Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.315.432ON51341922450.0
KAFR0E039205.432ON49742416430.0
Skud_15.2825.432ON48542016280.0
TPHA0E017805.432ON50842016230.0
YOR119C (RIO1)5.432ON48442016190.0
KLLA0E21121g5.432ON52642816070.0
Suva_8.1725.432ON48642016010.0
TBLA0A037605.432ON50442116010.0
CAGL0L11594g5.432ON50741616000.0
NCAS0F033605.432ON50942815930.0
SAKL0G02486g5.432ON50042615910.0
Smik_15.2975.432ON48642015890.0
AER257W5.432ON47742415650.0
KLTH0F16104g5.432ON54040415500.0
KNAG0C049305.432ON49642315320.0
Kwal_55.214335.432ON47642815150.0
NDAI0B056505.432ON46238915000.0
TDEL0E019305.432ON50241614960.0
Ecym_47635.432ON53842414960.0
ZYRO0F09988g5.432ON46041713780.0
CAGL0H08019g2.44ON425271980.002
NCAS0G015802.44ON424331980.002
TPHA0H009202.44ON429262960.004
KNAG0F010602.44ON428156930.008
Kpol_400.72.44ON425189910.017
ZYRO0C10340g2.44ON416152850.071
NDAI0F036002.44ON421154840.12
Kwal_23.45632.44ON425260810.22
KLTH0B07722g2.44ON428261800.32
KLLA0F15576g5.200ON51251732.1
Ecym_11191.104ON79149742.3
KNAG0I027706.350ON83760689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.31
         (513 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   869   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   637   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   631   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   629   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   628   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   623   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   621   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   621   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   620   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   618   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   617   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   616   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   607   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   601   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   594   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   588   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   582   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   580   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   580   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   535   0.0  
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    42   0.002
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      42   0.002
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    42   0.004
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    40   0.008
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    40   0.017
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    37   0.071
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    37   0.12 
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    36   0.22 
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    35   0.32 
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    33   2.1  
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    33   2.3  
KNAG0I02770 Chr9 (543571..546084) [2514 bp, 837 aa] {ON} Anc_6.3...    31   9.6  

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/419 (100%), Positives = 419/419 (100%)

Query: 1   MSFDEKFDRLKISGNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRTM 60
           MSFDEKFDRLKISGNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRTM
Sbjct: 1   MSFDEKFDRLKISGNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRTM 60

Query: 61  RFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDS 120
           RFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDS
Sbjct: 61  RFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDS 120

Query: 121 EEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHN 180
           EEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHN
Sbjct: 121 EEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHN 180

Query: 181 PRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYK 240
           PRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYK
Sbjct: 181 PRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYK 240

Query: 241 DRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMSLD 300
           DRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMSLD
Sbjct: 241 DRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMSLD 300

Query: 301 FLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPIKS 360
           FLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPIKS
Sbjct: 301 FLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPIKS 360

Query: 361 TDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQYGM 419
           TDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQYGM
Sbjct: 361 TDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQYGM 419

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/424 (72%), Positives = 361/424 (85%), Gaps = 17/424 (4%)

Query: 1   MSFDEKFDRLKISG-----NDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVL 55
           MS ++KFD LKISG     + +N +IL+KYGHKIKT+E S ++GKTNKDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 56  DPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVE 115
           DPRTM+FL+AL +RGVIS+F+GCLSTGKEANVYHAFAG G  +      V++ + +    
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 116 VNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNS 175
               ++ED  +N+             + R+EYAIKIYKTSILVFKDRERYVDGE+RFRN+
Sbjct: 121 SELSAQEDKDENS------------TDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNA 168

Query: 176 RSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLK 235
           RSQHNPRKMIKIWAEKEFRNL+RI+QS VIPAPKP+E+K+NVLVMEFLNRG+GFASPRLK
Sbjct: 169 RSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLK 228

Query: 236 DYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEH 295
           D+PYKDR+EIF YYH LVAY+RLLYQVC LVHADLSEYNT+VHQG+LY+IDVSQSVEPEH
Sbjct: 229 DHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEH 288

Query: 296 PMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNN 355
           PMSLDFLRMDIKNVN YFEKMGIDIFPERIIFQFVISE L+ F GD  S+DDLR++V+ N
Sbjct: 289 PMSLDFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQN 348

Query: 356 LPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASE 415
           LPIK+T +DEAEDE+FRSL+LVRNL GLEERDFDR+T+G+FDLLK+L+A DN+KNF ASE
Sbjct: 349 LPIKATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEKNFAASE 408

Query: 416 QYGM 419
           QY +
Sbjct: 409 QYEL 412

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/420 (73%), Positives = 351/420 (83%), Gaps = 31/420 (7%)

Query: 1   MSFDEKFDRLKIS---GNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDP 57
           MS +++FDRL +S    + +N ++LEKY HKIKTDELSF+K KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 58  RTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVN 117
           RTMRFLK++ NRGVI+  NGCLSTGKEANVYHAFAG G +                    
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPV------------------ 102

Query: 118 QDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177
              +E+ G    V + DG       LRKEYAIKIYKTSILVFKDRERYVDGE+RFRNSRS
Sbjct: 103 --IDEETG-QYEVLETDG-------LRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRS 152

Query: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237
           QHNPRKMIKIWAEKEFRNL+RIHQSGVIPAP+PVEVK+NVLVMEFL+RGNGFASP+L+DY
Sbjct: 153 QHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDY 212

Query: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297
           PY+DR+EIF YYH +VAYMRLLYQVCRLVHADLSEYNTI+H  KLYMIDVSQSVEPEHPM
Sbjct: 213 PYRDREEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPM 272

Query: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357
           SLDFLRMDIKNVN YFEKMG+ IFPER+IFQFVISE LE FKGD ++  DL  ++  NLP
Sbjct: 273 SLDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLP 332

