Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.265.440ON45736414630.0
TPHA0E017305.440ON4692839061e-117
NDAI0C015905.440ON4702798781e-113
NCAS0H020805.440ON4352798721e-113
Suva_8.1755.440ON4532808701e-112
YOR123C (LEO1)5.440ON4642838401e-107
KAFR0D050505.440ON4192678321e-107
Smik_15.3005.440ON4632838351e-107
Skud_15.2855.440ON4872838351e-106
KNAG0B042105.440ON4632618101e-103
TDEL0D026105.440ON4402348061e-103
SAKL0G02662g5.440ON4792317991e-101
CAGL0K10230g5.440ON4462667851e-99
ZYRO0F10164g5.440ON4232207492e-94
KLTH0F15928g5.440ON4232667473e-94
TBLA0A064905.440ON4282407362e-92
Ecym_45115.440ON4612207303e-91
Kwal_55.214085.440ON4362717251e-90
KLLA0E02311g5.440ON4172357056e-88
ACL167C5.440ON4392346892e-85
Ecym_42468.313ON169358722.9
Smik_12.3924.47ON312111679.2
AGR237C7.185ON103085689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.26
         (457 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   568   0.0  
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   353   e-117
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   342   e-113
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   340   e-113
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   339   e-112
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   328   e-107
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   325   e-107
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   326   e-107
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   326   e-106
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   316   e-103
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   315   e-103
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   312   e-101
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   306   1e-99
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   293   2e-94
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   292   3e-94
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   288   2e-92
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   285   3e-91
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   283   1e-90
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   276   6e-88
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   270   2e-85
Ecym_4246 Chr4 complement(508900..513981) [5082 bp, 1693 aa] {ON...    32   2.9  
Smik_12.392 Chr12 (686149..687087) [939 bp, 312 aa] {ON} YLR308W...    30   9.2  
AGR237C Chr7 complement(1193439..1196531) [3093 bp, 1030 aa] {ON...    31   9.3  

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/364 (79%), Positives = 288/364 (79%)

Query: 1   MSEELQSNXXXXXXXXXXXXXXXXXXRAESVEGAGSXXXXXXXXXXXXXXXXEGVSRRRI 60
           MSEELQSN                  RAESVEGAGS                EGVSRRRI
Sbjct: 1   MSEELQSNVVEEKPEDVVDGGEEVVERAESVEGAGSDMDDLFGDDDDDEDDDEGVSRRRI 60

Query: 61  DTQXXXXXXXXXXXXXXXXXXXXYVDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFRE 120
           DTQ                    YVDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFRE
Sbjct: 61  DTQGEGEDDGDEDEDNIGRRRRNYVDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFRE 120

Query: 121 EDVVLTRHVVPTKITSEENDADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSK 180
           EDVVLTRHVVPTKITSEENDADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSK
Sbjct: 121 EDVVLTRHVVPTKITSEENDADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSK 180

Query: 181 EEQLEDRLIDQNTIRWRYSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDN 240
           EEQLEDRLIDQNTIRWRYSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDN
Sbjct: 181 EEQLEDRLIDQNTIRWRYSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDN 240

Query: 241 TFLTVSHDQQELMQCVHGGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIV 300
           TFLTVSHDQQELMQCVHGGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIV
Sbjct: 241 TFLTVSHDQQELMQCVHGGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIV 300

Query: 301 NIDPXXXXXXXXXXQSQVFXXXXXXXXXXXXALESLETTGFGNNSYSASRKRSTTPMSYG 360
           NIDP          QSQVF            ALESLETTGFGNNSYSASRKRSTTPMSYG
Sbjct: 301 NIDPELEKKELEKKQSQVFRERRKKKQKEIEALESLETTGFGNNSYSASRKRSTTPMSYG 360

Query: 361 GSRR 364
           GSRR
Sbjct: 361 GSRR 364

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 425 KRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD 457
           KRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD
Sbjct: 425 KRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD 457

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  353 bits (906), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 171/283 (60%), Positives = 209/283 (73%), Gaps = 10/283 (3%)

Query: 84  YVDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEEND--- 140
           Y+DEDEDEE AMYTRKFYG++D +K D++E+ HEF+E DV L RH+VP KI  ++ND   
Sbjct: 103 YMDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSK 162

