 159

Query: 184 ESINMLMNQQGQVL---RSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240
           E++N  + Q+G  L      + G++ VK  LSG P ++L +                   
Sbjct: 160 ETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL------------------- 200

Query: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLT-TPI 299
                       + S   L++   H+CV L +      + F+PPDG F L  Y +  + I
Sbjct: 201 ------------RTSGHPLDNSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAIDLSAI 247

Query: 300 KPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANN---------VEILIPVPDDADTPT 350
                   N+ + + S      + + + + K I  N         + I +  PD +D   
Sbjct: 248 SQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQVAAIEDLRITVYFPDISDAAK 307

Query: 351 FK---YSHGSIKWLPEKNAILWKL-RSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIK 406
            K    +HG  +    +   +W   +  A G    +   +  P      PP     + + 
Sbjct: 308 IKILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVLRGCVENPESTPHAPPVFPSHLAVS 367

Query: 407 FQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450
           +       SGI+V  + +++     K F  V+Y +++G DY +R
Sbjct: 368 YSHVGQLPSGIRVDTIALSDLPPGSKPFKGVKYTSRAG-DYIVR 410

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 85/330 (25%), Positives = 129/330 (39%), Gaps = 97/330 (29%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLR----------SEIIGEVKVKSRLSG 213
           V WR  G+KY  NE Y+D+ ESI+++  + G+  R            I G+  VK  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKF 273
            P + L ++  G          D   P                       FH+CV L   
Sbjct: 271 NPTVDLQLDLAG---------NDLGVPA----------------------FHECVELDNH 299

Query: 274 ENEKI--ITFIPPDGEFELMNYR--LTTP----------IKPLIWCDINIQVHSKS-RIE 318
           +N     + FIPPDG F LM Y   L TP             L+  D   Q+ +K+   E
Sbjct: 300 QNPSNCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVTIDFADQLGNKTDEFE 359

Query: 319 I-----HCRAKAQIKKKSIANNVEILIPVPDDADT----PTFKYSHGSI---------KW 360
           I     + R  A I+   I  +V++     +D++T       + +HG            W
Sbjct: 360 ITVNISNSREVANIEDLRI--DVQLQSNTDEDSETDFKIKVLRNTHGRFDNSVVPGQGSW 417

Query: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPP--KVKRPVQIKFQIPYFTTSGIQ 418
           + +K+     L    G              V+  EP   +V+R V   + +     SGI+
Sbjct: 418 IFDKDTPTGTLPVLRG-------------CVESTEPRLLRVQR-VTASYSLSGQLASGIR 463

Query: 419 VRYLKINEPKLQYKS---FPWVRYITQSGD 445
           V+ + I +  L  KS   F  V+Y T++GD
Sbjct: 464 VKAINIGQ--LTTKSNRPFKGVKYATKTGD 491

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 122/314 (38%), Gaps = 65/314 (20%)

Query: 157 PVALTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQV-----LRSEIIGEVKVKSRL 211
           P A    V WR  G+KY  NE Y+D++E++++++ +  +      +R  + G V  +S L
Sbjct: 179 PAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHL 238

Query: 212 SGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLS 271
           SG P + L +  +G          D   P                        HQC   S
Sbjct: 239 SGNPVIALNLRLRG---------HDLGMPA----------------------LHQCCLDS 267

Query: 272 KFENEKIITFIPPDGEFELMNYRL---TTPIKPLIWCDINIQVHSKSRIEI-----HCRA 323
                  + F+PPDG+F+LM+Y +   +   K  ++ +I + V    R E+         
Sbjct: 268 YQGRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGL-VSPDYRTELGDLGDEFEV 326

Query: 324 KAQIKKKSIANNVEILI------PVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGG 377
              I     A  V+ L+      P+P +      + +HG  +     N   W        
Sbjct: 327 NLNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVF-----D 381

Query: 378 KEYSMTAQLGLPSVDGIEPPKVKRPVQ-IKFQIPYFTT----SGIQVRYLKI-NEPKLQY 431
           KE   T    LP + G      +  V+ ++  + Y       SGI+V  + I +      
Sbjct: 382 KE---TPTGTLPVLRGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNI 438

Query: 432 KSFPWVRYITQSGD 445
           K F  V+YI ++GD
Sbjct: 439 KPFKGVKYIAKTGD 452

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 70/150 (46%), Gaps = 47/150 (31%)