Query: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQY 417
           IKST++DEAEDE+FRSLHLVR+LGGLEERDFDR+TDGKFDLLK+LIA DN++NF ASEQ+
Sbjct: 333 IKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQF 392

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/420 (75%), Positives = 356/420 (84%), Gaps = 9/420 (2%)

Query: 1   MSFDEKFDRLKISGND-VNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRT 59
           MS + KFD+LK+  ++ +N++ILEKYGHKIKTDELS TKGKTNKDKANRATVENVLDPRT
Sbjct: 1   MSLEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPRT 60

Query: 60  MRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQD 119
           M+ LK L NRGVI  FNGCLSTGKEANVYHAFAGDG    N +V    L +++ +E   +
Sbjct: 61  MKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEV----LPQISELEDVLN 116

Query: 120 SEEDNGDNNNVADIDGSKPEGVEL--RKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177
            E   G    V  I  S+ E  +L  RKEYAIKIYKTSILVFKDRERYVDGE+RFRN+RS
Sbjct: 117 KELIPG-QIEVPTI-KSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARS 174

Query: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237
           QHNPRKMIKIWAEKEFRNLRRI QSG+IPAP+PVEVK N+LVMEFL RG+GFASPRL+D+
Sbjct: 175 QHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDH 234

Query: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297
            YK R+EI +YYH LVAY+RLLYQVCRLVHADLSEYNTIVH  KLY+IDVSQSVEPEHPM
Sbjct: 235 QYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPM 294

Query: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357
           SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVIS +L+ F GD  S+ DLR ++ + LP
Sbjct: 295 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLP 354

Query: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQY 417
           +K TDEDE +DE+FRSLHLVRNL GLEERDFDRFTDGKFDLLKTLIASDNQKNFTAS Q+
Sbjct: 355 VKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASTQF 414

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/420 (73%), Positives = 348/420 (82%), Gaps = 31/420 (7%)

Query: 1   MSFDEKFDRLKIS---GNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDP 57
           MS ++KFD L +S    + +N ++LEKY HKIKTDELSF++ KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 58  RTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVN 117
           RTMRFLK++  RGVI+  NGCLSTGKEANVYHAFAG G +                    
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPV------------------ 102

Query: 118 QDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177
              +E+ G    V + DGS       R EYAIKIYKTSILVFKDRERYVDGE+RFRNSRS
Sbjct: 103 --IDEETG-QYEVLETDGS-------RAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRS 152

Query: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237
           QHNPRKMIKIWAEKEFRNL+RI+QSGVIPAPKP+EVK+NVLVMEFL+RGNGFASP+LKDY
Sbjct: 153 QHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDY 212

Query: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297
           PYK+RDEIF YYH +VAYMRLLYQVCRLVHADLSEYNTIVH  KLYMIDVSQSVEPEHPM
Sbjct: 213 PYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPM 272

Query: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357
           SLDFLRMDIKNVN YFEKMGI IFPER+IFQFVISE LE FKGD N+   L  ++ +NLP
Sbjct: 273 SLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLP 332

Query: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQY 417
           IKST++DEAEDE+FRSLHLVR+LGGLEERDFDR+TDGKFDLLK+LIA DN++NF ASEQ+
Sbjct: 333 IKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQF 392

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/428 (70%), Positives = 359/428 (83%), Gaps = 18/428 (4%)

Query: 1   MSFDEKFDRLKISGND--VNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPR 58
           M+ D+K ++L ++  D  VNT+ILE+Y + IKTDELS T+GKT+KDKANRATVENVLDPR
Sbjct: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61

Query: 59  TMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDG------TSSRNTDVKVEDLVKLT 112
           TMRFLK++ NRG++SAFNGCLSTGKEANVYHAFAG+           +  +     ++ T
Sbjct: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121

Query: 113 SVEVNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRF 172
             +      ED    +   D    +P+    +KEYA+KIYKTSILVFKDRERYVDGE+RF
Sbjct: 122 KQKALTAESEDATSTSTATD----EPKN---KKEYAVKIYKTSILVFKDRERYVDGEFRF 174

Query: 173 RNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASP 232
           RNSRSQHNPRKMIKIWAEKEFRNL+RI+QSGVIP PKP+EV+SNVLVMEFLNRG+GFASP
Sbjct: 175 RNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASP 234

Query: 233 RLKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVE 292
           RLKD+PYKDR+EI  YY++++AYMRLLYQVCRLVHADLSEYN+IVH+ KLY+IDVSQSV+
Sbjct: 235 RLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQ 294

Query: 293 PEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFV 352
           PEHPMSLDFLRMDIKNVN YF+K+GIDIFPER+IFQF+ISE L+ FKGD  S+DDL  +V
Sbjct: 295 PEHPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYV 354

Query: 353 KNNLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQK--- 409
            +NLP+K TDEDEAEDEVFRSLHL+RNLGGLEERDFDRFTDGKFDLLK+LIA++N+K   
Sbjct: 355 ADNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSE 414

Query: 410 NFTASEQY 417
           NFTASEQY
Sbjct: 415 NFTASEQY 422

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/420 (72%), Positives = 351/420 (83%), Gaps = 31/420 (7%)

Query: 1   MSFDEKFDRLKIS---GNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDP 57
           MSF++KF++L +S    + +N ++L+K+ HKIKTDELSF+K KT+KDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 58  RTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVN 117
           RTMRFLK++ NRGVI+  NGCLSTGKEANVYHAFAG G +                    
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPV------------------ 102

Query: 118 QDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177
              +E+ G    V + DG       LR EYAIKIYKTSILVFKDRE+YVDGE+RFRN+RS
Sbjct: 103 --VDEETG-KYEVLETDG-------LRAEYAIKIYKTSILVFKDREKYVDGEFRFRNARS 152

