Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.285.436ON46546524130.0
TPHA0E017505.436ON4594646626e-81
TDEL0E018905.436ON4744685671e-66
ZYRO0F10076g5.436ON4824695042e-57
SAKL0G02574g5.436ON4844834921e-55
Kwal_55.214185.436ON4844924553e-50
AER403C5.436ON4804734263e-46
KLTH0F16016g5.436ON4844854081e-43
Ecym_47605.436ON4784793668e-38
KLLA0E02223g5.436ON4804693553e-36
TBLA0A028105.436ON4814933071e-29
YIL062C (ARC15)7.252ON15479790.16
KLTH0G12144g8.331ON358287732.5
YBR025C (OLA1)3.226ON39462722.8
SAKL0E07194g2.304ON49546722.9
CAGL0M12595g7.252ON15479675.1
Suva_9.1397.252ON15479676.1
Skud_2.1383.226ON39463686.9
Suva_9.842.259ON37740687.1
Skud_9.1107.252ON15479667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.28
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   934   0.0  
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    259   6e-81
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    223   1e-66
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   198   2e-57
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   194   1e-55
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   179   3e-50
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   168   3e-46
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   161   1e-43
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   145   8e-38
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   141   3e-36
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    122   1e-29
YIL062C Chr9 complement(243998..244462) [465 bp, 154 aa] {ON}  A...    35   0.16 
KLTH0G12144g Chr7 complement(1020201..1030949) [10749 bp, 3582 a...    33   2.5  
YBR025C Chr2 complement(290681..291865) [1185 bp, 394 aa] {ON}  ...    32   2.8  
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    32   2.9  
CAGL0M12595g Chr13 (1248901..1249365) [465 bp, 154 aa] {ON} high...    30   5.1  
Suva_9.139 Chr9 complement(234415..234879) [465 bp, 154 aa] {ON}...    30   6.1  
Skud_2.138 Chr2 complement(260175..261359) [1185 bp, 394 aa] {ON...    31   6.9  
Suva_9.84 Chr9 (150804..151937) [1134 bp, 377 aa] {ON} YIL110W (...    31   7.1  
Skud_9.110 Chr9 complement(214891..215355) [465 bp, 154 aa] {ON}...    30   7.3  

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/465 (98%), Positives = 459/465 (98%)

Query: 1   MERFHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQN 60
           MERFHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQN
Sbjct: 1   MERFHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQN 60

Query: 61  VDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATI 120
           VDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATI
Sbjct: 61  VDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATI 120

Query: 121 RLKPNDLVTNLQXXXXXXSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYF 180
           RLKPNDLVTNLQ      SNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYF
Sbjct: 121 RLKPNDLVTNLQTTFTTTSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYF 180

Query: 181 KGEFILPFTKVPSLRTVLSVDVSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGL 240
           KGEFILPFTKVPSLRTVLSVDVSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGL
Sbjct: 181 KGEFILPFTKVPSLRTVLSVDVSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGL 240

Query: 241 SIVNNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVL 300
           SIVNNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVL
Sbjct: 241 SIVNNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVL 300

Query: 301 SQLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRSTFVGESWD 360
           SQLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRSTFVGESWD
Sbjct: 301 SQLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRSTFVGESWD 360

Query: 361 KRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYFDGCA 420
           KRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYFDGCA
Sbjct: 361 KRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYFDGCA 420

Query: 421 ADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITYC 465
           ADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITYC
Sbjct: 421 ADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITYC 465

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  259 bits (662), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 160/464 (34%), Positives = 254/464 (54%), Gaps = 15/464 (3%)

Query: 12  FVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDI 71
            ++++I  S TKP+Y++QV V+N      LS +F +N+L +V+SNP+++V      F +I
Sbjct: 1   MIRDSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNI 60

Query: 72  KRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNL 131
           + NL+ +GLY +VDV L  D+  SLLN SLK+ T++IGIES+VP SAT+ + P  L    
Sbjct: 61  RNNLILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYK 120

Query: 132 QXXXXXXSN-DCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTK 190
                  SN   SV+ ++ W N  G +D   I   A  N   +   +K    +F +P  +
Sbjct: 121 NYVTFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLR 180

Query: 191 VPSLRTVLSVDVSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIVNNK---- 246
             S+RT+L    S  K  +          G+ KL L   + + P+FYSGL+I   +    
Sbjct: 181 NSSIRTILESKCSIAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTTLG 240