Query: 163 SVSWRQEGIKYKKNEAYLDIIESINMLM----------NQQGQVLRSEIIGEVKVKSRLS 212
           +V WR   + +  NE YLD++ESI++++          N   +++   IIG+  VKS L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 213 GMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRL-- 270
           G P +++ I+  G                   ND            LE +  H+CV+   
Sbjct: 261 GNPIVEMKIDMAG-------------------ND------------LESIFLHECVKSKD 289

Query: 271 ----SKFENEKIITFIPPDGEFELMNYRLT 296
                +FEN K+I F+PPDG F+L +Y + 
Sbjct: 290 VDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 36/137 (26%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQ---QGQVL--RSEIIGEVKVKSRLSGMPDLK 218
           V WR  G+KY  NE Y+D++E+I++++ +    GQ++  R  I G V  +S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKI 278
           L +N  G          D   P                        H C +     + + 
Sbjct: 246 LKLNLHG---------HDLGVPA----------------------LHPCCQAQYTGSPEN 274

Query: 279 ITFIPPDGEFELMNYRL 295
           + F+PPDG+F LM Y +
Sbjct: 275 LQFVPPDGKFRLMQYTI 291

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 130/318 (40%), Gaps = 67/318 (21%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLM------NQQGQVLRSEIIGEVKVKSRLSGMPDL 217
           V WR + IK  +NE Y+D+ E++ + +      + + ++L   I G V V S + G+P L
Sbjct: 173 VPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPML 232

Query: 218 KLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDL--KFHQCVRLSKF-- 273
           ++                                      + +D+  KFH CV +++F  
Sbjct: 233 EVSF---------------------------------GGCDFKDIIPKFHDCVEVNEFLT 259

Query: 274 ENEKIITFIPPDGEFELMNYR--LTTPIKPLIWCDI-NIQVHSKSRIEIHCRAKAQIKKK 330
            +  II FIPPDG+F+LM Y   L++    LI C+  N   +S    EI        K  
Sbjct: 260 NDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEITLNINKSNKVP 319

Query: 331 SIANNVEILIPVPDDADTPTFK--------YSHGSIKWLPEKNAILWKLRSFAGG-KEYS 381
            I NN+++ +   +       K        + +G   W+ +   +   L    G  +E +
Sbjct: 320 KI-NNLQVCLNFENREGQSKVKILRNTHGRFEYGKNTWIFDSELLTGTLPVLRGCVEEET 378

Query: 382 MTAQLGLPSVDGIEPPKVKRP--------VQIKFQIPYFT-TSGIQVRYLKINEPKLQYK 432
              + G    +G       RP         Q + Q+P  T  S I +R    + P+ Q +
Sbjct: 379 KNEEDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQRQ-Q 437

Query: 433 SFPWVRYITQSGDDYTIR 450
            F  V+Y+T++  +Y IR
Sbjct: 438 LFKGVKYVTKTS-NYEIR 454

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 64/145 (44%), Gaps = 37/145 (25%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINML-----MNQQGQVLRSEIIGEVKVKSRLSGMPDLK 218
           V WR   +KY  +E Y+DIIE+++++      N   Q++   I G+V VKS LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 219 LGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKI 278
           + ++  G                                E+     HQCV + +  +   
Sbjct: 252 MDMDLAG-------------------------------NEMYAPSMHQCVEMPQ-GSPSS 279

Query: 279 ITFIPPDGEFELMNYRLTTPIKPLI 303
           + FIPPDG   L+NY +   + P +
Sbjct: 280 LCFIPPDGNCNLLNYTIDLDMNPKV 304

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 76/154 (49%), Gaps = 37/154 (24%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQG------------------QVLRSEIIGEV 205
           V WR   +KY  NE Y+D+IE I+++  ++                   +++R++IIGE+
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFH 265
            V+S LS  P +++ + D+     Y + +  +S+             K+ N+ L    FH
Sbjct: 316 NVRSYLSDNPMVEVTLVDR----NYSDQKTGWSENDLF---------KQLNLGLP--MFH 360

Query: 266 QCVRLS--KFENE--KIITFIPPDGEFELMNYRL 295
            CV +   K  N+  + I FIPPDG+F LM Y +
Sbjct: 361 DCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 134/326 (41%), Gaps = 84/326 (25%)