Query: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237
           QHNPRKMIKIWAEKEFRNL+RIHQSGVIPAPKPVEVK+NVLVMEFL+RG+GFASP+LKDY
Sbjct: 153 QHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDY 212

Query: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297
           PYKDR+EIF YY+ +VAYMRLLYQVCRLVHADLSEYNTI+H  +LYMIDVSQSVEPEHPM
Sbjct: 213 PYKDREEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPM 272

Query: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357
           SLDFLRMDIKNVN YFEKMGI+IFPER+IFQFVISE LE FKGD  +  DL  ++  NLP
Sbjct: 273 SLDFLRMDIKNVNLYFEKMGINIFPERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLP 332

Query: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQY 417
           IKST++DEAEDE+FRSLHLVR+LGGLEERDFDR+TDGKFDLLK+LIA DN++NF ASEQ+
Sbjct: 333 IKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQF 392

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/421 (72%), Positives = 348/421 (82%), Gaps = 18/421 (4%)

Query: 1   MSFDEKFDRLKISGNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRTM 60
           M  D+ F +L +S N  N RIL+K+GHKIKTDE S ++GKTNKDKANRATVENVLDPRTM
Sbjct: 1   MVLDDDFQKLDLSNNHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDPRTM 60

Query: 61  RFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSS--RNTDVKVEDLVKLTSVEVNQ 118
           RFLKALT+RG+IS FNGC+STGKEANVYHAFAGD  S     T    E+LV       N 
Sbjct: 61  RFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLV-------NT 113

Query: 119 DSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ 178
                N +NN+           +E RKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ
Sbjct: 114 YDPYSNPNNNDTI---------LEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ 164

Query: 179 HNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYP 238
           HNPRKMIKIWAEKEFRNL+RI+QS VIP PKP+EVK+NVLVMEFLNRG+GFASPRLKDYP
Sbjct: 165 HNPRKMIKIWAEKEFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYP 224

Query: 239 YKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMS 298
           YKD ++I  YYH ++ Y+RLLYQVCRLVHADLSEYNT+VH+ KLY+IDVSQSVEPEHPMS
Sbjct: 225 YKDHNDIVHYYHTMIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMS 284

Query: 299 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPI 358
           LDFLRMDIKN+N YFE+MG+ IF ERIIFQF ISE L+ F G+ ++ DDLR +VKNNLP+
Sbjct: 285 LDFLRMDIKNINNYFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPL 344

Query: 359 KSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQYG 418
           K   +D+AEDE+FRSLHLVRNLGGLEERDFDR+TDGKFDLLK+LIA DN+KNF+ASEQY 
Sbjct: 345 KVPGKDDAEDEIFRSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEKNFSASEQYN 404

Query: 419 M 419
            
Sbjct: 405 F 405

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/416 (72%), Positives = 352/416 (84%), Gaps = 12/416 (2%)

Query: 3   FDEKFDRLKISGNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRTMRF 62
             +KF  +K+S + +N +I++KYGHKIKTDELS  K KTNKDKANRATVENVLDPRTMRF
Sbjct: 4   LSDKFRNVKVSTDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRTMRF 63

Query: 63  LKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSS-RNTDVKVEDLVKLTSVEVNQDSE 121
           L AL NRGVI+  NGCLSTGKEANVYHAFAG   ++ + +D   ED      ++ N    
Sbjct: 64  LNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKED------IDANAIPS 117

Query: 122 EDNGDNNNVADIDGSKPEGV--ELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQH 179
           + N D   +++      E +  E RKEYAIKIYKTSIL+FKDRERYVDGE+RFRNSRSQH
Sbjct: 118 KGNID---ISENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQH 174

Query: 180 NPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPY 239
           NPRKMIKIWAEKEFRNL+RI+Q GVIP+P+P+EVK+NVLVMEFLNRG+GFASP+L+DYPY
Sbjct: 175 NPRKMIKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPY 234

Query: 240 KDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMSL 299
           KDR+EI++YYHILV+YMRLLYQVCRLVHADLSEYNTIVH+ KLYMIDVSQSVEPEHPMSL
Sbjct: 235 KDREEIYYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSL 294

Query: 300 DFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPIK 359
           DFLRMDIKNVN YFEKMGI+IF E+ IFQFVI++ L+ F GD+NS +DLR++V  N+PIK
Sbjct: 295 DFLRMDIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIK 354

Query: 360 STDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASE 415
            T EDEAEDEVFRSLHLVRNL GLEERDFDRFTDGKFDLLK+L+A DN+KN+ A++
Sbjct: 355 RTQEDEAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAAQ 410

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/428 (70%), Positives = 359/428 (83%), Gaps = 9/428 (2%)

Query: 1   MSFDEKFDRLKISGN----DVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLD 56
           MS ++KFDRL IS        N +IL+KY HK KTDE+SFT+ KTNKDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 57  PRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEV 116
           PRTMRFLKALT+RGVIS FNGCLSTGKEANVYHAFAGD     +  ++ ++       E 
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 117 NQDSEEDNGDNNNVADIDGS-KPEGV----ELRKEYAIKIYKTSILVFKDRERYVDGEYR 171
            +D ++   D+N    ++   +PE +    + +KEYA+KI+KTSILVFKDRERYVDGE+R
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180

Query: 172 FRNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFAS 231
           FRNSRSQHNPRKMIKIWAEKEFRNLRRI+QSGVIP PKP+EVK+NVLVMEFL RG+GFAS
Sbjct: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240

Query: 232 PRLKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSV 291
           PRLKD+PYKDR+EIF YYH +VAYMRL+YQ+CRLVHADLSEYN ++H+ K+Y+IDVSQSV
Sbjct: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300