Query: 141 ----ADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRW 196
               +  + YYA++PPFLTIDP+PFDPP FE+ V+ERL N  + ++++ DRLID+NTIRW
Sbjct: 163 DDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRW 222

Query: 197 RYSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCV 256
           RYSRD NQ VFKESNA I+QWSDGSYSLKLGD+YTD+L+ND  NTFLTVSHDQQELMQCV
Sbjct: 223 RYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCV 282

Query: 257 HGGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQS 316
            GGEISKS +FVPIST S+LHQRLSKAI RR+   T  PRSMI+N+DP          QS
Sbjct: 283 DGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQS 342

Query: 317 QVFXXXXXXXXXXXXA-LESLETTGF--GNNSYSASRKRSTTP 356
           Q+F               E+L++ GF  GN   S+SRKR  TP
Sbjct: 343 QIFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTP 385

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  342 bits (878), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/279 (60%), Positives = 208/279 (74%), Gaps = 6/279 (2%)

Query: 87  EDEDEEQAMYTRKFYGEDDYDK-SDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTI 145
           ED D+E+AMYTRKFYG  D DK SD EED H+F+E +V + RH+VP K +S++  ADTTI
Sbjct: 113 EDMDDEEAMYTRKFYG--DTDKYSDNEEDAHDFKEANVEIIRHMVPYKTSSDQ--ADTTI 168

Query: 146 YYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQR 205
           YYAKVPPFLTIDPIPFDP +FE  V++RL +  S+E+QL DRLID+NTIRWRYSRD NQR
Sbjct: 169 YYAKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQR 228

Query: 206 VFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSL 265
           VFKESNA IVQWSDGS+SLKLGDEYTDIL+NDTDNTFLTVSHDQQELMQC +GGEI+K++
Sbjct: 229 VFKESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTM 288

Query: 266 LFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXXX 325
           +F+P ST SK+HQ+LSKA+ RRN  + +GP +MI+  DP          Q Q+       
Sbjct: 289 MFIPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKR 348

Query: 326 XXXXXXALESLETTGFGNNSYSASRKRSTTPMSYGGSRR 364
                   ES +TT F     ++S+ RS  P SY GSR+
Sbjct: 349 QLKEREIQESPDTT-FDVRGSASSKNRSPAPSSYRGSRQ 386

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 425 KRQGTAAYNDDEKSGSE--SPKRRKVAVIEDDEDD 457
           K+ G   Y D E+S  E  S KRRKVAV+ DDE+D
Sbjct: 435 KKGGAQEYADREESDMEEGSSKRRKVAVLSDDEED 469

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  340 bits (872), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/279 (60%), Positives = 210/279 (75%), Gaps = 5/279 (1%)

Query: 88  DEDEEQAMYTRKFYGEDDYDK--SDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTI 145
           D DEE+AMYTRKFYG+DDY++  SDQ+   H F+EE+V L RH+VP K +SE+ D +TT+
Sbjct: 78  DIDEEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTD-ETTV 136

Query: 146 YYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQR 205
           YYAKVPPFLTI+P+PFDP  FE+ VR+RL+N  SKE+QL DRLID+NT+RWRYSRD NQR
Sbjct: 137 YYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQR 196

Query: 206 VFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSL 265
           VFKESNA IVQWSDGS+SLKLGDEYTDIL+N+T+NTFL VSHDQQELMQC +GGEI+K+L
Sbjct: 197 VFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTL 256

Query: 266 LFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXXX 325
           +F+P ST SK+HQ+LSKA+ RRN  E +GP +MI+N DP          Q Q+       
Sbjct: 257 MFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRRR 316

Query: 326 XXXXXXALESLETTGFGNNSYSASRKRSTTPMSYGGSRR 364
                  LES +TT   +  Y  +RKR+ TP    GSRR
Sbjct: 317 QLKEKELLESPDTTMDVSGGYE-TRKRN-TPNPSLGSRR 353

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  339 bits (870), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 162/280 (57%), Positives = 204/280 (72%), Gaps = 6/280 (2%)