Query: 162 NSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMP--DLKL 219
           + V WR  GI Y  NE ++D+ E IN ++ ++G++L   I G + + + LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE--NEK 277
           G+ D                             K S++   +  FH+C+   K    N+ 
Sbjct: 267 GLLDH----------------------------KLSHL---NTTFHRCILEDKANSINDL 295

Query: 278 I------ITFIPPDGEFELMNYRLTTPI----KPLIWCDINIQVHSKSRI---EIHCRAK 324
           I      +TF+PPDG   L  Y  T P+      L   D+N+Q     R+   E+     
Sbjct: 296 IAGKFTKLTFVPPDGRTRLCQY--TLPLVKRDSNLGIIDVNLQSSLGKRLDEFEVRVTVG 353

Query: 325 AQIKKKSIAN---------NVEILIPVPDDADTPT-FKYSHGSIKWLPEKNAILWK---L 371
                K I N         N + ++ V  +         + G + W  +KN +      L
Sbjct: 354 MSTTVKEIENMSMTIRMNRNFKGIVRVMRNTHGGVETNMTRGEVNWHLDKNMVCGSMAVL 413

Query: 372 RSFA--------GGKEYSMTAQLGLPS---VDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420
           R  A          +  S ++ +  PS      ++P  +K   + K Q+P    SGI+++
Sbjct: 414 RCIAELEPELASNDQTSSRSSVVQPPSSHLTSLLQPSFIKCYYEHKSQLP----SGIKLQ 469

Query: 421 YLKI--NEPKLQYKSFPWVRYITQSG 444
            + +    PK   K F  V+Y+T++G
Sbjct: 470 SIDVVNGGPK---KPFKGVKYLTKTG 492

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 51/151 (33%)

Query: 166 WRQEGIKYKKNEAYLDIIESINML----MNQQGQVLRSE----------IIGEVKVKSRL 211
           WR + +K+  NE Y+D++ES++++    + +  ++ RS+          + G   V+S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLS 271
           +G P ++L +   G          D   P                       FH+CV + 
Sbjct: 263 NGNPLVELQLELSG---------NDIGHP----------------------SFHECVDID 291

Query: 272 KF----ENEKI--ITFIPPDGEFELMNYRLT 296
           ++    +N  I  + FIPPDG+F LM+Y +T
Sbjct: 292 EYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 72/334 (21%), Positives = 122/334 (36%), Gaps = 96/334 (28%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLM---------------NQQGQVLRSEIIGEVKVK 208
           V WR+ GIK  K E Y+D+ E + +                 N   +++   I G + V+
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 209 SRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCV 268
             L+G P + L  +  G          D   P                       FH CV
Sbjct: 249 CYLNGNPTVSLMFDTMG---------NDLGIP----------------------SFHACV 277

Query: 269 RLS-------------KFENEKIITFIPPDGEFELMNYRLT----TPIKPLIWCDINIQV 311
                            F+ ++++ F+PPDG+F L  Y +       +   +  D  IQV
Sbjct: 278 EQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQV 337

Query: 312 H-------SKSRIEIHCRAKAQIKKKSIANNVEILIPV-----PDDADTPTFKYSHGSIK 359
                   +K   E+    +  I   ++ + VE L+        +D++    + +HG+  
Sbjct: 338 SFEDGLGLNKDEFEVRLHVRESI---AVVDPVEDLVVTLQFSNGNDSNVKMLRATHGTFV 394

Query: 360 WLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDG-IEPPK----VKR----PVQIKFQIP 410
              E     W+  S     E S      LP + G I+  K     KR     V +++  P
Sbjct: 395 GQDEDRQCSWRFDS----DEISAGT---LPVLRGCIDDSKHVQQKKRSCLTSVAVRYGYP 447

Query: 411 YFTTSGIQVRYLKIN--EPKLQYKSFPWVRYITQ 442
               SG +V  L ++   P+++ K F  VR +T+
Sbjct: 448 GELASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHY 57
           +V  V     SGKP+LSR++RD   D  +  +  F  ++     E + V      + + Y
Sbjct: 2   VVLAVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFVEE----EHVRY 57

Query: 58  LFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           ++I   D Y++ L T+ Q+NI Q    L+     +   LK   EE + ++   I    DE
Sbjct: 58  IYIPFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  +++ +S
Sbjct: 117 IISLGYKESLSLSQINTFLSMES 139