Query: 292 EPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREF 351
           EPEHPMSLDFLRMDIKN+N YFEKMGIDIFPER+IFQF+IS+ LE F GD    +DLR++
Sbjct: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360

Query: 352 VKNNLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNF 411
           V  NLPIK +++DEAEDE+FRSL+LVRNL GLEERDFDR+TDGKFDLLK+LIA DN+KNF
Sbjct: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEKNF 420

Query: 412 TASEQYGM 419
           +A+EQ+ +
Sbjct: 421 SAAEQFDL 428

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/426 (72%), Positives = 347/426 (81%), Gaps = 41/426 (9%)

Query: 1   MSFDEKFDRLKI-SGND-----VNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENV 54
           MS +  F +L +  G D     VN+RIL+KY H+IKTDELS T+GKTNKDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 55  LDPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSV 114
           LDPRTMRFL+ L +RGV+S  NGCLSTGKEANVYHAFAG+                    
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNA------------------- 101

Query: 115 EVNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRN 174
             NQ SEE   D         SK E V  ++EYA+KIYKTSILVFKDRERYVDGE+RFRN
Sbjct: 102 --NQPSEEAEKD---------SKDELV--KREYAVKIYKTSILVFKDRERYVDGEFRFRN 148

Query: 175 SRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRL 234
           SRSQHNPRKMIKIWAEKEFRNL+RIHQSGVIP P+P+EV+SNVLVMEFLNRGNGFASPRL
Sbjct: 149 SRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRL 208

Query: 235 KDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPE 294
           KD+PYKDR+EI +YYH +VAYMRLLYQVC+LVHADLSEYNTIVH  +LYMIDVSQSV+PE
Sbjct: 209 KDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPE 268

Query: 295 HPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKN 354
           HPMSLDFLRMDIKN+N YFEK GIDIFPER+IFQF+ISE L+ F+GD ++  DLR++V  
Sbjct: 269 HPMSLDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSK 328

Query: 355 NLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQK---NF 411
           NLP+KST EDEAEDEVFRSLHLVRNL GLEERDFDRFTDGKFDLLK+LIA DN+K   NF
Sbjct: 329 NLPLKSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNATNF 388

Query: 412 TASEQY 417
            ASEQ+
Sbjct: 389 NASEQF 394

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/420 (71%), Positives = 346/420 (82%), Gaps = 31/420 (7%)

Query: 1   MSFDEKFDRLKIS---GNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDP 57
           MS ++ FD+L +S    + +N ++LEKY HKIKTDELSF + KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 58  RTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVN 117
           RTMRFLK++ NRGVI+  NGCLSTGKEANVYHAFAG G +                    
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPV------------------ 102

Query: 118 QDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 177
              +E+ G    V + DG +PE       YAIKIYKTSILVFKDRERYVDGE+RFRNSRS
Sbjct: 103 --IDEETG-KYEVLETDGPRPE-------YAIKIYKTSILVFKDRERYVDGEFRFRNSRS 152

Query: 178 QHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDY 237
           QHNPRKMIKIWAEKEFRNL+RI+QSGVIPAPKP+EVK+NVLVMEFL+RGNGFASP+LKDY
Sbjct: 153 QHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDY 212

Query: 238 PYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPM 297
           PY+DR EIF YY+ +VAYMRLLYQVCRLVHADLSEYNTI+H  KL+MIDVSQSVEPEHPM
Sbjct: 213 PYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPM 272

Query: 298 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLP 357
           SLDFLRMDIKNVN YFEKMGI IFPER+IFQFVISE LE FK D ++  DL  ++  NLP
Sbjct: 273 SLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLP 332

Query: 358 IKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQY 417
           IKST++DEAEDE+FRSLHLVR+LGGLEERDFDR+TDGKFDLLK+LIA DN++NF ASEQ+
Sbjct: 333 IKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQF 392

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/424 (69%), Positives = 339/424 (79%), Gaps = 48/424 (11%)

Query: 1   MSFDEKFDRLKI--SGNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPR 58
           M  +++  +LK+    +  NTRILEK+ ++IKTDELS TKGKTNKDKANRATVENVLDPR
Sbjct: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60

Query: 59  TMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQ 118
           TMRFL+AL NRGV+S FNGCLSTGKEANVYHA +G                         
Sbjct: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG------------------------- 95

Query: 119 DSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ 178
                               EG   + EYA+KIYKTSILVFKDRERYVDGE+RFRN+RS 
Sbjct: 96  ------------------ATEGAPEKSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSH 137

Query: 179 HNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYP 238
           HNPRKMIKIWAEKEFRNL+RI+QSGVIP P+PVE+KSNVLVMEFLNRG+GFASPRLKDYP
Sbjct: 138 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYP 197

Query: 239 YKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMS 298
           +KDRDEI+ YYH++V+Y+RLLYQVC+LVHADLSEYN+IVHQ KLY+IDVSQSV+PEHPMS
Sbjct: 198 FKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMS 257

Query: 299 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPI 358
           LDFLRMDIKN+N YFE+MGIDIFPER+IFQFVISE L+ F+GD+ SA+DLR +V  NLP 
Sbjct: 258 LDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPR 317

Query: 359 KSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTASE 415
           K T +DEAED+VFRSLHLVRNLGGLEERDFDRFTDGKFDLLK+LIA DN K    FTASE
Sbjct: 318 KQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASE 377

Query: 416 QYGM 419
           QY +
Sbjct: 378 QYDL 381

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/404 (73%), Positives = 332/404 (82%), Gaps = 35/404 (8%)

Query: 17  VNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRTMRFLKALTNRGVISAFN 76
           +NT+IL+K+ H IKTDELS T+ KT+KDKANRATVENVLDPRTMRFL+AL +RGVIS FN
Sbjct: 75  INTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENVLDPRTMRFLQALKSRGVISEFN 134

