Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.305.433ON21421411331e-159
TPHA0E017705.433ON2172007431e-100
CAGL0A02794g5.433ON2162097071e-94
KNAG0C049205.433ON2172116889e-92
Suva_2.5395.433ON2272196533e-86
YDR367W (KEI1)5.433ON2212206463e-85
NCAS0F033705.433ON2112086365e-84
Smik_4.6335.433ON2212136184e-81
Skud_4.6365.433ON2342336143e-80
TDEL0E019205.433ON2202216123e-80
KAFR0E039305.433ON2112116105e-80
ZYRO0F10010g5.433ON2082056011e-78
TBLA0A065205.433ON2062125575e-72
SAKL0G02508g5.433ON2282265448e-70
TBLA0G020105.433ON2132055038e-64
Kwal_55.214325.433ON2072064837e-61
AER256C5.433ON2392214754e-59
NDAI0B056605.433ON1611604423e-55
KLTH0F16082g5.433ON2062054342e-53
Ecym_47625.433ON2212194301e-52
KLLA0E21099g5.433ON2242224188e-51
KNAG0D039904.186ON36630639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.30
         (214 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   441   e-159
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   290   e-100
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   276   1e-94
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   269   9e-92
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   256   3e-86
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   253   3e-85
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   249   5e-84
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   242   4e-81
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   241   3e-80
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   240   3e-80
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   239   5e-80
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   236   1e-78
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   219   5e-72
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   214   8e-70
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   198   8e-64
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   190   7e-61
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   187   4e-59
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   174   3e-55
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   171   2e-53
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   170   1e-52
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   165   8e-51
KNAG0D03990 Chr4 (722437..723537) [1101 bp, 366 aa] {ON} Anc_4.1...    29   9.9  

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  441 bits (1133), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 214/214 (100%), Positives = 214/214 (100%)

Query: 1   MNINQELSRVKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNV 60
           MNINQELSRVKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNV
Sbjct: 1   MNINQELSRVKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNV 60

Query: 61  FQWVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTET 120
           FQWVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTET
Sbjct: 61  FQWVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTET 120

Query: 121 GSGMSDGSGVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVD 180
           GSGMSDGSGVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVD
Sbjct: 121 GSGMSDGSGVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVD 180

Query: 181 FDDVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214
           FDDVEQDLKNKNKIVQWWIKSKKSCYNLARHILT
Sbjct: 181 FDDVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  290 bits (743), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 162/200 (81%), Gaps = 3/200 (1%)

Query: 17  LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIY 76
           LP+SFFGFLPLYIGVETVLGITI NKCSG YGILALFTGHPL   QWVSYLWS FTL+IY
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 77  SQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTE---TGSGMSDGSGVDEY 133
           +QGLFQVH P+LLTY QI + +SFDT  TC FT+ F S WFTE    G  ++  + VD+Y
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTTVDKY 136

Query: 134 GQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQDLKNKNK 193
            QGASE+ E+ +T+ +T++ALVSR YFNFILA+F Q+LFLHPKYM+D DDVEQDLKNK+ 
Sbjct: 137 NQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDLKNKSI 196

Query: 194 IVQWWIKSKKSCYNLARHIL 213
           IVQWWIKSKK CY  ++  L
Sbjct: 197 IVQWWIKSKKRCYYTSKRFL 216

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  276 bits (707), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 155/209 (74%), Gaps = 11/209 (5%)

Query: 16  NLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLII 75
           + P+SFFGFLPLY+GVE VLGITILNKCSGAYGILALFTGHPL+  QW+SYLWSVFTLI+
Sbjct: 7   SFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIV 66

Query: 76  YSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDGSG------ 129
           +SQGLF +H P L+ +SQI V F+ DT LTC FT+ FS+QWF        + S       
Sbjct: 67  FSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVSQ 126

Query: 130 -----VDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDV 184
                 D   QGASE YEYT T+L T+V L+ RMYFNFILA+F QEL  HPKYMVD DDV
Sbjct: 127 NYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDDV 186

