Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.255.441ON53353327100.0
ZYRO0F10186g5.441ON51952814770.0
TDEL0D026005.441ON52353414710.0
SAKL0G02684g5.441ON53951913540.0
TBLA0A027905.441ON54756013121e-176
NDAI0B057105.441ON56348213111e-176
TPHA0E017205.441ON53747212721e-170
NCAS0F034205.441ON52553312491e-167
CAGL0A02904g5.441ON50152311721e-156
Suva_2.5435.441ON51151811611e-154
Skud_4.6405.441ON51148011481e-152
Smik_4.6375.441ON51151811261e-149
YDR371W (CTS2)5.441ON51152811191e-148
KLLA0E02333g5.441ON48052710971e-145
KNAG0C048705.441ON45851410771e-142
KAFR0E038105.441ON49046510801e-142
KLTH0F15906g5.441ON51547910631e-139
Ecym_45125.441ON52752610631e-139
ACL166W5.441ON49051410151e-132
Kwal_55.214025.441ON5165189991e-129
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.25
         (533 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...  1048   0.0  
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   573   0.0  
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   571   0.0  
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   526   0.0  
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   509   e-176
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   509   e-176
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   494   e-170
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   485   e-167
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   456   e-156
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   451   e-154
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   446   e-152
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   438   e-149
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   435   e-148
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   427   e-145
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   419   e-142
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   420   e-142
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   414   e-139
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   414   e-139
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   395   e-132
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   389   e-129

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score = 1048 bits (2710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/533 (95%), Positives = 509/533 (95%)

Query: 1   MIRVNQKWWVALALLFVIISIMVESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNP 60
           MIRVNQKWWVALALLFVIISIMVESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNP
Sbjct: 1   MIRVNQKWWVALALLFVIISIMVESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNP 60

Query: 61  DSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMD 120
           DSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMD
Sbjct: 61  DSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMD 120

Query: 121 CYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGW 180
           CYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGW
Sbjct: 121 CYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGW 180

Query: 181 SNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLK 240
           SNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLK
Sbjct: 181 SNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLK 240

Query: 241 WKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDY 300
           WKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDY
Sbjct: 241 WKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDY 300

Query: 301 HGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKY 360
           HGEWSEKTGYHSNLYSPQET                        SNLNGDYAINYVIKKY
Sbjct: 301 HGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKY 360

Query: 361 HINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSL 420
           HINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSL
Sbjct: 361 HINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSL 420

Query: 421 EEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKS 480
           EEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKS
Sbjct: 421 EEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKS 480

Query: 481 LLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYRDEIY 533
           LLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYRDEIY
Sbjct: 481 LLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYRDEIY 533

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/528 (52%), Positives = 372/528 (70%), Gaps = 22/528 (4%)

Query: 5   NQKWW-VALALLFVIISIMVESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNN---- 59
           NQ W+  ++ L F+I SI++E   Y+K  K  S E  + D ++E      + F ++    
Sbjct: 5   NQPWFNHSIILAFIIASIVIEMCFYRKIFK-SSAEHDVLDHVHEVGDGSLQQFKDHHTVI 63

Query: 60  PDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEM 119
            D GY  G+YYS+WSPY PR H PHD+DFS+++H+YYAFF++D  TG L +SD WSDF+M
Sbjct: 64  GDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQM 123

Query: 120 DCYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGG 179
           D YKPLA+KL +LQL +         LP GC+GELFYLRH+ + D +  R FK++M+VGG
Sbjct: 124 DLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGG 183

Query: 180 WSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKL 239
           WSNR+ +P+M+RD ++++ F+NSC+E MF YGFDGI+LDWEFP++D  EP+MYLEL +K+
Sbjct: 184 WSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKM 243

Query: 240 KWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYD 299
           + K +ELE+ IF  +G  NH   PKF LS+A PAFK+KL++L ++E+D Y+DVWNMMTYD
Sbjct: 244 RLKFDELEEVIF--AGEPNH---PKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYD 298

Query: 300 YHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKK 359
           YHGEWS  TGYH NLY                               L+ + AI+ +I +
Sbjct: 299 YHGEWSPVTGYHCNLYD-----------GPVKVHSQYKHDSSSDDEGLDANSAISDMINR 347

Query: 360 YHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNS 419
           + ++ +KI LGMAAYGRGFT V ASS D RFI+K + GVGGASEGEPGMWLYNQLPIK S
Sbjct: 348 FGVDSRKITLGMAAYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGS 407