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 64/136 (47%), Gaps = 10/136 (7%)

Query: 11  SGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHS-DIY 66
           SGKP+LSR++R+   D  L  +  F  ++     E + V      +G H  ++    D Y
Sbjct: 12  SGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFV------EGNHVRYVYRPFDDY 65

Query: 67  VVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYGIPQI 126
            + L T+ Q+NI +    L+ L   + + L S +E  I D+   I    DE++  G  + 
Sbjct: 66  YIILITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKEN 125

Query: 127 TETKMLKQYITQKSFK 142
             +  +  Y+T +S +
Sbjct: 126 LSSTQVTTYLTMESHE 141

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 39/139 (28%)

Query: 164 VSWR-QEGIKYKKNEAYLDIIESINMLMNQQGQVLR---SEIIGEVKVKSRLSGMPDLKL 219
           V WR  +  K++ NE Y+D++E+ +++   +   LR     I G V V+S L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKI- 278
            +N  G          D   P                        H+CV + K + E + 
Sbjct: 259 KLNTMG---------NDIGVPT----------------------LHECVEI-KDDGEFLP 286

Query: 279 --ITFIPPDGEFELMNYRL 295
             ITFIPPDG+F L+ Y +
Sbjct: 287 SNITFIPPDGKFRLLEYSV 305

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHY 57
           +V  V      GKP+LSR++RD   D  +  +  F  ++    ++ + V      + + Y
Sbjct: 2   VVLAVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFVED----EHVRY 57

Query: 58  LFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           ++    D Y++ L T+  +NI Q    L+  V  +   LK + EE + D+   I    DE
Sbjct: 58  VYKPFDDYYII-LITNLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +K ++  +S
Sbjct: 117 IITMGYKENLSLTQIKTFLAMES 139

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 62/139 (44%), Gaps = 39/139 (28%)

Query: 164 VSWRQEGI-KYKKNEAYLDIIESINMLMNQQGQVLR---SEIIGEVKVKSRLSGMPDLKL 219
           V WR     K++ NE Y+D++E+ ++++ ++   LR    +I G V V+S L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLS---KFENE 276
            +N  G          +   P                        H+CV ++   +F   
Sbjct: 259 KLNTMG---------NEIGIP----------------------SLHECVEINDDGEFTPS 287

Query: 277 KIITFIPPDGEFELMNYRL 295
            I TFIPPDG+F L+ Y +
Sbjct: 288 NI-TFIPPDGKFRLLEYSI 305

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHY 57
           +V  V     SGKP++SR+++D   D  +  +  F  ++     + + V      + + Y
Sbjct: 2   VVLAVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFVEE----EHVRY 57

Query: 58  LFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           ++    D Y++ L T+ Q+NI Q    L+     +  +LK   E+ I DN   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  +++ +S
Sbjct: 117 IISLGCKENLSLSQINTFLSMES 139

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 11  SGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYV 67
           +GKP+LSR++ D   D  +  +  F  ++ +   E + V      + + YL+    D Y+
Sbjct: 12  NGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYKPFDDYYL 67

Query: 68  VALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYGIPQIT 127
           + + T+ Q+NI Q    L      +  YL S +E  I +N   I    DE++  G  +  
Sbjct: 68  I-IITNRQSNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIVMGYKENL 126

Query: 128 ETKMLKQYITQKSFK 142
               ++ Y+T +S +
Sbjct: 127 TMAQVETYLTMESHE 141

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 63/143 (44%), Gaps = 8/143 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHY 57
           +V  V      GKP+LSR++RD   D     +  F  ++ +   + + V      + + Y
Sbjct: 98  VVIAVSIVTRQGKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRY 153

Query: 58  LFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           ++    D Y++ L T+ Q+NI Q    L      +  YL S +E  I +N   I    DE
Sbjct: 154 VYKPFDDYYII-LITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDE 212

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  Y++ +S
Sbjct: 213 VITMGYKENLSISQINTYLSMES 235

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 82/197 (41%), Gaps = 17/197 (8%)

Query: 11  SGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHS-DIY 66
           +GKP+LSR++R+   +  +  +  F  ++      S++       +  H  ++    D Y
Sbjct: 12  NGKPLLSRQFRELTKERTMELLSNFQGLV------SNISSDHTFLEDEHVRYVYRPFDNY 65