Query: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
           +D+DE EEQAMYTRKFYGED  D SDQ+E  H F+EE+V L RH++P+K    E  +   
Sbjct: 100 LDDDEAEEQAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSKANVNETASHNE 159

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           I+YA++P FLTIDPIPFDPP+FE  V ER  N +SKE+QL+DRLID+NT+RWRYSRD++Q
Sbjct: 160 IFYARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDNDQ 219

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
            VFKESN  IVQWSDGSYSLK+G+EYTDIL+NDT NTFLTVSHDQQELMQC  GGEI K+
Sbjct: 220 HVFKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKT 279

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXX 324
           L+F+P ST+SK+HQ+LSKA+VR+N  +  GP + I+N+DP          QSQ+      
Sbjct: 280 LMFIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRK 339

Query: 325 XXXXXXXALESLETTGFGNNSYSASRKRSTTPMSYGGSRR 364
                    ES +  GF     +A RK+S +P +YG +RR
Sbjct: 340 RQLKEKEKQESPD-VGF----ETAFRKQS-SPTAYGATRR 373

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 5/36 (13%)

Query: 425 KRQGTAAYNDDEKSG---SESPKRRKVAVIEDDEDD 457
           KR+G A Y   E+ G   S   KRR+VAVIEDDED+
Sbjct: 419 KREGAAMYK--EEGGDDDSNESKRRRVAVIEDDEDE 452

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  328 bits (840), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 155/283 (54%), Positives = 199/283 (70%), Gaps = 12/283 (4%)

Query: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
           +D+DE EEQAMYTRKFYGED  + SDQ+E  H F+EE+V L RH++P+K    E  +   
Sbjct: 108 LDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNE 167

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           I+YA++P FLTIDPIPFDPP+FE  V ER +N  S+E+QL+DRLID+NT+RWRYSRD +Q
Sbjct: 168 IFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQ 227

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
            VFKESN  IVQWSDG+YSLK+G+E TDIL+NDT NTFLTVSHDQQEL+QC  GGEI K+
Sbjct: 228 HVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKT 287

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXX 324
           L+F+P ST SK+HQ+LSKA++RRN  ++ GP + IV++DP          QSQ+      
Sbjct: 288 LMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRR 347

Query: 325 XXXXXXXALESLET---TGFGNNSYSASRKRSTTPMSYGGSRR 364
                    ES +    TGF         ++  +P +YG SRR
Sbjct: 348 RQLKEKEKQESPDAAFETGF---------RKQNSPTTYGASRR 381

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 4/36 (11%)

Query: 425 KRQGTAAY---NDDEKSGSESPKRRKVAVIEDDEDD 457
           KR+G A Y    ++EK  SE+ KRR+VAVIEDDED+
Sbjct: 429 KREGAAMYREEEEEEKDRSET-KRRRVAVIEDDEDE 463

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  325 bits (832), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 191/267 (71%), Gaps = 7/267 (2%)

Query: 90  DEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYYAK 149
           DEE+AMY RKFYGE+  D SD EE+   F+E DV L RHVVP K T  EN+ D TIYY K
Sbjct: 66  DEEEAMYNRKFYGEEGSDMSDHEEEAL-FKEADVELVRHVVPYK-TFPENEDDKTIYYTK 123

Query: 150 VPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVFKE 209
           VP FL+IDP+PFDPP+FEN V+ER +N  S E+QL DRLID+NTIRWRYSRD  QRVFKE
Sbjct: 124 VPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKE 183

Query: 210 SNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLFVP 269
           SNA IVQWSDGSYSLKLG EYTDIL+N TDNTFLTVSHDQQELMQCV GG+I+K+L+F+P
Sbjct: 184 SNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIP 243

Query: 270 ISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXXXXXXX 329
            ST SK+HQRLSKAI RR+     GP +MIVN+DP          Q+Q+           
Sbjct: 244 TSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQMKE 303

Query: 330 XXALESLETTGFGNNSYSASRKRSTTP 356
              LES E   F     S S +RS TP
Sbjct: 304 QERLESPELGAF-----SHSNRRSQTP 325

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  326 bits (835), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 199/283 (70%), Gaps = 12/283 (4%)

Query: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
           +D+DE EEQAMYTRKFYGED  D SDQ+E  H F+EE+V L RH++P+K    E  +   
Sbjct: 102 LDDDEAEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNE 161