Query: 77  GCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDSEEDNGDNNNVADIDGS 136
           GCLSTGKEANVYHAFAG G  S                     SEE+     N  +    
Sbjct: 135 GCLSTGKEANVYHAFAGYGAKS---------------------SEEEQKVLPNQGE---- 169

Query: 137 KPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKEFRNL 196
                  R+EYAIKIYKTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEKEFRNL
Sbjct: 170 -------RREYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 222

Query: 197 RRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDRDEIFWYYHILVAYM 256
           +RI+QSGV+PAP+P+EVKSNVLVMEFLNRG+GFASP+LKD+PYKDRDE  +YYH +VAY+
Sbjct: 223 KRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYI 282

Query: 257 RLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKM 316
           RLLYQ C+LVHADLSEYNTIVH  KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+M
Sbjct: 283 RLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERM 342

Query: 317 GIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPIKSTDEDEAEDEVFRSLHL 376
            IDIFPER IFQFVIS+KLE F+G+  +A+DLR++V   L  KS  EDEAEDEVFRSLHL
Sbjct: 343 SIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHL 402

Query: 377 VRNLGGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTASEQY 417
           VRNLGGLEERDFDRFT GKFDLLK+LIA DNQK   NFTASEQY
Sbjct: 403 VRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY 446

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 342/423 (80%), Gaps = 26/423 (6%)

Query: 1   MSFDEKFDRLKI----SGNDVNTRILEKYGHKIKTDELSFTK-GKTNKDKANRATVENVL 55
           MS +EKF++L I      +  N ++L+KY HKIK D+ SF+K  KT KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 56  DPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVED--LVKLTS 113
           DPRTMRFL+AL NRG+IS FNGCLSTGKEANVYHAFAGDG S  +  +  E+  L +LT 
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120

Query: 114 VEVNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFR 173
            E               A + G        +KEYAIKI+KTSILVFKDRERYVDGE+RFR
Sbjct: 121 EERAVQ-----------ASVGG--------KKEYAIKIFKTSILVFKDRERYVDGEFRFR 161

Query: 174 NSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPR 233
           NSRSQHNPRKMIKIWAEKEFRNL+RI+QSG +P PKPVEVK+NVLVMEFLNRG+GFASPR
Sbjct: 162 NSRSQHNPRKMIKIWAEKEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPR 221

Query: 234 LKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEP 293
           L+DYPYKD D I  YY  LVAYMRL+YQVC LVHADLSEYN +VH  +LY+IDVSQSV+P
Sbjct: 222 LRDYPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQP 281

Query: 294 EHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVK 353
           EHPMSLDFLRMDIKNVN YF KMGIDIFPERIIFQFVISE L+ F+GD  S+ DL E+V+
Sbjct: 282 EHPMSLDFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVE 341

Query: 354 NNLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTA 413
           +NLP+K T++DE EDEVFRSL+LVRNL GLEERDFDRFT+GKFDLLK+L+A D +KNFTA
Sbjct: 342 SNLPVKKTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEKNFTA 401

Query: 414 SEQ 416
           +EQ
Sbjct: 402 AEQ 404

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/428 (67%), Positives = 341/428 (79%), Gaps = 41/428 (9%)

Query: 1   MSFDEKFDRLKISGN------DVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENV 54
           MS  ++ D L++  N       +NT+IL+K+ H IK DELS ++GKT+KDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 55  LDPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSV 114
           LDPRTMRFL+ALT+RGVIS FNGC+STGKEANVYHAFA  G  ++NT+   E L  L   
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIG--AKNTEEAGEVLPNL--- 115

Query: 115 EVNQDSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRN 174
                                      E R+E AIKI+KTSILVFKDRERYVDGE+RFRN
Sbjct: 116 ---------------------------EERRELAIKIFKTSILVFKDRERYVDGEFRFRN 148

Query: 175 SRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRL 234
           SRSQHNPRKMIKIWAEKEFRNL+RI+QSG++PAP+PVEV+SNVLVMEFL+RGNGFASPRL
Sbjct: 149 SRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRL 208

Query: 235 KDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPE 294
           KDYPYKDR+E   YY+ +VAY+RLLYQ C+LVHADLSEYN IVH  +LY+IDVSQSV+PE
Sbjct: 209 KDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPE 268

Query: 295 HPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKN 354
           HPMSLDFLRMDIKNVN YFE+M +D+FPER+IFQFVISE L+ F GD  S+ DLR++V  
Sbjct: 269 HPMSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSK 328

Query: 355 NLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQK---NF 411
           NLP+KS  +DEAEDEVFRSLHLVRNLGGLEERDFDRFT GKFDLLK+LIA DN++    F
Sbjct: 329 NLPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTF 388

Query: 412 TASEQYGM 419
           TASEQ+ +
Sbjct: 389 TASEQFEL 396

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/389 (71%), Positives = 329/389 (84%), Gaps = 19/389 (4%)

Query: 34  LSFTKGKTNKDKANRATVENVLDPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAG 93
           +SFTKGKTNKDKANRATVENVLDPRTM+FLKALT+RGVIS FNGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 94  DGTSSRNTDVKVEDLVKLTSVEVNQDSEEDNGDNNNVADIDGSK--PEGVEL---RKEYA 148
           D               KL S + ++  +++N D   + +   ++  PE   L   +KEYA
Sbjct: 61  DS--------------KLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYA 106

Query: 149 IKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAP 208
           +KI+KTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEKEFRNLRRI+QS VIP P
Sbjct: 107 VKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVP 166

Query: 209 KPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHA 268
           KP+EVK+NVL+MEFLNRG+GFASPRL+DYPYKDR+E+  YYHI +AYMRL+YQVCRLVHA
Sbjct: 167 KPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHA 226

Query: 269 DLSEYNTIVHQGKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQ 328
           DLSEYN ++H   +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N YF++MGIDIFPER+IFQ
Sbjct: 227 DLSEYNILIHNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQ 286