Query: 247 PIFNGEIPIDVP---SPE--QTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLS 301
           P+ + E   ++    S E   + S +S ++T    DS  +   FP+ G    L +++VL+
Sbjct: 241 PLSDEESETEIIGNISDEVINSLSLKSEYIT----DSRFYTSKFPSGGHLFKLVHQHVLN 296

Query: 302 QLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRSTFVGESWDK 361
           + +S +  I  NI+    +FEK++S LN ++ ++ + +G    P+  +  +   GE WD 
Sbjct: 297 ETNSISNEIKKNISNINMSFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGEFWDN 356

Query: 362 RNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYFDGCAA 421
              + K +  N   ++ K G +SSF++PN  + SP+R Q+S L  NK K +A Y    +A
Sbjct: 357 EKEIFKTLCQNDIKVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAEYLKNYSA 416

Query: 422 DTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITYC 465
           DTGVSLVYK   + M LSY++PL+   N    SG SFD+A+TYC
Sbjct: 417 DTGVSLVYKGDHSQMKLSYQIPLIH-GNDNKHSGLSFDVAVTYC 459

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  223 bits (567), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 150/468 (32%), Positives = 229/468 (48%), Gaps = 16/468 (3%)

Query: 13  VKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIK 72
           +  +I  S TKPLYIS++S++ D+S  PLS S  + +L+  +S+P+QNV ++L +F DI+
Sbjct: 6   LASDIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIR 65

Query: 73  RNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQ 132
           R LL TGLY DV +TL  D        + K    + GIES + T A I LKP+ +  +  
Sbjct: 66  RKLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTA 125

Query: 133 XXXXXXSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVP 192
                  +  SV   + + N LG AD E+   G KYN Q++ W  K  KG F LP  K P
Sbjct: 126 GTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNP 185

Query: 193 SLRTVLSVD---VSEDKVSHLQ------RLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIV 243
           S+R  L+ D   V++   S++        +  +   G+QK W+ +  N+ P FY+G++  
Sbjct: 186 SVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITST 245

Query: 244 NNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLSQL 303
           N      G     V S       +    + F  D+ K+ G+FP SG  L + NEYV+SQ 
Sbjct: 246 NRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQT 305

Query: 304 DSDNK--PINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRST-----FVG 356
              ++  P   N ++F+ + + + S   +++  ++ +  G   P  E T        ++G
Sbjct: 306 KGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTEVHPMDKWYLG 365

Query: 357 ESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYF 416
                +      +    +   +K    +S KL NT +DSPLRL       N F  L    
Sbjct: 366 GLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTAT 425

Query: 417 DGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITY 464
           +  AA TG+SL YKT   NM L+Y  PL   S      GFSF +  +Y
Sbjct: 426 NSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSY 473

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  198 bits (504), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 137/469 (29%), Positives = 234/469 (49%), Gaps = 24/469 (5%)

Query: 16  NISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNL 75
           N+  + TKPLYIS++ ++ D+   PLS S  + +    ++ P+Q+V+ ++  F DI++ L
Sbjct: 17  NLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKL 76

Query: 76  LFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQXXX 135
           LFTGL++DV++TL  D   + L+   K +++  GIE+ + T A + LK  D  T +    
Sbjct: 77  LFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNT-ISGTT 135

Query: 136 XXXSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVPSLR 195
               ++ S+   K W N LG AD E +  G  +N  ++ W  K  +  F LP  KVPS+R
Sbjct: 136 TLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVR 195

Query: 196 TVLSVD------------VSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIV 243
            ++  +              ED+  H+Q+      AG QK W+ +   + P+ Y+G+S+V
Sbjct: 196 AIVEAEGIQRSLCSKPFVAPEDE--HVQQ-QYAVGAGFQKRWICNISKSVPLLYTGVSVV 252

Query: 244 NNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLSQL 303
                       ++ +P + P  ++ ++T+F+ D+ +++G+FP SG    L NEYV+SQ 
Sbjct: 253 RRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQS 312

Query: 304 DSDNKPIN--TNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRSTFVGESWD- 360
              +K +N   N N+   + E + S    ++  +  + GG  +P+    ++    + +  
Sbjct: 313 QGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQL 372

Query: 361 -KRNSL----IKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANY 415
              NSL    +  +     +  +K G   S KL NT   SPLRLQ      N        
Sbjct: 373 GGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTI 432