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           I+YA++P FLTIDP+PFDPP+FE  V ER +N  SKE+QL+DRLID+NT+RWRYSRD +Q
Sbjct: 162 IFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQ 221

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
            VFKESN  IVQWSDG+YSLK+G+E TDIL+NDT NTFLTVSHDQQEL+QC  GGEI K+
Sbjct: 222 HVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKT 281

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXX 324
           L+F+P ST SK+HQ+LSKA++RRN  +  GP + IV++DP          QSQ+      
Sbjct: 282 LMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRR 341

Query: 325 XXXXXXXALESLET---TGFGNNSYSASRKRSTTPMSYGGSRR 364
                    ES +    TGF         ++ ++P +YG SRR
Sbjct: 342 RQLKEKEKQESPDAAFETGF---------RKQSSPTAYGTSRR 375

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 425 KRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD 457
           K++G A Y  +E   +   KRR+VAVIEDDE++
Sbjct: 430 KKEGAAMYRQEENEDNNETKRRRVAVIEDDEEE 462

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  326 bits (835), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 196/283 (69%), Gaps = 12/283 (4%)

Query: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
           +D+DE EEQAMYTRKFYGED  D SDQ+E  H F+EE++ + RH++P K    E  +   
Sbjct: 130 LDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNE 189

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           I+YA++P FLTID +PFDPP+FE  V ER  N  SKE+QL+DRLID+NT+RWRYSRD +Q
Sbjct: 190 IFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQ 249

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
            VFKESN  IVQWSDGSYSLK+G+E TDIL+NDT NTFLTVSHDQQEL+QC  GGEI K+
Sbjct: 250 HVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKT 309

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXX 324
           L+F+P ST SK+HQ+LSKA++RRN  +  GP + IVN+DP          QSQV      
Sbjct: 310 LMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLRDRRR 369

Query: 325 XXXXXXXALESLET---TGFGNNSYSASRKRSTTPMSYGGSRR 364
                    ES +    TGF         ++ ++P SYG SRR
Sbjct: 370 RQLKEREKQESPDAAFETGF---------RKQSSPTSYGISRR 403

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 425 KRQGTAAYNDDEKSG-SESPKRRKVAVIEDDED 456
           KR+G A Y ++EK   S   KRR+VAVIEDDED
Sbjct: 453 KREGAAMYKEEEKDDDSNETKRRRVAVIEDDED 485

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  316 bits (810), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 186/261 (71%), Gaps = 1/261 (0%)

Query: 88  DEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYY 147
           D DEE+ MY RKFYGED  D SD E+ +HEF+E +V L +H+VP K+  ++      IY 
Sbjct: 95  DMDEEEEMYNRKFYGED-VDMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTNDIYV 153

Query: 148 AKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVF 207
           AKVPPFL IDP PFDP +FE  V +RL   LSKE++L DRLID+NT+RWRYSRD NQ VF
Sbjct: 154 AKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQSVF 213

Query: 208 KESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLF 267
           KESN  IVQWSDGSYSLKLG+EYTDIL+NDTDNTFLTVSHDQQELMQCV GG ++K+L+F
Sbjct: 214 KESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLMF 273

Query: 268 VPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXXXXX 327
           +P ST+SK+HQ+LSKA+ RRN  ++ GP + IV++DP          Q Q+F        
Sbjct: 274 IPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELERKQGQIFKERRRRQL 333

Query: 328 XXXXALESLETTGFGNNSYSA 348
                 ES +TT  G  S SA
Sbjct: 334 REKELAESPDTTIGGPRSGSA 354

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  315 bits (806), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 180/234 (76%), Gaps = 1/234 (0%)

Query: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
           +D++E +E AMYTRKFYGED  + SDQEE  + F EE+V L RH+VP K   E  D  +T
Sbjct: 78  MDDEEAQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKST 137

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           IYYAKVP FLTIDP+PFDPP+FE+ V+ERL N  S+E+QL DRLID+NTIRWRYSRD+NQ
Sbjct: 138 IYYAKVPEFLTIDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQ 196

