Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.275.439ON1261266611e-90
CAGL0I01078g5.439ON1261266012e-81
NDAI0C015805.439ON1261265971e-80
TDEL0D026205.439ON1261265925e-80
Smik_15.2995.439ON1261265804e-78
YOR122C (PFY1)5.439ON1261265804e-78
SAKL0G02640g5.439ON1261265795e-78
TPHA0E017405.439ON1261265796e-78
Skud_15.2845.439ON1261265779e-78
KNAG0B042205.439ON1261265752e-77
Suva_8.1745.439ON1261265735e-77
KAFR0D050405.439ON1261265726e-77
KLLA0E02289g5.439ON1261265648e-76
Ecym_45105.439ON1261265648e-76
ACL168C5.439ON1261265641e-75
KLTH0F15950g5.439ON1261265631e-75
NCAS0H020705.439ON1261265622e-75
ZYRO0F10142g5.439ON1261265352e-71
TBLA0A065005.439ON1191265301e-70
Kwal_55.214135.439ON58582803e-33
ZYRO0F02574g8.17ON63058634.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.27
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   259   1e-90
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   236   2e-81
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   234   1e-80
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   232   5e-80
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   228   4e-78
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   228   4e-78
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   227   5e-78
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   227   6e-78
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   226   9e-78
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   226   2e-77
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   225   5e-77
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   224   6e-77
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   221   8e-76
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   221   8e-76
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   221   1e-75
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   221   1e-75
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   221   2e-75
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   210   2e-71
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   208   1e-70
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   112   3e-33
ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} simila...    29   4.2  

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  259 bits (661), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  236 bits (601), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLLATGK+DKAV+YS+AGDAVWA+SGGL+L A EIS I QGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQT+L+AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  234 bits (597), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLLATGK+DKAV+YSRAGD+VWA+SGG  L A EIS I QGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQT+LVAHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  232 bits (592), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLL TGK+DKAV+YSRAGD++WASSGGL L A EI  IAQGFD P  LQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQTIL+AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  228 bits (580), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNL+ TGK+DKAV+YSRAGDAVWA+SGGL+L   EI  I QGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQT+++AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  228 bits (580), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNL+ TGK+DKAV+YSRAGDAVWA+SGGL+L   EI  I QGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQT+++AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  227 bits (579), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLL TGK+DKA++YSRAGDA+WA+SGGL L   EIS IAQGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQ QKFM++RADDRSIYGRHDAEGVVCVRTKQTIL+AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  227 bits (579), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLLATGK+DKA LYSRAGDA WA+SGGL+L A E + IA+GFDDPS LQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQTI++AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  226 bits (577), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNL+ TGK+DKAV+YSRAGDA+WA+SGGL+L   EIS + QGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGV+CVRTKQT++++HYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLL TGK+DKAV+YSRAGD+VWA+SGGL L   EIS I  GFD+ + LQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQTILVAHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  225 bits (573), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNL+ TGK+DKAV++SRAGDA+WA+SGGL+L   EI  I QGFD+P  LQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGV+CVRTKQT+++AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  224 bits (572), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLLAT K+D+AV+YSRAGDA WA+SGG+AL   EI+ IAQGFD+ + LQSNG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQTI++AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  221 bits (564), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLLATGKIDK+V+YSRAGDAVWASSGGL L   EIS IA+GFD+PS LQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LH+QGQKFM+++ADDRSIYGRH+AEG+V VRTKQTIL+ HYP  VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  221 bits (564), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNL+ATGK+DKA++YSRAGD +WASSGG++L A EIS I+QGFD+   LQSNG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQ QKFM+LRADDRSIYGRH+AEG++ VRTKQTIL+AHYPA VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  221 bits (564), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLLATGK+DKA +YSRAGD +WASSGGLAL  +EI  I+QGFD+ + LQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRAD+RSIYGRH+AEGVV VRTKQTIL+AHYPA VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  221 bits (563), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYTDNLL TGKIDKA +YSRAGD++WA+SGGL+L   EI  IAQGF++PS LQS G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LH+QGQKFM++RADDRSIYGRHDAEGV+CVRTKQTILV HYPA VQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV Y
Sbjct: 121 LISVSY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  221 bits (562), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQA TDNLLATGK+D+AVLYSRAGD+VWA+SGGL L   EI+ IA+GFD+P+ LQSNG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LH+QGQKFM+LRADD+SIYGRHDAEG+VCVRT QTIL+AHYP +VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV+Y
Sbjct: 121 LISVKY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  210 bits (535), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 98/126 (77%), Positives = 109/126 (86%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQAYT+NLL TGKIDKA +YSRAGD++WASSGGL  A  EI  IA GFD+PS LQS G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           L +QGQKFM+LRADDRSIY RHDAEG+ CVRTKQTI++AHYP +VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI  QY
Sbjct: 121 LIGAQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  208 bits (530), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60
           MSWQA       TGK+DKAV+YSRAGD+VWASSGGL L A EI+ IA+GFD+PS LQSNG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120
           LH+Q QKFM+LRADDRSIYGRHDAEG+VCVRTKQTI++AHYP TVQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVQY 126
           LI VQY
Sbjct: 114 LIGVQY 119

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  112 bits (280), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (94%)

Query: 69  MMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADYLISVQY 126
           M++RADDRSIYGRHDAEGVVCVRTKQTILV HYPA VQAGEATKIVEQLADYLISV Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} similar
           to uniprot|P43561 Saccharomyces cerevisiae YFL041W
          Length = 630

 Score = 28.9 bits (63), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 26/58 (44%)

Query: 36  LALAATEISGIAQGFDDPSHLQSNGLHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTK 93
           L L  T      +G+D P  +   GL    ++F +   D+R +Y  +D +    VR K
Sbjct: 294 LQLQWTHQVAYDKGYDWPKTIDVGGLENAAEEFYLQPLDNRELYDDYDVQITFDVRMK 351

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.131    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,779,280
Number of extensions: 377364
Number of successful extensions: 639
Number of sequences better than 10.0: 22
Number of HSP's gapped: 639
Number of HSP's successfully gapped: 22
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)