Query: 416 FDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITY 464
           F+  AA TG+SLVYKT    + L+Y  PL       +  G S  +++T+
Sbjct: 433 FNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTF 481

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  194 bits (492), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 148/483 (30%), Positives = 246/483 (50%), Gaps = 31/483 (6%)

Query: 8   LKNEFVK----ENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDT 63
           L  EF K    + +S S TKPLYI+ VSV+ D+   PLS +  +++L+ V+S P+QN+D 
Sbjct: 6   LSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDN 65

Query: 64  ALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLK 123
           A+ +F +IK+ L FTGL+ DV +TL  D  G+  +   + V+ + G+E  +PT A I L 
Sbjct: 66  AMNNFSEIKKKLFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLI 125

Query: 124 PNDLVTNLQXXXXXXSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGE 183
           P  L   L           S+     + N LG A+   +     Y   S    +K   G+
Sbjct: 126 P-ALYNKLCLTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGK 184

Query: 184 FILPFTKVPSLRTVLSVDVSE---------DKVSHLQRLNCNYKAGIQKLWLKDDLNTFP 234
           F+LP  K PS++ V+ V+ +            V   ++   ++  G+QK WL +     P
Sbjct: 185 FLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAP 244

Query: 235 VFYSGLS-IVNNKPIFNGEIPIDVPSPEQTPSY-QSGWLTTFSKDSTKWLGSFPNSGECL 292
           + ++G+S ++ N   FN    +     +   S+ +S +++  + D+ K++G FP SG   
Sbjct: 245 ILFNGVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRF 304

Query: 293 NLKNEYVLSQLDSDNK--PINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFP----- 345
           NL NEYVL+Q  S NK  P   N ++   ++E++ S LN+R+ +++  + G   P     
Sbjct: 305 NLVNEYVLTQAFSKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKA 364

Query: 346 -IDESTRSTFVGESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQI--- 401
            I  +    ++G     +   +  +  +  +  ++ G  SS++LPN   +SPLR Q+   
Sbjct: 365 AIVHTMDRFYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFN 424

Query: 402 SALTENKFKGLANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIA 461
           +  + NK + L   F   AA TG SLVYKT   NM L+Y +PL +     A  GFSF + 
Sbjct: 425 AGDSLNK-RELPQSF---AAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVE 480

Query: 462 ITY 464
           +++
Sbjct: 481 LSF 483

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  179 bits (455), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 141/492 (28%), Positives = 232/492 (47%), Gaps = 41/492 (8%)

Query: 1   MERFHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQN 60
           + +F E L+ E  +  +  S  KPLY + +SV+ +    PLS +   +VLE V+S P+Q 
Sbjct: 3   LPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQT 62

Query: 61  VDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATI 120
           ++ +L +F +IK+ L++TG+++DV ++L  D  G+ L    +    ++ +ES VPT A I
Sbjct: 63  LEQSLANFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARI 122

Query: 121 RLKPNDLVTNLQXXXXXXSNDC--SVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQK 178
            LKP +     +      +ND   S+     + N LG A+   +    KY     + ++K
Sbjct: 123 LLKPLEFN---KLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEK 179

Query: 179 YFKGEFILPFTKVPSLRTVLSVDVS----------EDKVSHLQRLNCNYKAGIQKLWLKD 228
               + ++P  K PS++ V   + +          E K  H QR   +   G+QK WL  
Sbjct: 180 TLDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQR-QVSVNVGVQKQWLTS 238

Query: 229 DLNTFPVFYSGLSIVNNKPIFNGEIPIDVPSPEQ-------TPSYQSGWLTTFSKDSTKW 281
            +N  PVFY+G S+V            DVP+           P  ++ +++    D+ K+
Sbjct: 239 KMNLSPVFYNGFSVVARN-------LHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKF 291

Query: 282 LGSFPNSGECLNLKNEYVLSQL---DSDNK-PINTNINRFEANFEKYVSILNSRVITTVL 337
            G FP SG  + L NEYVLSQ    DS N   ++   N+   + E   S   +++I ++ 
Sbjct: 292 FGLFPASGVKIALNNEYVLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLD 351

Query: 338 MNGGFQFPIDESTRST------FVGESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNT 391
           +  G   P   S          ++G     +      +  +  +  +K    SSFKLP T
Sbjct: 352 IACGGILPTGNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRT 411