Query: 67  VVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYGIPQI 126
            + L T+ Q+NI Q    L+   S +  YL S +E  I DN   I    DE++  G  + 
Sbjct: 66  YIILITNRQSNIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVTMGYKEN 125

Query: 127 TETKMLKQYITQKSFKLIXXXXXXXXXXXPPVALTNSVSWRQEGIKYKKNEAYLDI---- 182
                ++ Y+  +S +               +  T     R + I  K+ E  L I    
Sbjct: 126 LSISQVETYLAMESHE---ERIQEIIERNKEIEATEERKRRAKEIARKEQERKLGIYGGE 182

Query: 183 IESINMLMNQQGQVLRS 199
            E+ N++ N Q + + S
Sbjct: 183 FETANLVANSQNRFMAS 199

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 64/143 (44%), Gaps = 8/143 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHY 57
           +V  V     SGKP+LSR++RD   D     +  F  ++     + + V      + + Y
Sbjct: 2   VVLAVSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVANSSSQHTFVED----EHVRY 57

Query: 58  LFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           ++    D Y++ L T+ Q+NI Q    L+     +   L+S +E  I +N   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  +++ +S
Sbjct: 117 IIAMGYKENLSLTQINNFLSMES 139

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 58/136 (42%), Gaps = 37/136 (27%)

Query: 164 VSWR-QEGIKYKKNEAYLDIIESINMLMNQQGQVLR---SEIIGEVKVKSRLSGMPDLKL 219
           V WR     K++ NE YLD++E+ +++  ++   +R     I G + V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFE--NEK 277
            +N  G          D   P                        H+CV ++     +  
Sbjct: 259 KLNTMG---------NDIGIP----------------------SLHECVEINDGGVFSPS 287

Query: 278 IITFIPPDGEFELMNY 293
            ITFIPPDG+F L+ Y
Sbjct: 288 NITFIPPDGKFRLLEY 303

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 44/141 (31%)

Query: 164 VSWR-QEGIKYKKNEAYLDIIESINMLMNQQGQVLR---SEIIGEVKVKSRLSGMPDLKL 219
           V WR     K++ NE Y+D++E+ +++  ++   LR     I G V V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKI- 278
            +N  G          D   P                        H CV +    N+ + 
Sbjct: 259 KLNTMG---------NDIGIP----------------------SLHDCVEI----NDGVF 283

Query: 279 ----ITFIPPDGEFELMNYRL 295
               ITFIPPDG+F L+ Y +
Sbjct: 284 SPSNITFIPPDGKFRLLEYSV 304

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 11  SGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYV 67
           +GKP+LSR++R+   D  +  +  F  ++     + + V      + + Y++    D Y+
Sbjct: 12  NGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFVED----EHVRYVYKPFDDYYI 67

Query: 68  VALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYGIPQIT 127
           + L T+ Q+NI Q    L+     +  YL S +E  + DN   I    DE++  G  +  
Sbjct: 68  I-LITNRQSNIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVVMGYKENL 126

Query: 128 ETKMLKQYITQKSFK 142
               +  Y++ +S +
Sbjct: 127 TAAQVSTYLSMESHE 141

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 63/143 (44%), Gaps = 8/143 (5%)

Query: 1   MVSGVYFCDASGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHY 57
           +V  V      GKP+LSR++R+   D     +  F  ++ +   + + V      + + Y
Sbjct: 2   VVIAVSIVTRQGKPLLSRQFREISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRY 57

Query: 58  LFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDE 117
           ++    D Y++ L T+ Q+NI Q    L      +  YL S +E  I +N   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  Y++ +S
Sbjct: 117 VITMGYKENLSMTQINTYLSMES 139

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 61/160 (38%), Gaps = 61/160 (38%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESI-----NMLMNQQGQ-------------------VLRS 199
           V WR   IK  KNE Y+D+ E I     N + N++G+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIEL 259
            I G + V+S L+G P +++ +N  G          D   P                   
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCG---------NDMGTP------------------- 350