Query: 329 FVISEKLETFKGDLNSADDLREFVKNNLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDF 388
           F+ISE L+ F G+ N  +DLR++V   LPIK T +DEAEDE+FRSL+LVRNL GLEERDF
Sbjct: 287 FIISETLDKFTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDF 346

Query: 389 DRFTDGKFDLLKTLIASDNQKNFTASEQY 417
           DR+TDGKFDLLK+LIA DN+KNF+A+EQ+
Sbjct: 347 DRYTDGKFDLLKSLIAHDNEKNFSAAEQF 375

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/416 (70%), Positives = 332/416 (79%), Gaps = 38/416 (9%)

Query: 1   MSFDEKFDRLKISGN--DVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPR 58
           MS +++FDRL IS      N +IL+K+ + IKTDELSFT+ K++KDKANRATVENVLDPR
Sbjct: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60

Query: 59  TMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQ 118
           TMRFLK++ NRGVIS FNGCLSTGKEANVYHAFAG+                        
Sbjct: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGE------------------------ 96

Query: 119 DSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ 178
            S ED+ D +    + G K       KE AIKIYKTSILVFKDRERYVDGE+RFRNSRSQ
Sbjct: 97  -SIEDSKDGH----VQGEK-------KELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 144

Query: 179 HNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYP 238
           HNPRKMIKIWAEKEFRNLRRI+QSGVIPAPKPVEVK+NVLVMEFL+RG+GFASPRLKD+ 
Sbjct: 145 HNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHL 204

Query: 239 YKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMS 298
           + DR EI+ YYH ++AY+RLLYQVCRLVHADLSEYN IVH  KLY+IDVSQSVEPEHPMS
Sbjct: 205 FADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMS 264

Query: 299 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPI 358
           LDFLRMDIKN+N YFEKMGIDIFPER+IFQFVISE LE F G+  S+ DL  +V   LP+
Sbjct: 265 LDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPV 324

Query: 359 KSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTAS 414
           KST  D  EDE+FRSLHLVRNL GLEERDFDRFTDGKFDLLK+LIA DN+++  A+
Sbjct: 325 KSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERHLRAA 380

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/424 (66%), Positives = 337/424 (79%), Gaps = 29/424 (6%)

Query: 1   MSFDEKFDRLKI--SGNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPR 58
           M  + K  RLK+       N+RIL+K+ ++IKTDELS T+GKT+KDKANRATVENVLDPR
Sbjct: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92

Query: 59  TMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQ 118
           TMRFL++L +RG+I+ FNGCLSTGKEANVYHAF               D+V+     + Q
Sbjct: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGN-----------AVDIVEKQHKVIRQ 141

Query: 119 DSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ 178
            S               S  EG   + EYAIKIYKTSILVFKDRERYVDGE+RFRNSRSQ
Sbjct: 142 SS-------------ICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 188

Query: 179 HNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYP 238
           HNPRKMIKIWAEKEFRNL+RI+ +GVI  PKP+E+KSNVLVMEFLNRG+GFASP+LKDYP
Sbjct: 189 HNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYP 248

Query: 239 YKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMS 298
           Y DR EI+++YH++VAY+RLLYQVC+LVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMS
Sbjct: 249 YSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMS 308

Query: 299 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPI 358
           LDFLRMDIKN+N YF K+GI++F ER IFQFVISEKLE FKGD  S D L+++    LP+
Sbjct: 309 LDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPL 368

Query: 359 KSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQ---KNFTASE 415
           K T+EDE EDE+FRSLHLVRNLGGLEE DFDRFT+GKFDLLK+L++ DNQ   K FTASE
Sbjct: 369 KLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASE 428

Query: 416 QYGM 419
           Q+ +
Sbjct: 429 QFEL 432

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/417 (64%), Positives = 312/417 (74%), Gaps = 50/417 (11%)

Query: 1   MSFDEKFDRLKISGNDVNTRILEKYGHKIKTDELSFTKG-KTNKDKANRATVENVLDPRT 59
           MS + +FDRL +S +  NTRILEKY ++I+    +  KG KT KDK++RATVENVLDPRT
Sbjct: 1   MSLETEFDRLHVSKHQDNTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLDPRT 60

Query: 60  MRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQD 119
           M+FL ALTNRGVIS FNGC+S+GKEANVYHAF                            
Sbjct: 61  MKFLSALTNRGVISEFNGCISSGKEANVYHAFG--------------------------- 93

Query: 120 SEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQH 179
                             PEG EL    AIKIYKTSILVFKDRERYVDGE+RFRNSRSQH
Sbjct: 94  ------------------PEGQEL----AIKIYKTSILVFKDRERYVDGEFRFRNSRSQH 131

Query: 180 NPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPY 239
           NPRKMIKIWAEKEFRNLRRIH SGV+P   PVEVKSNVLVM+FLNRG+G  SPRLKDY Y
Sbjct: 132 NPRKMIKIWAEKEFRNLRRIHSSGVVPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQY 191

Query: 240 KDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMSL 299
           KD  E+  YY+  +AYMRLLYQVCRLVHADLSEYN +VHQ  L++IDVSQSVEP HPMSL
Sbjct: 192 KDELEVAHYYYKAIAYMRLLYQVCRLVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSL 251

Query: 300 DFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPIK 359
           DFLRMDIKN+N YF KMG+ +F ER+IFQF+I+E LE F+GD  +ADDL E++  +LP+K
Sbjct: 252 DFLRMDIKNINAYFGKMGVSLFQERMIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLK 311

Query: 360 STDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQKNFTASEQ 416
           +  E   EDE+FRSLHLVR+LGGLEERDFDRFTDGKFDLLK+LIA+DN++N    +Q
Sbjct: 312 TPTEGADEDEIFRSLHLVRSLGGLEERDFDRFTDGKFDLLKSLIANDNERNLQRPQQ 368