Query: 185 EQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
           EQDLKNK+ I +WWIKS+K CY L RH L
Sbjct: 187 EQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  269 bits (688), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 126/211 (59%), Positives = 164/211 (77%), Gaps = 12/211 (5%)

Query: 15  SNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLI 74
           S+LP++FFG  PLYIGVE VLG+T+LNKCSGA+GILALFTGHPL++ QW SYLWSVFTL+
Sbjct: 6   SSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLV 65

Query: 75  IYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTE---TGSGMSDGS--- 128
           +Y+QGL+Q+H P LLT+SQI VVFS DT LTC+FT+ F+  WF E   T + M   +   
Sbjct: 66  VYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAV 125

Query: 129 ------GVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFD 182
                 G +   QGA+E+YEY FTI+IT+V+LV R+YFNF+LA+F QEL  HP+Y+VD D
Sbjct: 126 ARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQD 185

Query: 183 DVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
           D+EQDLKNK  + +WW+ S+KS Y++ RH+L
Sbjct: 186 DIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  256 bits (653), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 159/219 (72%), Gaps = 22/219 (10%)

Query: 17  LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIY 76
           LP+SF GF+PLY+ VE VLGI+ILNKCSGAYGILALFTGHPL+  QWV+YLWSVFTLI++
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVF 67

Query: 77  SQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSG--MSDGS------ 128
           +QGL+ +H P+LL +SQI V+++ DT  TC FT+ F++QWFT  G+   ++D S      
Sbjct: 68  AQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTATQT 127

Query: 129 --------------GVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLH 174
                           D  GQGASE+YEY+ TILIT+V+L+ R YFNFILA+F QEL  H
Sbjct: 128 INYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFVQELLHH 187

Query: 175 PKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
           PKY+VD DDVEQDLKNK    + W KS+K CY L +++L
Sbjct: 188 PKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  253 bits (646), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 160/220 (72%), Gaps = 16/220 (7%)

Query: 10  VKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWS 69
           +++    LP+SF GF+PLY+ VE VLGI+ILNKCSGAYGILALFTGHPL+  QW++YLWS
Sbjct: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60

Query: 70  VFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDGS- 128
           VFTLI++SQGL+ +H P+LL +SQI V+++ DT  TC FT+ F++QWFT   +   DG+ 
Sbjct: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNN 120

Query: 129 ---------------GVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFL 173
                          G+D   Q A+E+YEYT TILIT+V+L+ R YFNFILA+F QEL  
Sbjct: 121 ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH 180

Query: 174 HPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
           HPKY+VD DDVEQ+LKNK    + W KS+K CY L +++L
Sbjct: 181 HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  249 bits (636), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 122/208 (58%), Positives = 150/208 (72%), Gaps = 6/208 (2%)

Query: 13  HYSNLPR---SFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWS 69
           H   LP+   SFFG +PLY+GVE VLGITI NKCSGAYGILALFTGHPL+  QWV YLWS
Sbjct: 4   HSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWS 63

Query: 70  VFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDG-- 127
           +FTLII++QGL+++H P+LLT+SQI V +S DT  TC+FT+ F+SQWF    +G  +   
Sbjct: 64  IFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEALQ 123

Query: 128 -SGVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQ 186
                   QGA+E YEY  TI IT+V L  R+YFN +LAAF QEL  HPKY+VD DDVEQ
Sbjct: 124 RRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQ 183

Query: 187 DLKNKNKIVQWWIKSKKSCYNLARHILT 214
           DLKNK    +WWIK++K  Y +  H+L 
Sbjct: 184 DLKNKPVWKRWWIKNQKWSYKVCSHLLA 211

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  242 bits (618), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 119/213 (55%), Positives = 154/213 (72%), Gaps = 16/213 (7%)

Query: 17  LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIY 76
           LP+SF GF+PLY+ VE VLGI+ILNKCSG YGILALFTGHPL+  QWV+YLWSVFTLII+
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLIIF 67

Query: 77  SQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFT--ETGSGMSDGS------ 128
           SQGL+ +H P+LL +SQI  +++ DT  TC FT+ F++QWFT  +T  G++  S      
Sbjct: 68  SQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQSNNSNLI 127