Query: 420 LEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEK 479
            EE+DP+YVS FC+D K+KTFVGYDN +S+KVKA YVKE  L+GGFWWESCGD+H +P++
Sbjct: 408 KEEYDPEYVSGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQR 467

Query: 480 SLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLL 527
           SLLNAFT  I ++ +   +++   E L+YYL+  G   FLS FI++++
Sbjct: 468 SLLNAFTGRIKTIAKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRII 515

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/534 (52%), Positives = 362/534 (67%), Gaps = 29/534 (5%)

Query: 4   VNQKWWVALALLFVII--SIMVESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPD 61
           + ++ W++  ++ ++I  SI VE   Y+K     ++ + ++   ++ Q     + P   +
Sbjct: 1   MQRRPWLSHTVIIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVE 60

Query: 62  SG-YDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMD 120
            G Y  G+YYSNWSPY+PR+H PHD+D SR++H+YYAFF+VD  TGAL   D WSD  MD
Sbjct: 61  PGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMD 120

Query: 121 CYKPLAMKLKKLQLDHFFNPKFKNGL-------PMGCIGELFYLRHSQLFDSNNSRKFKL 173
            YKP+A+KL KL      NP+ KN L       P GC+GELFY+R++ LF + N R FK+
Sbjct: 121 LYKPMAIKLNKL------NPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKV 174

Query: 174 IMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYL 233
           IM VGGWSNRE FP+M+R+ K++D F++SCIE MF YGFDGI+LDWEFP+DD  EP+MYL
Sbjct: 175 IMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYL 234

Query: 234 ELVKKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVW 293
           +L K+LK + NELE  IF    N NH   PKF LS+A PAF EKLDIL + EMD Y+D+W
Sbjct: 235 QLAKRLKERMNELEDAIF--GPNMNH---PKFQLSMATPAFSEKLDILPITEMDKYIDIW 289

Query: 294 NMMTYDYHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAI 353
           NMMTYDYHGEWSEKTGYH NLY+                              L+   AI
Sbjct: 290 NMMTYDYHGEWSEKTGYHCNLYN--------GSTKSFDETHQKHIYSTESVEGLDAHSAI 341

Query: 354 NYVIKKYHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQ 413
            +++    +N  KI LGMAAYGRGFT V A S D RFI+KP+ GVGGAS+GEPGMWLYNQ
Sbjct: 342 EHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQ 401

Query: 414 LPIKNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDD 473
           LPI+ + E FDPDYVS FCY   SKTFVGYD+ +S++ KAQYV+E NL GGFWWESCGDD
Sbjct: 402 LPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDD 461

Query: 474 HKNPEKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLL 527
           H N  +SLLNAFT+EI  V++ ++ M+    VL+YY+   G+  FLS FI+ LL
Sbjct: 462 HANQSRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLL 515

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/519 (50%), Positives = 348/519 (67%), Gaps = 33/519 (6%)

Query: 13  ALLFVIISIMVESF---LYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPDSGYDVGVY 69
           +LLF+ +S+   +      QKF +  S   S +++ N  + V   S   N    Y  GVY
Sbjct: 38  SLLFLEMSVFFGTLKGRATQKFKQIYSDMNSNDNNQNLQEEVGPAS---NDSQSYISGVY 94

Query: 70  YSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKL 129
           Y+NWSPY PR H PHDM+F R+T+V+Y+FFVVD K+G + +SD WSDF+MD YK    + 
Sbjct: 95  YTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQF 154

Query: 130 KKLQLDHFFNPKF----KNGLPMGCIGELFYLRHSQLFDSNNS----RKFKLIMSVGGWS 181
           K   L    +  F    K  LPMGCIGELFYL++S +  S +     R FK+ MSVGGWS
Sbjct: 155 KAALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWS 214

Query: 182 NREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKW 241
           NR+AFP ++RD  K D F+ +C+E MF YGFDG+++DWEFP++D LEPKMYL ++++L+ 
Sbjct: 215 NRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIRRLRE 274

Query: 242 KQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYH 301
             ++LE+ IF +  +  H     F L++A PAFKEKL +L +R+MD YVD WN+M YDYH
Sbjct: 275 ALDDLERDIFQDEHHSEH-----FFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYH 329