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/271 (20%), Positives = 104/271 (38%), Gaps = 72/271 (26%)

Query: 63  LKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDSEE 122
           L+ L N+ V+ +    +  GKE+++Y        S RN   KV  + +L           
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQ------VSDRNGTAKVMKIHRLG---------- 128

Query: 123 DNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPR 182
                                         +TS    K+   Y+      RNSR   N  
Sbjct: 129 ------------------------------RTSFHTVKNNRDYL------RNSRQGTNWM 152

Query: 183 KMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDR 242
            + K+ A KEF  +  ++  G I  P+      +V+VM+ +   +G+   RL+++     
Sbjct: 153 HLSKLAASKEFEFMSMLYAKGFI-VPQAYGCSRHVVVMDLI---DGYPMRRLREHK---- 204

Query: 243 DEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGK---------LYMIDVSQSVEP 293
             I   Y  L+ ++  L     L+H D +E+N ++   +           +ID  Q +  
Sbjct: 205 -NIPKLYSDLMTFIVKLAN-SGLIHCDFNEFNIMIKNDEAVTDEKDCGFVVIDFPQCISI 262

Query: 294 EHPMSLDFLRMDIKNVNGYF-EKMGIDIFPE 323
           +H  +  + + D+  +  +F +K+  D  PE
Sbjct: 263 QHKDAEFYFKRDVDCIRRFFKKKLKYDPQPE 293

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/331 (19%), Positives = 125/331 (37%), Gaps = 87/331 (26%)

Query: 63  LKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDSEE 122
           LK + NR  I +  G +  GKE+++Y   A DG                           
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDG--------------------------- 117

Query: 123 DNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPR 182
               N  V  I                ++ +TS    ++   Y+      RN++   N  
Sbjct: 118 ----NPRVMKIH---------------RLGRTSFHTVRNNRDYL------RNTKQGVNWM 152

Query: 183 KMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDR 242
            + ++ A KE++ +  ++  G    P+P +   +++VME +    G+   RL+ +     
Sbjct: 153 YLSRLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIVMELI---KGYPMRRLRKHK---- 204

Query: 243 DEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIV-------HQGKLYMIDVSQSVEPEH 295
             I   Y  L+ ++  L     L+H D +E+N ++       +     +ID  Q +  +H
Sbjct: 205 -NIPKLYSDLMNFIVKLGN-SGLIHCDFNEFNIMIKDKPEDENDCGFVVIDFPQCISIQH 262

Query: 296 PMSLDFLRMDIKNVNGYFEK------------MGIDIFPERIIFQFVISEKLETFKGDLN 343
             +  + + D+  +  +F+K            +  D F E   + + + E+      D+ 
Sbjct: 263 QDAAYYFQRDVDCIRRFFKKKLKYEPKSDSSMLDTDGFGEGYKYAYPVFER------DIK 316

Query: 344 SADDLREFVKNNLPIKSTDEDEAEDEVFRSL 374
             D+L E V+ +   K    D + +E   S+
Sbjct: 317 RCDNLDELVQASGFSKKHPGDRSLEEAVESM 347

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/262 (19%), Positives = 103/262 (39%), Gaps = 73/262 (27%)

Query: 63  LKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDSEE 122
           LK+L N+  + +  G +  GKE+++Y        S +N + +V  + +L           
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEG------SDKNGNKRVLKIHRLG---------- 128

Query: 123 DNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPR 182
                                         +TS    K+   Y+      R S    N  
Sbjct: 129 ------------------------------RTSFHTVKNNRDYL------RRSNQGTNWM 152

Query: 183 KMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDR 242
            + K+ A KE++ +  ++  G    P+P +   +V+VME +    G+   RL+   +KD 
Sbjct: 153 NLSKLAANKEYQFMSLLYTKG-FKVPEPFDNSRHVIVMELIR---GYPMRRLR--KHKDI 206

Query: 243 DEIFWYYHILVAYMRLLYQVCR--LVHADLSEYNTIV-------HQGKLYMIDVSQSVEP 293
            +++         M+ + Q+    L+H D +E+N ++       +     +ID  Q +  
Sbjct: 207 PKLY------SDLMKFILQLANSGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISI 260

Query: 294 EHPMSLDFLRMDIKNVNGYFEK 315
           +H  +  + + D+  +  +F+K
Sbjct: 261 QHKDADFYFKRDVDGIRRFFKK 282

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 72/156 (46%), Gaps = 19/156 (12%)

Query: 169 EYRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNG 228
           +Y  +NS++  N   + K+ A KE++ +  +H  G    P+P +   ++++ME +    G
Sbjct: 140 DYLRKNSKNGANWMFLSKLAAAKEYQFMSLLHSRG-FRVPEPFDHSRHIIIMELI---KG 195

Query: 229 FASPRLKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIV---------HQ 279
           F   RL+ +       +   Y  L+ ++  L     L+H D +E+N ++         + 
Sbjct: 196 FPMTRLRKH-----QNVPKLYSDLMKFILELGN-SGLIHCDFNEFNIMIKDKLDGSDPND 249

Query: 280 GKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEK 315
               +ID  Q +  +H  +  + + D+  +  +F+K
Sbjct: 250 TGFIVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 82/189 (43%), Gaps = 35/189 (18%)

Query: 184 MIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDRD 243
           + ++ A KE++ +  ++  G    PK  +   +++VME +    GF   RL+ +     D
Sbjct: 154 LSRVAANKEYQFMSLLYSKG-FTVPKAFDNSRHIVVMELIK---GFPLRRLRKH-----D 204