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
           +V+KESNA IVQWSDG  SLKLG EYTDIL+NDTDNTF  VSHD+QELMQC  GGE++KS
Sbjct: 197 QVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKS 256

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQV 318
           L+F+P ST SK+HQ+L+KA++RR+  +T GP    VN DP          Q QV
Sbjct: 257 LMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQV 310

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 425 KRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD 457
           KRQGT  Y + E     S KRRKVA+I DDEDD
Sbjct: 408 KRQGTERYTEPEPESDPSTKRRKVAII-DDEDD 439

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  312 bits (799), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/231 (61%), Positives = 180/231 (77%), Gaps = 2/231 (0%)

Query: 88  DEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYY 147
           +EDEEQAMY RKFYG+D  + SD E+ + EF+E DV + +H+VP K TS  N  D  +YY
Sbjct: 127 EEDEEQAMYNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYKTTS--NSQDKEVYY 184

Query: 148 AKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVF 207
           AKVP FLTIDP+PFDPP+F+  V  RL    SKE+QL+DRLID+NTIRWRYSRD  Q+VF
Sbjct: 185 AKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVF 244

Query: 208 KESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLF 267
           KESNA I+QWSDG++SL+LGDE++D+L+NDTDNTFLTVSH+QQELMQCV GGEI+K+++F
Sbjct: 245 KESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMF 304

Query: 268 VPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQV 318
           +P ST+SK+HQRLSKA+VRR   E +GP + IV  DP          Q Q+
Sbjct: 305 IPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQI 355

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  306 bits (785), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 153/266 (57%), Positives = 184/266 (69%), Gaps = 6/266 (2%)

Query: 91  EEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYYAKV 150
           +EQ MYTRKFYGED  + SD +E  H F+E +V L RH++P K  +  N+ D  I+YAKV
Sbjct: 107 KEQEMYTRKFYGEDAVNYSDDDE-PHTFKESNVDLIRHIIPYKTRTTNNEHDE-IFYAKV 164

Query: 151 PPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVFKES 210
           P FLTIDP+PFDP TFE  V ERL+   SKE+QL DRLID+NTIRWRYSRD  Q VFKES
Sbjct: 165 PAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKES 224

Query: 211 NATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLFVPI 270
           NA IVQWSDGS+SLKLGDEYTDI++NDTDNTFLTVSHDQQELMQC  GGEI+K+++F+P 
Sbjct: 225 NAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPT 284

Query: 271 STTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXXXXXXXX 330
           ST SK+HQ+LSKA+ RRNA + +GP S I+  DP          Q Q+            
Sbjct: 285 STNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEI 344

Query: 331 XALESLETTGFGNNSYSASRKRSTTP 356
              E+ E  GF     +   KR  TP
Sbjct: 345 ETRENAE-NGFAE---TGEFKRGNTP 366

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  293 bits (749), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 142/220 (64%), Positives = 176/220 (80%), Gaps = 3/220 (1%)

Query: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
           +D++E EE AMYTRKFYGED  D+   EE+  EFREEDV L RH+VP + T  +      
Sbjct: 81  MDDEEAEEHAMYTRKFYGED-VDRVSDEEEAQEFREEDVELVRHIVPYRAT--QGTDKPV 137

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           +YYAK+P FLTIDP+PFDPP+FE  V+ERL N  SKE+QL DRLID+NT+RWRYSRD NQ
Sbjct: 138 LYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQ 197

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
           +VFKESNA IVQWSDG++SLKLGDEYTDIL NDTDNTF  VSHDQQELMQC  GGE++K+
Sbjct: 198 QVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKT 257

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDP 304
           L+F+P ST+S++HQ+L+KA++RR+  +  GP + IV  DP
Sbjct: 258 LMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDP 297

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  292 bits (747), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 138/266 (51%), Positives = 183/266 (68%), Gaps = 4/266 (1%)

Query: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
            +E+ED+EQAMY RKFYG+   D +D  E   EFRE D+ + +H+VP   ++E +  D T
Sbjct: 60  ANEEEDDEQAMYNRKFYGDKGEDSND--EGSQEFREADIDIMKHIVP--YSTEPSQGDKT 115

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           IYY KVP FLTIDPIPFDPP F++ + ER     S E+Q++DRLI++NT+RWRYSRD NQ
Sbjct: 116 IYYTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQ 175