Query: 129 --------GVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVD 180
                     D   Q A+E+YEY+ TILIT+V+L+ R YFN ILA+F QEL  HPKY+VD
Sbjct: 128 STERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLVD 187

Query: 181 FDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
            DDVEQ+LKNK    + + KS+K CY L +++L
Sbjct: 188 RDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  241 bits (614), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 121/233 (51%), Positives = 157/233 (67%), Gaps = 29/233 (12%)

Query: 10  VKTHYSNLPR----SFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVS 65
           ++T +  LP+    SF GF+PLY+ VE VLGI+ILNKCSGAYGILALFTGHPL+  QWV+
Sbjct: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60

Query: 66  YLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWF-----TET 120
           YLWSVFTLI++SQGL+ +H P+LL +SQI ++++ DT  TC FT+ F++QWF     T+ 
Sbjct: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDF 120

Query: 121 GS--------------------GMSDGSGVDEYGQGASETYEYTFTILITVVALVSRMYF 160
           GS                    G       D+ GQ A+E YEY+ TI IT+ +L+ R YF
Sbjct: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180

Query: 161 NFILAAFNQELFLHPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
           N IL +F QEL  HPKY+VD DDVEQDLKNK    + W KS+KSCY L +++L
Sbjct: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  240 bits (612), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 158/221 (71%), Gaps = 14/221 (6%)

Query: 7   LSRVKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSY 66
           ++  ++    LP+SF GF+PLYIGVE  LGI+I+NKCSGAYGILALFTGHPL+  QWV Y
Sbjct: 1   MATTRSKSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLY 60

Query: 67  LWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFT-------- 118
           +WS+FTLII  QGL+Q+H P++LT+S IF+ F  DT  T  FT+ F++QW+         
Sbjct: 61  IWSIFTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNV 120

Query: 119 -ETGSGMSDGSGVDEYG----QGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFL 173
            +T S  SD   VD       QGASE +EY  T+ IT+++L  ++YF FI+A+F QEL L
Sbjct: 121 KDTKSSYSDAP-VDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLL 179

Query: 174 HPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214
           HP+YM+D DDVEQDLK+++   +WWIKS+KSCY +++ +L 
Sbjct: 180 HPRYMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  239 bits (610), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 151/211 (71%), Gaps = 6/211 (2%)

Query: 10  VKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWS 69
           ++T   +LP+SF G LPLY+ VE VLGIT  NK SGA+GILALFTGHPL   QWV YLWS
Sbjct: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60

Query: 70  VFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWF-TETGSGMSDGS 128
             TL +++QGLF++H P++LT+SQIFV +S DT   C FT+ F+  WF  E+ +  + GS
Sbjct: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120

Query: 129 GV-----DEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDD 183
            +     D   QGAS+ YEY+ TI IT+ +LV R YFNFILA+F QEL  HPKYM D DD
Sbjct: 121 TITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDD 180

Query: 184 VEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214
           +EQDLKNK+   +WW+K +KSCY L +++L 
Sbjct: 181 IEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  236 bits (601), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 108/205 (52%), Positives = 149/205 (72%), Gaps = 4/205 (1%)

Query: 14  YSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTL 73
           Y NLP+ F GFLPLYIGVE  LG+TILNKCSG +GILALFTGHPL   QWV YLWS+F+ 
Sbjct: 4   YLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSF 63

Query: 74  IIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDGS----G 129
           ++Y+QGLF    PSLL +SQIF+ FS DTFLTC+FT+ F++QW+T   +  +  S     
Sbjct: 64  VVYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIAAAA 123

Query: 130 VDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQDLK 189
           + E  QGAS+++E+  TI IT+ +L++R+YFNF+LA+F Q L  HP+YMVD+ DVEQ+L+
Sbjct: 124 MQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQELR 183

Query: 190 NKNKIVQWWIKSKKSCYNLARHILT 214
            +    + W +++  C   ++ +LT
Sbjct: 184 TQPVWKRVWTRTQIRCLRYSKQLLT 208

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  219 bits (557), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 103/212 (48%), Positives = 142/212 (66%), Gaps = 6/212 (2%)