Query: 392 ELDSPLRLQISALTENKFKGLANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSP 451
              SPLRLQ   L   +          CAA +G+SL+YK+   NM L+Y +PL   +   
Sbjct: 412 PQQSPLRLQF-FLNAGEVSNEKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDV 470

Query: 452 ATSGFSFDIAIT 463
           A  GFSF ++++
Sbjct: 471 AKPGFSFGVSLS 482

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  168 bits (426), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 141/473 (29%), Positives = 222/473 (46%), Gaps = 33/473 (6%)

Query: 15  ENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRN 74
           + +  S+TKPLYI+ V VE D  D+PLS   L+++L  V++ P+Q++ + L S   I++N
Sbjct: 17  DQLGKSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKN 75

Query: 75  LLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDK-IGIESIVPTSATIRLKPNDLVTNLQX 133
           L++TGLY D+ +TL  DK   L+N  L  +  K   IE  +P  A +++ P      L  
Sbjct: 76  LMYTGLYQDISITLDHDK-SRLVNQFLSNIAPKEYDIELPLPVKALVKVLPAP-YQRLSL 133

Query: 134 XXXXXSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVPS 193
                 +  S        N  G+A+  ++     Y   S     K      ++PF   PS
Sbjct: 134 VTTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPS 193

Query: 194 LRTVLSVD-----------VSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGLSI 242
           ++ V  V+           ++ED   H QR    +  GIQK WL   L + P  ++G+SI
Sbjct: 194 IKAVFDVNYAMLDLYNQPWINEDD-QHKQR-QIGFNIGIQKQWLSKRLYS-PTAFAGVSI 250

Query: 243 VNNKPIFNGEIPIDVPSPEQTP----SYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEY 298
           V      +G I +D  S   +     S ++ ++T F   + K +G+FP  G   N  NE 
Sbjct: 251 VGRN--LHG-IQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNEL 307

Query: 299 VLSQLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRST----- 353
           VLSQ  +   P     N+F   +EK+VS L + V T++ ++ G      ++ +       
Sbjct: 308 VLSQTVA-GTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMD 366

Query: 354 --FVGESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKG 411
             ++G     +      +     D+ ++    SS  LP T LDSPLRLQ      + F  
Sbjct: 367 QFYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHF 426

Query: 412 LANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITY 464
                +  AA TG+SLVY++   N+ L+Y +PL       A  GFSF +AI Y
Sbjct: 427 RRQIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  161 bits (408), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 130/485 (26%), Positives = 226/485 (46%), Gaps = 33/485 (6%)

Query: 4   FHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDT 63
           F +EL+       +  S  KPLY + +SV+ D+   PLS++   +VLE V+  P+Q +D 
Sbjct: 6   FSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQ 65

Query: 64  ALGSFIDIKRNLLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLK 123
           +L +F +IK+ L++TGL+ DV ++L  +     L    K +     +E  +PT A IRL 
Sbjct: 66  SLSNFAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLT 125

Query: 124 PNDLVTNLQXXXXXXSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGE 183
           P +L           +       + +  NF G A+   +     Y    +++ +K  + +
Sbjct: 126 PINLNRASLTSFTGDTLSSMGGRYSVINNF-GKAEVLTLQGKLAYQPFQSTFDEKVLEAK 184

Query: 184 FILPFTKVPSLRTVLSVDVS----------EDKVSHLQRLNCNYKAGIQKLWLKDDLNTF 233
            ++P  K PS++ V   + +          E +  H Q+   +   G+QK W+       
Sbjct: 185 LLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQK-QVSVNVGVQKQWVNIKTGLA 243

Query: 234 PVFYSGLSIVNNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLN 293
           PV Y+G S+V        +   +       P  ++ +++    D+ K+ G FP SG   +
Sbjct: 244 PVLYNGFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFS 303

Query: 294 LKNEYVLSQLDSDNKPINTNINRFEA------NFEKYVSILNSRVITTVLMNGGFQFPID 347
           + NEYVLS  +S +K   T +++ E       +FE + +   +++I ++ +  G  F   
Sbjct: 304 INNEYVLS--ESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAG 361

Query: 348 ESTRST------FVGESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQI 401
           +S+         ++G     +      +  +   + +K G  SSFKLPNT  +SPLRLQ 
Sbjct: 362 KSSSLVHHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQF 421