Query: 302 GEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYH 361
           GEWSE TGYHSNLYS                            + LN D A+ Y++K + 
Sbjct: 330 GEWSELTGYHSNLYSEDSNHVHRRHFRDEE-------------NQLNADSAVKYLLKNFG 376

Query: 362 INPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLE 421
           IN +K+ LGMAAYGRGFT+V  ++    +I KPY GVGGASEGEPGMWLYNQLP+  +LE
Sbjct: 377 INSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLE 436

Query: 422 EFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSL 481
            FDP  VSA+ +D KSKTFVGYDN DSM+ KAQYVK HNL GGFWWESCGD+HK+ +KSL
Sbjct: 437 NFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSL 496

Query: 482 LNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLS 520
           LNAFT+++GS+ ++  +++T+  V++YYLK     GFLS
Sbjct: 497 LNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNY-PQGFLS 534

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  509 bits (1312), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 257/560 (45%), Positives = 358/560 (63%), Gaps = 56/560 (10%)

Query: 8   WWVALALLFVIISIMVESFLYQKF------------LKHGSKEESIEDSINESQIVYGKS 55
           W   + L F+ I+++ E   Y K             L+  +K E + +  NE +     +
Sbjct: 9   WRATIILTFIAITLITEMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTN 68

Query: 56  FPNNPDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWS 115
                  GY  GVYYSNWSPY+PR H PHD+DFSR++HVYY+FF+V+   G +   D WS
Sbjct: 69  LTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWS 128

Query: 116 DFEMDCYKPLAMKLKKLQ--LDHFFNPK----FKNGLPMGCIGELFYLRHSQLF---DSN 166
           D EMD YKPL++KL KL+  +D +  P+     K  LP GCIGE FYLR+S+L    ++ 
Sbjct: 129 DIEMDLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTE 188

Query: 167 NSRKFKLIMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDK 226
           NS+ FK+IM++GGWSNR++FP+M +  +K+  FV S IE MF YGFDGI+LDWEFPK++ 
Sbjct: 189 NSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNT 248

Query: 227 LEPKMYLELVKKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREM 286
            EP +YL+++++L+   NELE++I+ NS      +R  F LS+A+PAF+EKL +L ++EM
Sbjct: 249 QEPAVYLKIMQQLRQGMNELEEEIYKNSAVP-VEERKHFQLSVASPAFEEKLSVLPIKEM 307

Query: 287 DHYVDVWNMMTYDYHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSN 346
           +  +D WNMMTYDY+GEWSEKTGYHSNLY   +                           
Sbjct: 308 NKVLDYWNMMTYDYNGEWSEKTGYHSNLYDGSKVKHDEEV-------------------- 347

Query: 347 LNGDYAINYVIKKYHINPKKINLGMAAYGRGFTKVNAS--------------SQDTRFIN 392
           LN D AI Y+I+   + P K+ LG+A YGRG+T VN +              + D  FI+
Sbjct: 348 LNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFID 407

Query: 393 KPYRGVGGASEGEPGMWLYNQLPIKNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVK 452
             Y+GVGG SEGEPGMW+YNQLPIK S+E+FDP +VSA+CYD K+ T V YDN +SM VK
Sbjct: 408 LEYKGVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVK 467

Query: 453 AQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKT 512
            QYVK+  L GGF WESCGD H NP++SL+ AFT+E+G + ++  ++F + +  ++YL+ 
Sbjct: 468 GQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEE 527

Query: 513 KGDTGFLSTFIMKLLYRDEI 532
            G+ G+LS  I KLL +D++
Sbjct: 528 FGNEGYLSEAIAKLLNKDKM 547

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  509 bits (1311), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 254/482 (52%), Positives = 326/482 (67%), Gaps = 38/482 (7%)

Query: 67  GVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLA 126
           GVYYS+WSPY PR H PHD+D +++THVYY+FF+V+  TG +T SD WSD +MD YKPL+
Sbjct: 96  GVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYKPLS 155

Query: 127 MKLKKL-QLDHFFN-----------PKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLI 174
           +KL  L Q D   +            K K  LP+GC+GELFYL+  Q         FKLI
Sbjct: 156 LKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQ--------NFKLI 207

Query: 175 MSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLE 234
           MS+GGWSNRE FP M+RD  KL+ F+ S +E MF YGFDGI+LDWEFP+DD  EP  YLE
Sbjct: 208 MSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLE 267