Query: 3   INQELSRVKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQ 62
           +  E  R       LP+ F G  PLY+GVE VLGITI NKC GAYGILALF GHPL   Q
Sbjct: 1   MTPERYRAAVKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQ 60

Query: 63  WVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGS 122
           WV Y WS+  L IY+QGL +VH P+L T+SQ+F+ FS DT LTC FT+ F+ +WF    +
Sbjct: 61  WVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTT 120

Query: 123 GMSDGSGVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFD 182
                +      QGAS+ YEY+ ++L+T+ +LVSR+YFNFI+ +F QELF  P Y +D D
Sbjct: 121 TRPPAA------QGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTD 174

Query: 183 DVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214
           +VE +L++ + + + W++++  CY L+R IL+
Sbjct: 175 EVETELRHSSLLRRLWLQNQHYCYILSRRILS 206

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  214 bits (544), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 115/226 (50%), Positives = 141/226 (62%), Gaps = 22/226 (9%)

Query: 11  KTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSV 70
           K    +LP+SF GFLPLYIGVE  LGI+I NK SG YGILALFTGHPL+  QW  Y  SV
Sbjct: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSV 62

Query: 71  FTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFT----ETGSGMSD 126
            TL++Y  GL+Q+  P+ LTYS + VVF+ DT L C FT+ FS+QWF+    +   G   
Sbjct: 63  LTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122

Query: 127 GSGVDEYG------------------QGASETYEYTFTILITVVALVSRMYFNFILAAFN 168
            S +   G                  Q AS+ YEYT T+L TV+ L  R YFNFILAAF 
Sbjct: 123 TSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFV 182

Query: 169 QELFLHPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214
           Q++  HPKY+VD DDVEQDLKNK+   +  IKS+K CYN  +  L 
Sbjct: 183 QQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  198 bits (503), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 137/205 (66%), Gaps = 9/205 (4%)

Query: 8   SRVKTHYSN-LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSY 66
            R+ + YS  LP SFF   PLY+GVE +LGI ILNKCSG YGILALFTGHPL++ QW++Y
Sbjct: 3   KRITSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTY 62

Query: 67  LWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSD 126
           +WS+FTL+IY+QG+F +  P++  +SQIF +FS DT  T   T+ F+  WF+   S    
Sbjct: 63  IWSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQS 122

Query: 127 GSGVDE--------YGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYM 178
            + +            QGAS TYE    +++T+  L+SR Y+N +LA+F  +LF++PK++
Sbjct: 123 ENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFI 182

Query: 179 VDFDDVEQDLKNKNKIVQWWIKSKK 203
           +D DDVE DLKNK+   ++   SKK
Sbjct: 183 IDQDDVETDLKNKSFFKKFGGISKK 207

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  190 bits (483), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 98/206 (47%), Positives = 132/206 (64%), Gaps = 21/206 (10%)

Query: 29  IGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIYSQGLFQVHTPSL 88
           +GVE  LGIT+LNKCSG YGIL L TGH L+  QWV YL S+ T+I+YS GL  ++ PS+
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 89  LTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSD----------------GSGVDE 132
           L+YS I + F+ DT +TC FT+ FS QWF+   S ++D                G+ + +
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 133 YG-----QGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQD 187
            G     Q AS+  EY FTIL+T+ AL +R YFNFI+ AF Q L  HPKY+VD DDVEQD
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 188 LKNKNKIVQWWIKSKKSCYNLARHIL 213
           LK++  + +WWI+++   Y + R  L
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  187 bits (475), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 138/221 (62%), Gaps = 16/221 (7%)

Query: 8   SRVKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYL 67
           ++  ++ ++LP+SFFG LPLYIGVE  LGI I NK  G +G+LALFTGHPL++ QW+ YL
Sbjct: 20  TKSHSNMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYL 78

Query: 68  WSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDG 127
           WS  TL++Y  GL Q++ P L  Y  + VV+S DT LTC++T+ F+  WF +   G++  
Sbjct: 79  WSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTAT 138