Query: 244 EIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGK-------LYMIDVSQSVEPEHP 296
            I   Y  L+ ++  L     L+H D +E+N ++   K         +ID  Q +  +H 
Sbjct: 205 NIPKLYSDLMCFIVNLAN-SGLIHCDFNEFNIMIKDEKDDENDCGFIVIDFPQCISIQHK 263

Query: 297 MSLDFLRMDIKNVNGYFEK------------MGIDIFPERIIFQFVISEKLETFKGDLNS 344
            +  + + D+  +  +F+K            + +D F +   +Q+ +      F  D+  
Sbjct: 264 DADFYFKRDVDCIRRFFKKKLKYEPQSDSTMLDLDGFGDGYKYQYPV------FSRDVER 317

Query: 345 ADDLREFVK 353
            D+L E V+
Sbjct: 318 TDNLDELVQ 326

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 67/152 (44%), Gaps = 18/152 (11%)

Query: 172 FRNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFAS 231
            ++SR   +   +  + A KE+  L  +H  G    P+  +   ++++MEF+    GF  
Sbjct: 142 LKHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEAFDNSRHMVLMEFIK---GFPM 197

Query: 232 PRLKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIV--------HQGKLY 283
             L+ +       I   Y  L+ +   L +   L+H D +E+N ++              
Sbjct: 198 KNLRTHS-----NIPKLYSDLMKFAVDLAK-SGLIHCDYNEFNIMIKDQDTTDSSDCGFV 251

Query: 284 MIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEK 315
           +ID  Q +  +HP +  F R DI+ +  +F+K
Sbjct: 252 VIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/154 (19%), Positives = 73/154 (47%), Gaps = 17/154 (11%)

Query: 169 EYRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNG 228
           +Y  +N ++  N   + ++ A KE++ +  ++  G    P+P +   ++++M  +    G
Sbjct: 140 DYLKKNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIIMGLIE---G 195

Query: 229 FASPRLKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIV-------HQGK 281
           +   RL+ +     + I   Y+ L+ ++  L     L+H D +E+N ++       +   
Sbjct: 196 YPMRRLRKH-----NNIPKLYNDLMKFIVRLAN-SGLIHCDFNEFNIMIKDEVEDENDCG 249

Query: 282 LYMIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEK 315
             +ID  Q +  +HP +  + + D+  +  +F+K
Sbjct: 250 FVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 46/260 (17%), Positives = 100/260 (38%), Gaps = 70/260 (26%)

Query: 63  LKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDSEE 122
           LKA+ NR  + +    +  GKE++VY   A DGT  R   +        T+V+ N+D  +
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSAKDGT-PRVLKIHRLGRTSFTTVKNNRDYLK 143

Query: 123 DNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPR 182
            N                                           G + F          
Sbjct: 144 RNQ-----------------------------------------SGSWMF---------- 152

Query: 183 KMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDR 242
            + ++ A KE++ +  ++  G +  P+P +   ++++M+ +   +G+   R++ +     
Sbjct: 153 -LSRLAANKEYQFMSLLYSKGFV-VPEPFDNSRHMILMQLI---DGYPMRRMRSHK---- 203

Query: 243 DEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQ-------GKLYMIDVSQSVEPEH 295
             +   Y  L++++  L     L+H D +E+N ++             +ID  Q +  +H
Sbjct: 204 -NLPKLYSDLMSFIVKLANHG-LIHCDFNEFNIMIKNKVTDADDCGFIVIDFPQCISIQH 261

Query: 296 PMSLDFLRMDIKNVNGYFEK 315
             + ++ + D+  +  +F K
Sbjct: 262 QDAEEYFKRDVDCIRRFFAK 281

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 50/261 (19%), Positives = 100/261 (38%), Gaps = 72/261 (27%)

Query: 63  LKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDSEE 122
           L+A+ +R  I +    +  GKE++VY   A DG S+R   +        T+V+ N+D  +
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRVSAKDG-SARVLKIHRLGRTSFTTVKNNRDYLK 143

Query: 123 DNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPR 182
            N                                           G + F          
Sbjct: 144 RNQS-----------------------------------------GSWMF---------- 152

Query: 183 KMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRL-KDYPYKD 241
            + ++ A KE++ +  +H  G    P+P +   ++++ME ++ G    + RL K+ P   
Sbjct: 153 -LSRLAANKEYQFMSLLHSKG-FTVPEPFDNSRHMILMELID-GYPMRNMRLHKNLPK-- 207

Query: 242 RDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQG-------KLYMIDVSQSVEPE 294
                 Y  +++  ++L      L+H D +E+N ++             +ID  Q +  +
Sbjct: 208 -----LYSDLMLFIVKLANH--GLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQ 260

Query: 295 HPMSLDFLRMDIKNVNGYFEK 315
           H  +  F + D+  +  +F+K
Sbjct: 261 HQDAEFFFKRDVDCIRRFFKK 281

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 156 ILVFKDRE-RYVDGEYRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVI 205
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  +  S VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 151 IYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKEFRNLRRI 199
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ +++R+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>KNAG0I02770 Chr9 (543571..546084) [2514 bp, 837 aa] {ON} Anc_6.350
           YCR077C
          Length = 837

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%)

Query: 328 QFVISEKLETFKGDLNSADDLREFVKNNLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERD 387
           + +I E  +   G +N+A+++RE  KN     + D     D++++ L+L  N+ GL  RD
Sbjct: 771 RIIIDEVRDEIFGTINAAEEMREQAKNTQGAPADDLLYRRDKLYQDLNLFLNVMGLIARD 830

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,350,995
Number of extensions: 2331474
Number of successful extensions: 10444
Number of sequences better than 10.0: 78
Number of HSP's gapped: 10811
Number of HSP's successfully gapped: 82
Length of query: 513
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 399
Effective length of database: 40,409,475
Effective search space: 16123380525
Effective search space used: 16123380525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)