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
           RVFKESNA IVQWSDG+YSL+LGDEYTD+L+NDT++T+L VSHDQQEL+Q V GGE++K+
Sbjct: 176 RVFKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKN 235

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXX 324
           ++F+P ST SK HQRLSKA+ R+   E  GP + I+ +DP          Q Q+      
Sbjct: 236 MIFIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRK 295

Query: 325 XXXXXXXALESLETTGFGNNSYSASR 350
                    E +++    +   SASR
Sbjct: 296 RQLREQQEREGMDSPAPTSKPRSASR 321

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  288 bits (736), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 134/240 (55%), Positives = 182/240 (75%), Gaps = 6/240 (2%)

Query: 86  DEDEDEEQ--AMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVP--TKITSEENDA 141
           DE+ D+EQ  AMY +KFYGED +++SD +++++E++E D+ L RH+VP  T+ +++E D 
Sbjct: 47  DENSDDEQDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDK 106

Query: 142 DTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRD 201
              +YYAKVPPFL +DP+PFD   FE+ V+ER+ N L+++ Q+ DRL D+NTIRWRYSRD
Sbjct: 107 HRELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRD 166

Query: 202 --DNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGG 259
             DN +VFK+SNA I+QWSDGSYSLKLG++YTDIL N+TDN FLTVSHDQQELMQC +GG
Sbjct: 167 SNDNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGG 226

Query: 260 EISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVF 319
           EI+K+L+F+P ST SK+HQRL+ A+  R+   T GP  M++N DP          Q Q+ 
Sbjct: 227 EITKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMM 286

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  285 bits (730), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 172/220 (78%), Gaps = 5/220 (2%)

Query: 88  DEDEEQAMYTRKFYGEDDYDKSDQE---EDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
           DE++EQ MY RKFYG DD  K+  E   E++ E +E +V + +HVVP   T+  ++ D++
Sbjct: 82  DEEDEQEMYNRKFYG-DDLKKTSYESDVEEEREIKEANVQIMKHVVPY-YTTNASEKDSS 139

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           +YYAKVP FLTIDPIPFDPP F++ + +RL    SKE+QL DRLID+NTIRWRYSR  NQ
Sbjct: 140 LYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQ 199

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
           +VFKESNA I+QWSDG++SLKLGDE++DIL+ND +NT++TVSH+Q+ELMQCV GGEI KS
Sbjct: 200 QVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKS 259

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDP 304
           +LF+P ST SK HQRLS AI RR A E  GP + IV +DP
Sbjct: 260 MLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDP 299

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  283 bits (725), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 136/271 (50%), Positives = 182/271 (67%), Gaps = 9/271 (3%)

Query: 93  QAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYYAKVPP 152
           QAMY RKFYG D+ + S+ E  + EFRE DV + +HVVP      E   D TI+YAKVP 
Sbjct: 81  QAMYNRKFYG-DNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSE--GDKTIFYAKVPQ 137

Query: 153 FLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVFKESNA 212
           FLTIDPIPFDPP F+N + +R     S E+Q++DRLI++NT+RWRYSRD  Q+VFKESNA
Sbjct: 138 FLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNA 197

Query: 213 TIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLFVPIST 272
            IVQWSDG++SL+LGDE+TD+L+NDT++T+LTVSHDQQEL+Q V GGE++K+++F+P ST
Sbjct: 198 QIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTST 257

Query: 273 TSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVFXXXXXXXXXXXXA 332
            SK HQRLSKA+ R+   E  GP + I+ +DP          Q Q+              
Sbjct: 258 NSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQE 317

Query: 333 LESLETTGFGNNSYSASRKRSTTPMSYGGSR 363
            E L++         A++ +ST+ + Y  SR
Sbjct: 318 REGLDSPA------PAAKPKSTSSLGYSQSR 342

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  276 bits (705), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 178/235 (75%), Gaps = 3/235 (1%)

Query: 85  VDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTT 144
           +D++EDEEQAMY RKF GED Y+   +EE + +++E DV + +HVVP K  +  +D   T
Sbjct: 62  IDDEEDEEQAMYNRKFLGED-YEGQSEEEYEKKYKEVDVEIVKHVVPYKTANGADDK--T 118