Query: 128 SGVDEYG---------------QGASETYEYTFTILITVVALVSRMYFNFILAAFNQELF 172
           +  D+                 Q AS++YEY FT+  T+ AL  R Y NF++A+F Q +F
Sbjct: 139 AKEDDADATQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMF 198

Query: 173 LHPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
            H K+    DDVEQDLK+K+   + + K ++ CY L R  L
Sbjct: 199 QHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  174 bits (442), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 84/160 (52%), Positives = 115/160 (71%), Gaps = 7/160 (4%)

Query: 62  QWVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWF--TE 119
           QWV+YLWS+F LII++QGL+Q+H P+LLT+SQI V F+ DT  TC FT+ F++QWF  +E
Sbjct: 2   QWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGSE 61

Query: 120 TGSGMSDGSGVDEY-----GQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLH 174
             S +   +GV +       QGA+  YEY  T+LIT + L  R YFN ILA+F QEL  +
Sbjct: 62  GESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLSN 121

Query: 175 PKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214
           PK+M+D DDVEQDLKNK+ + +WWIK++K CY L + +L+
Sbjct: 122 PKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  171 bits (434), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 130/205 (63%), Gaps = 20/205 (9%)

Query: 29  IGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIYSQGLFQVHTPSL 88
           +GVE  LGITILNKCSG YGIL L TGH L+  QWV YL SVFTL++YS GL  V+ P L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 89  LTYSQIFVVFSFDTFLTCVFTMIFSSQWFT--------------ETGSGMSDGS------ 128
            TY+ + + F+ DT +TC FT+ FS  WF               +T  G+S GS      
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 129 GVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQDL 188
           G     Q AS+  EY FTIL++++ALVSR YFNFI+ AF Q LF HPKY+VD DDV+QDL
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 189 KNKNKIVQWWIKSKKSCYNLARHIL 213
           K+K    +WWI+++   Y +  H L
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  170 bits (430), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 131/219 (59%), Gaps = 23/219 (10%)

Query: 17  LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIY 76
           LP+SFFG LPLYIGVE  LG+ I NK  G YGILALFTG PL++ QW  Y+WS   L+++
Sbjct: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62

Query: 77  SQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFT--ETGSGMS----DGSGV 130
           ++GL QV+ P L+TY  +  V+S DT L C F ++F+  WF+  +T SG +     G GV
Sbjct: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122

Query: 131 DEYG----------------QGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLH 174
            + G                Q AS  YEY+ TIL+T++    R Y NFI+A+F + +   
Sbjct: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182

Query: 175 PKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
            +Y+ + DDVE DLKN +   + ++ +++ CY   R  L
Sbjct: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  165 bits (418), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 133/222 (59%), Gaps = 20/222 (9%)

Query: 11  KTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSV 70
           +++  +LP++F  + PLYIGVE  LG+   NK SG YG+LALFTGHPL+  QW  Y+WS+
Sbjct: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62

Query: 71  FTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSG-----MS 125
           F L+++  G+ QV+ P++L  S +  VFS DT ++C++ + F++ WF++ GS       S
Sbjct: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKS 122

Query: 126 DGSGVDEYGQG--------------ASETYEYTFTILITVVALVSRMYFNFILAAFNQEL 171
            G+ +    +G              AS  YE+   IL+T+V L  R YFNFI+ AF Q+L
Sbjct: 123 AGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQL 182

Query: 172 FLHPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213
               K+  D +D+E +L N+N + +W  K +K C+ L +  L
Sbjct: 183 LRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>KNAG0D03990 Chr4 (722437..723537) [1101 bp, 366 aa] {ON} Anc_4.186
           YLR353W
          Length = 366

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 114 SQWFTETGSGMSDGSGVDEYGQGASETYEY 143
           S W T  G   SDG G +E GQG   T+++
Sbjct: 51  SDWLTTAGESSSDGEG-EEQGQGRLRTFQH 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,372,015
Number of extensions: 997094
Number of successful extensions: 3162
Number of sequences better than 10.0: 38
Number of HSP's gapped: 3201
Number of HSP's successfully gapped: 38
Length of query: 214
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 109
Effective length of database: 41,441,469
Effective search space: 4517120121
Effective search space used: 4517120121
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)