Query: 260 EDLKFHQCVRLS---KFENEKI---ITFIPPDGEFELMNY 293
                H CV L      +++K+   + FIPPDG+F L  Y
Sbjct: 351 ---SLHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 12  GKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYVV 68
           GKP+LSR++RD   D  +  +  F  ++     + + V      + + Y++    D Y++
Sbjct: 13  GKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTFVED----EHVRYVYKPFDDYYII 68

Query: 69  ALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYG 122
            L T+ Q+NI Q    L+     +   L + +E  I DN   I    DE++  G
Sbjct: 69  -LITNRQSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDEIVVMG 121

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYVV 68
           GKP+LSR+++D   D  L  +  F  ++ E   + + V      + + Y++    + Y++
Sbjct: 66  GKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFVED----KHVRYVYRPFDNYYII 121

Query: 69  ALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYG 122
            L T+ Q+NI +    L+     +  YL S +++ I  N   I    DE++  G
Sbjct: 122 -LITNRQSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 174

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 62/135 (45%), Gaps = 8/135 (5%)

Query: 11  SGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYV 67
           +GKP+LSR++R+   D  L  +  F  ++     + + V      + + Y++    D Y+
Sbjct: 12  TGKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFVED----EHVRYVYRPFDDYYI 67

Query: 68  VALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYGIPQIT 127
           + L T+ Q+NI      L+     +  YL S +E  I +N   I    DE++  G  +  
Sbjct: 68  I-LITNRQSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVVMGYKENL 126

Query: 128 ETKMLKQYITQKSFK 142
               +  Y++ +S +
Sbjct: 127 SITQVNTYLSLESHE 141

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 56/137 (40%), Gaps = 36/137 (26%)

Query: 164 VSWRQEGIKYKKNEAYLDIIESINMLMNQQG----QVLRSEIIGEVKVKSRLSGMPDLKL 219
           V WR   +    NE Y+D++E++ + + Q       V    I G++ +K  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVR-LSKFENEKI 278
            ++  G           F KP  +                     H+C+   S   +   
Sbjct: 255 NLHSAG---------HAF-KPSAL---------------------HRCLDPSSSSFDSSS 283

Query: 279 ITFIPPDGEFELMNYRL 295
           + FIPPDG+F L+ Y +
Sbjct: 284 LRFIPPDGKFTLLEYTI 300

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYVV 68
           GKP+LSR+++D   D  L  +  F  ++ E   + + V      + + Y++    + Y++
Sbjct: 13  GKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYRPFDNYYII 68

Query: 69  ALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYG 122
            L T+ Q+NI +    L+     +  YL S +++ I  N   I    DE++  G
Sbjct: 69  -LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYVV 68
           GKP+LSR+++D   D  L  +  F  ++ E   + + V      + + Y++    + Y++
Sbjct: 13  GKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYRPFDNYYII 68

Query: 69  ALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYG 122
            L T+ Q+NI +    L+     +  YL S +++ I  N   I    DE++  G
Sbjct: 69  -LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 60/154 (38%), Gaps = 54/154 (35%)

Query: 166 WRQ-EGIKYKKNEAYLDIIESINMLMNQQ-----------------GQV--LRSEIIGEV 205
           WR  + I   +NE Y D+ E I ++  ++                 G +  +R  I G V
Sbjct: 227 WRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGSV 286

Query: 206 KVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFH 265
            ++  L+G P +++ +   G+         D   P                       FH
Sbjct: 287 DMRCFLTGNPLVEIALKQGGL---------DIGIP----------------------GFH 315

Query: 266 QCV-RLSKFENEKI--ITFIPPDGEFELMNYRLT 296
            CV + S  + EKI  ++FIPPDG F LM Y + 
Sbjct: 316 DCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 8/114 (7%)

Query: 12  GKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYVV 68
           GKP+LSR+++D   D  L  +  F  ++ E   + + V      + + Y++    + Y++
Sbjct: 13  GKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVED----KHVRYVYRPFDNYYII 68

Query: 69  ALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYG 122
            L T+ Q+NI +    L+     +  YL S  ++ I  N   I    DE++  G
Sbjct: 69  -LITNRQSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDEIVSMG 121

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 62/133 (46%), Gaps = 8/133 (6%)

Query: 11  SGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYV 67
           +GKP+LSR++ +   D  +  +  F  ++     + + V      + + Y++    D Y+
Sbjct: 12  NGKPLLSRQFVEMSKDRVMELLSNFQGLVANISSDHTYVED----EHVRYVYKPFDDYYL 67