Query: 402 ---SALTENKFKGLANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSF 458
              +   +NK       F  CAA +GVSL+YK+   NM L+Y  PL          GFSF
Sbjct: 422 FFNAGDVQNK---KPTQFS-CAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSF 477

Query: 459 DIAIT 463
            ++++
Sbjct: 478 GVSLS 482

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  145 bits (366), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 127/479 (26%), Positives = 222/479 (46%), Gaps = 47/479 (9%)

Query: 17  ISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLL 76
           ++  +TKPL+I+ V V ND    PLS+S  +++L+ V+S P QN+ + L +   I++ L+
Sbjct: 17  LAKVQTKPLFITSVYV-NDVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLM 75

Query: 77  FTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRL-----KPNDLVTNL 131
           +TGLY+DV++TL  DK   + +   ++   + G+E  VP  A I+L     +P  LVT  
Sbjct: 76  YTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTTT 135

Query: 132 QXXXXXXS-NDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTK 190
           +        +  S+N  +     +   +     F  K +       +K    + ++P  K
Sbjct: 136 RDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKID-------EKLLSLKCLVPLQK 188

Query: 191 VPSLRTVLSVDVS----------EDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGL 240
           +PS++ V  ++ +           +   H Q     +  GIQ+  +       P+ YSG+
Sbjct: 189 LPSMKAVFDINYALVDLFKQSWLPESDQHKQN-QIGFNIGIQEQQISSSKFRGPIIYSGI 247

Query: 241 SIVNNKPIFNGEIPIDVPSPEQTPSYQS-------GWLTTFSKDSTKWLGSFPNSGECLN 293
           SI+       G   +D+   E + S  S        ++    +++ K+LG+ P SG   N
Sbjct: 248 SIL-------GRNLLDLKKTEVSSSINSWVESSKVSYVFQILQNNKKFLGTLPISGWKFN 300

Query: 294 LKNEYVLSQLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGG--FQFPIDESTR 351
           L NE VL Q  +  K   +   +   ++E Y S L + +IT++ ++ G  F++      +
Sbjct: 301 LFNEAVLGQTVAGEKQ-ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELK 359

Query: 352 STFVGESWDKRNSLIKDIILNKSDMN-----FKCGFISSFKLPNTELDSPLRLQISALTE 406
              + + +    S +K    N          +K  F SSF +P T L SPLRLQ      
Sbjct: 360 VHIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAG 419

Query: 407 NKFKGLANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITYC 465
           + F       +  A  TG+SLVY++   ++ L+Y +PL   +   A  GFSF ++I Y 
Sbjct: 420 DVFNSERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  141 bits (355), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 123/469 (26%), Positives = 222/469 (47%), Gaps = 33/469 (7%)

Query: 23  KPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLLFTGLYN 82
           K +Y ++V+V+ D+   P+S    Q++   ++++P+Q VD+A  S  DI++ LLFTGL+ 
Sbjct: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76

Query: 83  DVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQXXXXXXSNDC 142
             ++TL  D       L  + V   + IE  +PT A ++L P   V N         +  
Sbjct: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVP--AVYNKGSLSTTTRDTY 134

Query: 143 SVNFHKL-WPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVPSLRTVLSVD 201
           S    +L W N  G A+  ++     Y   +    ++    +  LPF K PS++  +  +
Sbjct: 135 SSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYAN 194

Query: 202 VS----------EDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIV-NNKPIFN 250
            +           +   H Q       AGI+K +L ++  +    ++G+++V  N   F 
Sbjct: 195 HTYLDLFKQPFIGESDEHKQS-QFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFA 253

Query: 251 GEIPI-DVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLSQLDSDNKP 309
             + + D     Q    +S +++    DS ++   FP SG+ + L +EY+LSQ  +++KP
Sbjct: 254 DALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKP 313

Query: 310 I--NTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTR------STFVGESWDK 361
           +   +N ++   ++E +    N++++T++ ++ G  FP    ++       +F       
Sbjct: 314 LPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKS 373

Query: 362 RNSLIKDIILNKSDMNF-KCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYFDG-- 418
                ++ + N+  + F K G  SSFKLPNT +DSPLRLQ      N    L N+ D   
Sbjct: 374 LKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFI---NFGDVLNNWRDANL 430