Query: 235 LVKKLKWKQNELEQKIFNNSGNGNHS-----KRPKFHLSIAAPAFKEKLDILLMREMDHY 289
           +V++L+ + ++LE  IF  S    H        PKF LS+A PAF EKL+IL ++EM+ Y
Sbjct: 268 IVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPIKEMNKY 327

Query: 290 VDVWNMMTYDYHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNG 349
           +D WNMMTYDY+G+WSE+TGYH NLY                               LN 
Sbjct: 328 IDYWNMMTYDYYGDWSEETGYHCNLYEGGNN---------GTINAQYKHEHTSSNKGLNA 378

Query: 350 DYAINYVIKKYHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMW 409
           + AINY++   +++ +K+ LG+AAYGRGFTKV  +  D  FINK + GVGGAS GEPGMW
Sbjct: 379 NDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGMW 438

Query: 410 LYNQLPIKNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWES 469
           LYNQLPIKNS E FDP+YVSAFCYD K+KTFVGYDN D+MKVKA+YV++ +L GGFWWES
Sbjct: 439 LYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWES 498

Query: 470 CGDDHKNPEKSLLNAFTDEIGSVT----EKNETMFTNIEVLKYYLKTKGDTGFLSTFIMK 525
           CGDDHK+PE+SLLNAFT+++        E +  ++   + +KYYL   G+ GFLS F ++
Sbjct: 499 CGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQ 558

Query: 526 LL 527
           ++
Sbjct: 559 IM 560

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  494 bits (1272), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 327/472 (69%), Gaps = 16/472 (3%)

Query: 61  DSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMD 120
           +S Y +GVYYSNWSPY+PRL  PHD+D SR++HVYY+F +VD   G + +SD WSDF++D
Sbjct: 75  NSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQID 134

Query: 121 CYKPLAMKLKKLQLDHFFNPKF--KNGLPMGCIGELFYLRHSQL-FDSNNSRKFKLIMSV 177
            YKPL + L ++  D    P    K  LPMGCIGE FYLR++++      S  FK+ MSV
Sbjct: 135 MYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSV 194

Query: 178 GGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVK 237
           GGWSNREAFP+M+RD +K+D F+NSCI+ MF YGFDGI+LDWEFP+DD  EP MYL+++K
Sbjct: 195 GGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIK 254

Query: 238 KLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMT 297
           +LK K  ELE  I+ ++ + N S  P F LSIAAPAF EKL IL +++MD +VD WNMMT
Sbjct: 255 RLKMKMLELEATIYKDAISHNTS-YPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMT 313

Query: 298 YDYHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVI 357
           YDY GEWS+ TGYHSNL+SP +                           L GD A+ Y+ 
Sbjct: 314 YDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSN-----------ETLCGDNAVKYMK 362

Query: 358 KKYHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIK 417
               I+ +KI LGMAAYGRGF+ V+ S  + +   K + GV G+S  EPG+WLYN+LPIK
Sbjct: 363 DNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIK 422

Query: 418 NSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNP 477
            S EEFD + VSA+CYD KSK FV YDN  SM +K++YV+++NL GGF WE+CG+   NP
Sbjct: 423 GSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNP 482

Query: 478 EKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYR 529
           + SL+N+FT ++ ++ +K ++MF+N +VL+YYL   G  GFLS +I+ +L R
Sbjct: 483 KLSLINSFTFDMNNI-DKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNR 533

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  485 bits (1249), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 247/533 (46%), Positives = 342/533 (64%), Gaps = 32/533 (6%)

Query: 6   QKWWVALALLFV--IISIMVESFLYQKFLKHGSKEESIEDSI------NESQIVYGKSFP 57
           +K+++   +LF   I+ ++++  L++ + K  + ++ I+         N  +I Y  +  
Sbjct: 7   RKFFLNTGVLFALAIVVLVLQMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQT 66

Query: 58  N-NPDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSD 116
           N N + GY  G+YYS+WSPY PR H PHD+D +R++H+YYAFF+VD KTG L  SD WSD
Sbjct: 67  NSNGEKGYLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSD 126

Query: 117 FEMDCYKPLAMKLKKLQLDHFFNP---KFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKL 173
            +MD YKPL++KL  L L     P   + K  LP+GCIGELFYL+HS +    +S K  +
Sbjct: 127 LQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTK--M 184