Query: 68  VALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYGIPQIT 127
           + L T+ Q+NI Q    L+     +  YL S +E  I +N   I    DE++  G  +  
Sbjct: 68  I-LMTNRQSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEIIVMGHKENL 126

Query: 128 ETKMLKQYITQKS 140
             + +  YI+ +S
Sbjct: 127 TIQQVNNYISMES 139

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 60/133 (45%), Gaps = 8/133 (6%)

Query: 11  SGKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYV 67
           SGKP+LSR++ +   D  +  +  F  ++     + + V      + + Y++    D Y+
Sbjct: 12  SGKPLLSRQFTEITKDRVMELLSNFQGLVANISSDHTYVES----EHVRYVYKPFDDYYL 67

Query: 68  VALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYGIPQIT 127
           + L T+ Q+NI Q    L+     +  YL S +E  I +N   I    DE++  G  +  
Sbjct: 68  I-LVTNRQSNIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSSFDEIIVMGNKEDL 126

Query: 128 ETKMLKQYITQKS 140
               +  Y+  +S
Sbjct: 127 TISQVNTYLAMES 139

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 61/132 (46%), Gaps = 8/132 (6%)

Query: 12  GKPILSRRYRD---DIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFIQHSDIYVV 68
           GKP+LSR++++   +  +  +  F  ++ +   + + V      + + Y++    D Y++
Sbjct: 13  GKPLLSRQFKELTKERVIELLSNFQGLVSKSSSDHTYVED----EHVRYVYRPFDDYYLI 68

Query: 69  ALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMDYGIPQITE 128
            L T+ Q+NI Q    L+     +  YL S +EE I  N   I    DE++  G  +   
Sbjct: 69  -LVTNRQSNIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEIIVMGNKENLT 127

Query: 129 TKMLKQYITQKS 140
              +  Y+  +S
Sbjct: 128 VSQVNTYLAMES 139

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 256 NIELEDLKFHQCVRLSKF----ENEKIITFIPPDGEFELMNYRLT 296
             +L     H CV L        +   + FIPPDG+F LM Y +T
Sbjct: 279 GCDLGTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
          YFR051C
          Length = 543

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 1  MVSGVYFCDASGKPILSRRYRD---DIPLSAIDKFSQIL-LEHEEESSVVPPCLLYQGIH 56
          +V       ++GKP+LSR+++D   D  L  +  F  ++ L+H    + V        + 
Sbjct: 2  VVLAASITTSNGKPLLSRQFKDLSRDRVLELLSNFQNLVSLKHSSNHTFVED----DHVR 57

Query: 57 YLFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKS 98
          Y++    D Y++ L T+ Q+NI Q    L+     +  +L +
Sbjct: 58 YVYKPFDDFYII-LITNRQSNIVQDLSTLNLFSQTINAFLNN 98

>AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR170C (APS1)
          Length = 156

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 2/91 (2%)

Query: 52  YQGIHYLFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVII 111
           YQ    ++ +++ ++ V   +  + N       +H+ V  +  Y  +V E  I  NF   
Sbjct: 54  YQDHKVVYKRYASLFFVCGISPEEDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFTRA 113

Query: 112 YELLDE--MMDYGIPQITETKMLKQYITQKS 140
           Y +LDE  M D    + ++T +LK   T  S
Sbjct: 114 YNILDELIMCDGSFVESSKTDVLKNMATMDS 144

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 46/95 (48%), Gaps = 2/95 (2%)

Query: 50  LLYQGIHYLFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFV 109
           L YQ    ++ +++ +Y +   +S   N       +H+ V  +  Y  +V E  I  NF 
Sbjct: 52  LEYQDHKVVYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFT 111

Query: 110 IIYELLDEMM--DYGIPQITETKMLKQYITQKSFK 142
             YE+L+E++  D  + + ++  +L+  +T  S +
Sbjct: 112 KAYEILNEVLVCDGSMTETSKQAILRSVMTMDSLE 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,295,771
Number of extensions: 2241521
Number of successful extensions: 6733
Number of sequences better than 10.0: 122
Number of HSP's gapped: 6727
Number of HSP's successfully gapped: 175
Length of query: 450
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 337
Effective length of database: 40,524,141
Effective search space: 13656635517
Effective search space used: 13656635517
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)