Query: 419 ---CAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITY 464
               A  TG+SL+Y     N+ LSY +PL       A  G +F + +++
Sbjct: 431 ERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSF 479

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score =  122 bits (307), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 131/493 (26%), Positives = 229/493 (46%), Gaps = 83/493 (16%)

Query: 22  TKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLLFTGLY 81
           TKPLYIS+V++ + + D  +S SFL+++L  V+S P+QN+ T L +F +I+  L  T L+
Sbjct: 21  TKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDLF 80

Query: 82  NDVDVTLGADKGGS--LLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQXXXXXXS 139
            DV ++L  ++  S  +  L   +    I ++S +P +A I +KPN  + +        +
Sbjct: 81  EDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNYTWTISN 140

Query: 140 NDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKG---EFILPFTKVPSLRT 196
           N    ++ K W N L  AD+  I+  A Y+L ST W    F G     ++PFT V S+  
Sbjct: 141 NKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVKSVSG 200

Query: 197 VLSVDVSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPV--------FYSGLSI------ 242
           +      +    ++Q L    ++G +K     D+  FP          Y+GL+I      
Sbjct: 201 ISLFKPLQQSKDYIQYL---VESGFRK-----DMR-FPEEVGVKSSNLYTGLAINGAIKD 251

Query: 243 --VNNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVL 300
              NN  + N  I  ++   ++T       L+ FS DS  ++   P  G   N+  EYVL
Sbjct: 252 EGNNNCLVLNKTILENMQIYKKT-----SILSKFSTDSRIFVKGIPRYGSYFNIYYEYVL 306

Query: 301 SQLDSDNKPIN------TNINRFEANFEKYVSILNSRVITTVLMNGGF------------ 342
           + L+ D+K ++      +N++RF  NFEKY ++    ++ ++L+  G             
Sbjct: 307 NGLN-DSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMFNWE 365

Query: 343 -------QFPIDESTRSTFVGESWDKRNSLIK--DIILNKSDMNF-KCGFISSFKLPNTE 392
                  +FP+      +++ E   ++N  I   ++ LN S   F KC F          
Sbjct: 366 TKRREANEFPV-----PSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKF---------- 410

Query: 393 LDSPLRLQISALTENKFKGLANYFDGCAADTG-VSLVYKTKDTNMALSYKVPLMQSSNSP 451
             SPLR Q S   E ++     +       TG + LVYK++     + Y +P+ + +   
Sbjct: 411 --SPLRFQNSIQLE-RYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHD 467

Query: 452 ATSGFSFDIAITY 464
             +GF+ + +I++
Sbjct: 468 TKAGFAMNASISF 480

>YIL062C Chr9 complement(243998..244462) [465 bp, 154 aa] {ON}
           ARC15Subunit of the ARP2/3 complex, which is required
           for the motility and integrity of cortical actin
           patches; has mRNA binding activity
          Length = 154

 Score = 35.0 bits (79), Expect = 0.16,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 36  SSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGS 95
           S+D P    + ++VLE +      ++   + +  D +R++L   LY  + V  G  +GG 
Sbjct: 68  SADAPTKEQYFKSVLEALTQVRQADIGNVIKNLSDSQRDVLVKYLYKGMSVPQGQKQGGV 127

Query: 96  LLNLSLKMVTDKIGIESIV 114
           LL   L+ +T   G+  IV
Sbjct: 128 LLAW-LERITQVSGVTPIV 145

>KLTH0G12144g Chr7 complement(1020201..1030949) [10749 bp, 3582 aa]
            {ON} weakly similar to uniprot|Q00402 Saccharomyces
            cerevisiae YDR150W NUM1 Protein required for nuclear
            migration localizes to the mother cell cortex and the bud
            tip may mediate interactions of dynein and cytoplasmic
            microtubules with the cell cortex
          Length = 3582

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 37/87 (42%), Gaps = 2/87 (2%)

Query: 262  QTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLSQLDSDNKPINTNINRFEANF 321
            Q+P   SG +   S+D  K   S P  G  L    ++ L    SDN  +N  +N     F
Sbjct: 2686 QSPKSASGHIMA-SQDEGKHSDSLPVKGVVLLKPEDFDLLLSSSDNGVVNMALNGDSVTF 2744

Query: 322  EKYVSILNSRVITTVLMNGGFQFPIDE 348
            E        RVI + L N G  F ++E
Sbjct: 2745 ESETG-ETMRVIASFLPNSGLTFSVEE 2770