Query: 174 IMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYL 233
           I+S+GGWSNR+ FP ++RD++K + F++S +E MF YGFDGI+LDWEFPKDD LEP  YL
Sbjct: 185 ILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYL 244

Query: 234 ELVKKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVW 293
           E++ KL+ K ++LE +IF     G     PKF LS+A PAF  KL IL + +MD YVD W
Sbjct: 245 EMISKLRRKMDDLELEIF-----GETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYW 299

Query: 294 NMMTYDYHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAI 353
           NMMTYDY+G WSE TGYH NL++   +                        + LN + AI
Sbjct: 300 NMMTYDYYGSWSEATGYHCNLFNGDGSEFRAGYKHEHTAHN----------NGLNANEAI 349

Query: 354 NYVIKKYHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEG-EPGMWLYN 412
           +++IK  ++   K+ LGMAAYGR F  V +       IN+ ++GVG    G EPGMWLYN
Sbjct: 350 DFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYN 409

Query: 413 QLPIKNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGD 472
           QLP+K ++E +DP+Y +AFCYDKKS+TF+GYDN DS+K+KAQYV+   L GGFWWESCGD
Sbjct: 410 QLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGD 469

Query: 473 DHKNPEKSLLNAFTDEIGSVTE--KNETMFTNIEVLKYYLKTKGDTGFLSTFI 523
           DH N  +SLL  F++E+  + +    + +F   E + YYL   G  GFLS  +
Sbjct: 470 DHINKRRSLLYNFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGIL 522

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  456 bits (1172), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 236/523 (45%), Positives = 331/523 (63%), Gaps = 46/523 (8%)

Query: 14  LLFVIISIMVE-SFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPDSGYDVGVYYSN 72
           ++ +I S++++ S  Y+ F K   + +S +  + ES ++         ++ Y  G+YYSN
Sbjct: 13  IVILITSLILQMSLHYKIFQKLKRRSQSDDYRMPESDVL--------SNTSYIAGLYYSN 64

Query: 73  WSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKL 132
           WSPY PRLH PHD+DF +++H+YYAF ++D +TG LT+SD WSD +++    LA + ++ 
Sbjct: 65  WSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLN----LAKQCREY 120

Query: 133 QLDHFFNPKFKN----GLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPR 188
               F   + K       P GCIGEL YLR+  ++     R  KLIMSVGGWSNRE+FP 
Sbjct: 121 MFKRFTGDELKAVTNIRAPPGCIGELNYLRY--IYSKIKKRNVKLIMSVGGWSNRESFPI 178

Query: 189 MIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQ 248
           M+RD  K   F+NSCIE M  YGFDGI+LDWEFP+DD  EP  YL + ++LK +  +LE 
Sbjct: 179 MVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEA 238

Query: 249 KIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKT 308
            I      G+HS +  F LS+A PAFK+KL IL + ++D Y+D+WN+MTYDY+GEWSE+T
Sbjct: 239 NIL-----GDHSNK-TFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERT 292

Query: 309 GYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHINPKKIN 368
           G H+NLY+ +                          + L+GD AINY++ +  I+P+K+ 
Sbjct: 293 GLHANLYNEK--------------GKLLHLHRHDEDAGLSGDAAINYMVNRCKIDPRKVI 338

Query: 369 LGMAAYGRGFTKVNASSQDTRFINKPY----RGVGGASEGEPGMWLYNQLPIKNSLEEFD 424
           LGMAAYGRGFT V+  S +    + PY     GVGGASEGEPGMWLYNQLPI  S E++D
Sbjct: 339 LGMAAYGRGFTNVDMKSTNP---HNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYD 395

Query: 425 PDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNA 484
             +V A+CYD ++ T VGYDN  S+  KA Y+  ++L G FWWESCGD HKNP++SLLN 
Sbjct: 396 YRHVGAYCYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNT 455

Query: 485 FTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLL 527
           +   I +V    ET+++  ++  YYL+     GFL+ FI  ++
Sbjct: 456 YIRVIRNVKNNKETIYSTTKLHDYYLENYDTNGFLTGFIKDII 498

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  451 bits (1161), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 232/518 (44%), Positives = 329/518 (63%), Gaps = 55/518 (10%)