Query: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204
           IYYAKVP FLTIDP+PFDPP+F+  V +R++   SKE+QL DRLI++NTIRWRYSRD ++
Sbjct: 119 IYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDE 178

Query: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264
           RVFKESNA IV+WSDG++SLK+GDEYTDIL+N+T+NT+LTVSH++QEL+QCV GGEI+KS
Sbjct: 179 RVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKS 238

Query: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVF 319
           ++FVP ST SK+H+ LSKA+ RR+     GP + I   DP            Q+ 
Sbjct: 239 MMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQIL 293

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  270 bits (689), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 128/234 (54%), Positives = 166/234 (70%), Gaps = 3/234 (1%)

Query: 88  DEDEEQAMYTRKFYGEDDYDKSD--QEEDKHEFREEDVVLTRHVVPTKITSEENDADTTI 145
           +++EEQ MY RKFYG+D    SD   E++  E +E D+ L +HVVP  + ++  +    +
Sbjct: 77  EDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPL-LYNKPLEGKRLL 135

Query: 146 YYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQR 205
           YY KVP FLTIDP+PFDPP+F+  + +R+    SKE+QL D LID+NTIRWRYSR  +QR
Sbjct: 136 YYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQR 195

Query: 206 VFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSL 265
           VFKESNA +++WSDG+ SLKLGDEYTDIL N+ +NT+LTVSH+QQE+MQCV GG IS S+
Sbjct: 196 VFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSM 255

Query: 266 LFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPXXXXXXXXXXQSQVF 319
           LF+P ST SK+H+RL+KAI RR A E  GP + IV  DP            QV 
Sbjct: 256 LFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVL 309

>Ecym_4246 Chr4 complement(508900..513981) [5082 bp, 1693 aa] {ON}
            similar to Ashbya gossypii AGL187W
          Length = 1693

 Score = 32.3 bits (72), Expect = 2.9,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 237  DTDNTFLTVSHDQQELMQCVHGGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMG 294
            D +   LTV H  Q L+   + G    +LLF  ++TT+K     S A+ + +A+E +G
Sbjct: 1180 DGNRPVLTVPHLMQSLLNTCNKGS---TLLFSTVNTTTKRANEPSMAVSKLDASEILG 1234

>Smik_12.392 Chr12 (686149..687087) [939 bp, 312 aa] {ON} YLR308W
           (REAL)
          Length = 312

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 158 PIPFDPP--TFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVFKESNATIV 215
           P  F PP    +N VR      ++++  L+  L D +T  W    DD+    +E    ++
Sbjct: 206 PKWFRPPYGGIDNRVR-----AITRQFGLQAVLWDHDTFDWSLLLDDSGTTEQEILQNVI 260

Query: 216 QWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLL 266
            W+     L L  + T+  +N        + +DQ  +  CV G +  K  L
Sbjct: 261 NWNKTGTGLILEHDSTEKTVNLAIKINDVIGNDQSTISHCVGGIDYIKEFL 311

>AGR237C Chr7 complement(1193439..1196531) [3093 bp, 1030 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR030W
           (MET10)
          Length = 1030

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 34/85 (40%), Gaps = 13/85 (15%)

Query: 158 PIPFDPPTFENVVRERLTN----GLSKEEQLEDRLIDQNTIRWRYSRDDNQRV------- 206
           P PF+ P F  +V E  TN    G  +E      L    +    YS   N RV       
Sbjct: 275 PSPFNGPAFVKIVPESATNIVVIGQCQENNTYSWLKSTISAALFYSNKRNIRVSEYIFHP 334

Query: 207 --FKESNATIVQWSDGSYSLKLGDE 229
             F   NA +   ++  YSLKLG +
Sbjct: 335 DFFWSPNAVVQILNEFDYSLKLGSD 359

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,167,639
Number of extensions: 1618657
Number of successful extensions: 11049
Number of sequences better than 10.0: 122
Number of HSP's gapped: 11119
Number of HSP's successfully gapped: 149
Length of query: 457
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 344
Effective length of database: 40,524,141
Effective search space: 13940304504
Effective search space used: 13940304504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)