>YBR025C Chr2 complement(290681..291865) [1185 bp, 394 aa] {ON}
           OLA1P-loop ATPase with similarity to human OLA1 and
           bacterial YchF; identified as specifically interacting
           with the proteasome; protein levels are induced by
           hydrogen peroxide
          Length = 394

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 153 FLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVPSLRTVLSVDVSEDKVSHLQR 212
            + +++R+ I    K+ L+   W+ KY  G+ I+PF+   SL   LS    ED    L++
Sbjct: 230 LINLSERDYIRKKNKHLLRIKEWVDKYSPGDLIIPFS--VSLEERLSHMSPEDAEEELKK 287

Query: 213 LN 214
           L 
Sbjct: 288 LQ 289

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 420 AADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITYC 465
           +  TGV LV+K       L++ VP+   S+     GF + I +T+ 
Sbjct: 450 STSTGVGLVFKHPVARFELNFTVPISAHSSDSVRKGFQYGIGLTFL 495

>CAGL0M12595g Chr13 (1248901..1249365) [465 bp, 154 aa] {ON} highly
           similar to uniprot|P40518 Saccharomyces cerevisiae
           YIL062c ARC15 subunit of the ARP2/3 complex
          Length = 154

 Score = 30.4 bits (67), Expect = 5.1,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 36  SSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGS 95
           +SD     ++L  VLE +      ++   +G   D + ++L   LY  + V  G  +GG 
Sbjct: 68  NSDEATKKTYLLAVLEALGQVKTMDIANIVGQLNDSQVDVLVKYLYKGMSVPEGQKQGGI 127

Query: 96  LLNLSLKMVTDKIGIESIV 114
           LL   L+ +T   G++ IV
Sbjct: 128 LLAW-LEKITQTNGVKPIV 145

>Suva_9.139 Chr9 complement(234415..234879) [465 bp, 154 aa] {ON}
           YIL062C (REAL)
          Length = 154

 Score = 30.4 bits (67), Expect = 6.1,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 36  SSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGS 95
           S+D      +  +VLE +      ++   + +  D +R++L   LY  + V  G  +GG 
Sbjct: 68  SADAATKEQYFVSVLEALTQVRQADIGNVVKTLNDAQRDILVKYLYKGMSVPQGQKQGGI 127

Query: 96  LLNLSLKMVTDKIGIESIV 114
           LL   L+ +T   G+  IV
Sbjct: 128 LLAW-LEKITQVSGVTPIV 145

>Skud_2.138 Chr2 complement(260175..261359) [1185 bp, 394 aa] {ON}
           YBR025C (REAL)
          Length = 394

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 153 FLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVPSLRTVLSVDVSEDKVSHLQR 212
            + +++R+ I    K+ L+   W+ KY  G+ I+PF+   SL   LS    ED    L++
Sbjct: 230 LINLSERDYIRKKNKHLLRIKEWVDKYSPGDLIIPFS--VSLEERLSHMSPEDAEEELKK 287

Query: 213 LNC 215
           +  
Sbjct: 288 VGA 290

>Suva_9.84 Chr9 (150804..151937) [1134 bp, 377 aa] {ON} YIL110W
          (REAL)
          Length = 377

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 33 ENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIK 72
          END+ D+PL S FL  +  N+V   ++N++T L    D++
Sbjct: 33 ENDTHDNPLDSGFL--LQSNIVQPKVENLETLLQGLKDVR 70

>Skud_9.110 Chr9 complement(214891..215355) [465 bp, 154 aa] {ON}
           YIL062C (REAL)
          Length = 154

 Score = 30.0 bits (66), Expect = 7.3,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 36  SSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLLFTGLYNDVDVTLGADKGGS 95
           S+D      +L +VLE +      ++   + +  D ++++L   LY  + +  G  +GG 
Sbjct: 68  SADAATKEQYLGSVLEALTQVRQADIGNVIKTLSDSQKDVLVKYLYKGMSIPQGQKQGGI 127

Query: 96  LLNLSLKMVTDKIGIESIV 114
           LL   L+ +T   G+  IV
Sbjct: 128 LLAW-LEKITQVSGVTPIV 145

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,125,575
Number of extensions: 2537644
Number of successful extensions: 8261
Number of sequences better than 10.0: 54
Number of HSP's gapped: 8474
Number of HSP's successfully gapped: 55
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)