Query: 24  ESFLYQKFLKHGSKEESIEDSINESQ-----IVYGKSFPNNPDSGYDVGVYYSNWSPYTP 78
           E  LY K  K+  + E I D+    +     +V  +  P+  D GY  GVYYSNWSPY P
Sbjct: 30  EMCLYNKLFKN-QRSEDIRDNFQNGRHQVPNMVQNQK-PSGDDDGYVSGVYYSNWSPYKP 87

Query: 79  RLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQLDHFF 138
           R H PHD++  +++HVYYAFF +D KTG + ++D+WSD EMD YKPLA+K  +L  D+  
Sbjct: 88  RFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLD 147

Query: 139 NPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRMIRDSKKLDA 198
           +   ++ LP+GCIGELFYL+     ++ + RKFK IMS+GGWS+ E F  ++++ K L  
Sbjct: 148 DNNMQSILPLGCIGELFYLK-----NACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQN 202

Query: 199 FVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKIFNNSGNGN 258
           FV+S +E MF  GFDGI++DWEFP+++K+EP+ YL+LV+ L+ K N LE +IF       
Sbjct: 203 FVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGG----- 257

Query: 259 HSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSNLYSPQ 318
            S +  F LSIAAPAFK+KL  L + E+D Y+D WNMMTYDY+G WSE TGYHSNL+S  
Sbjct: 258 -STKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSET 316

Query: 319 ETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHINPKKINLGMAAYGRGF 378
           E                           L+G++AI+Y+I ++ +NP+K+ LGMAAYGR F
Sbjct: 317 E---------------------------LSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF 349

Query: 379 ----TKVNASSQDTRFINKPYRGVG------GASEGEPGMWLYNQLPIKNSLEEFDPDYV 428
                K    +++T  IN+ ++GVG        ++G+ G+W Y  LP K + E++DP YV
Sbjct: 350 HIKDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYV 409

Query: 429 SAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTDE 488
           SA+C+D+K+  F+GYDN +S+K KA YV    L GGFWWESCG+D+ +  +SL+NAF + 
Sbjct: 410 SAYCFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEA 469

Query: 489 IGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKL 526
           +        +MF +  V+KYYL   GD GFL+ ++  L
Sbjct: 470 LHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYLKHL 507

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  446 bits (1148), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 221/480 (46%), Positives = 315/480 (65%), Gaps = 49/480 (10%)

Query: 57  PNNPDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSD 116
           P++   GY  GVYYSNWSPYTPR H PHD++  +++HVYYAFF ++SKTG + ++D+WSD
Sbjct: 66  PHDGGKGYVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSD 125

Query: 117 FEMDCYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMS 176
            EM+ YKPLA+K  +L +++  N   +N LP+GC+GELFYL+     ++ + +KFK+IMS
Sbjct: 126 LEMNLYKPLAIKSSQL-VENNLNDSVQNILPLGCVGELFYLK-----NACSEKKFKVIMS 179

Query: 177 VGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELV 236
           +GGWS+ E F  ++ D K L  FV+S +E MF  GFDGI++DWEFP+++K+EP+ YL+LV
Sbjct: 180 IGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLV 239

Query: 237 KKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMM 296
           K L+ K N LE +IF        S    F +SIAAPAFK+KL  L + E+D Y+D WNMM
Sbjct: 240 KMLRLKLNNLESQIF------GESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMM 293

Query: 297 TYDYHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYV 356
           TYDY+G WSE TGYHSNL+S  E                           L+G++A++Y+
Sbjct: 294 TYDYYGSWSETTGYHSNLFSETE---------------------------LSGNFAMHYM 326

Query: 357 IKKYHINPKKINLGMAAYGRGF----TKVNASSQDTRFINKPYRGVG------GASEGEP 406
           I ++ ++  K+ LGMAAYGR F    +K    +Q+T  IN+ ++GVG        ++G+ 
Sbjct: 327 IDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKE 386

Query: 407 GMWLYNQLPIKNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFW 466
           G+W Y  LP K ++E++DP YVSA+C+D+K+  F+ YDN  S K KA+YV  + L GGFW
Sbjct: 387 GIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFW 446

Query: 467 WESCGDDHKNPEKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKL 526
           WESCG+ H N  +SL+NAF + I        +MF ++ V+K+YL   GD GFLS ++  L
Sbjct: 447 WESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLKHL 506

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  438 bits (1126), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 233/518 (44%), Positives = 326/518 (62%), Gaps = 62/518 (11%)

Query: 24  ESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPN-------NPDS-GYDVGVYYSNWSP 75
           E  LY+K  K+  +   I DS N      G   PN       N D  G+  GVYYSNWSP
Sbjct: 30  EMCLYKKIFKN-QRSNKIRDSFNNG----GHKVPNMDQTQGPNVDGEGFVSGVYYSNWSP 84

Query: 76  YTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQLD 135
           Y PR H PHD++ ++++HVYYAFF ++ +TG + ++DNWSD EM+ YKPLA+K  +L +D
Sbjct: 85  YKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSEL-ID 143

Query: 136 HFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRMIRDSKK 195
              +   +  LP+GCIGELFYL+HS      + +KFK+IMS+GGWS+ E F  +I++   
Sbjct: 144 GNSSNDIQKILPLGCIGELFYLKHSC-----SGKKFKVIMSIGGWSDSENFKVIIKNENL 198

Query: 196 LDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKIFNNSG 255
           L AFV+S +E MF  GFDGI+LDWEFP+++K EP+ YL+LV+ L+ K N LE +IF   G
Sbjct: 199 LQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIF-GEG 257

Query: 256 NGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSNLY 315
             +H     F LSIAAPAFK+KL  L + E+D Y+D WNMMTYDY+G WSE TGYHSNL+
Sbjct: 258 VEDH-----FQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF 312

Query: 316 SPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHINPKKINLGMAAYG 375
           S  E                           L+G++AI+Y+I K+ IN +K+ LGMAAYG
Sbjct: 313 SETE---------------------------LSGNFAIHYMIDKFGINSRKLVLGMAAYG 345

Query: 376 RGF----TKVNASSQDTRFINKPYRGVG------GASEGEPGMWLYNQLPIKNSLEEFDP 425
           R F    +     +Q+T  IN+ ++GVG        ++G+ G+W Y  LP K ++E +DP
Sbjct: 346 RSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDP 405

Query: 426 DYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAF 485
            YVSA+C+D+K+  F+ YDN  S+K KA+YV  + L GGFWWESCG+ + N  +SL++AF
Sbjct: 406 KYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAF 465

Query: 486 TDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFI 523
            + + S      +MF N  V+ +YL   G+ GFL+ ++
Sbjct: 466 NEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLTPYL 503

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  435 bits (1119), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 232/528 (43%), Positives = 326/528 (61%), Gaps = 66/528 (12%)

Query: 24  ESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNN--------PDSGYDVGVYYSNWSP 75
           E  LY K  K+  + + I D+ N      G   P+N         D  +  GVYYSNWSP
Sbjct: 30  EMCLYNKIFKN-QRSDDIRDNFNNG----GHRVPSNVQNHGTHIRDEAFISGVYYSNWSP 84

Query: 76  YTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQLD 135
           Y PR H PHD++  +++H+YYAFF ++S+TG +  +D+WSD EM+ YK LA+K  +L + 
Sbjct: 85  YKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSEL-IK 143

Query: 136 HFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRMIRDSKK 195
              N   +N LP+GCIGELFYL+     ++ + +KFK+IMS+GGWS+ E F  +I+D K 
Sbjct: 144 ESSNNSVQNILPLGCIGELFYLK-----NTCSDKKFKVIMSIGGWSDSENFKIIIKDDKL 198

Query: 196 LDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKIFNNSG 255
           L  FV+S +E MF  GFDGI+LDWEFP +++ EP+ YL+LV+ L+ K N LE +IF    
Sbjct: 199 LQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIF---- 254

Query: 256 NGNHSKRPK--FHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSN 313
                KR +  F LSIAAPAFK+KL  L + E+D YVD WNMMTYDY+G WSE TGYHSN
Sbjct: 255 ----GKRTEDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSN 310

Query: 314 LYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHINPKKINLGMAA 373
           L+S  E                           LNG++A++Y+I ++ +N +K+ LGMAA
Sbjct: 311 LFSETE---------------------------LNGNFAMHYMIDRFGVNSRKLVLGMAA 343

Query: 374 YGRGF----TKVNASSQDTRFINKPYRGVG------GASEGEPGMWLYNQLPIKNSLEEF 423
           YGR F     K    +Q+T  INK ++GVG        ++G+ G+W Y  LP   ++E++
Sbjct: 344 YGRSFHIKDNKFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQY 403

Query: 424 DPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLN 483
           DP YVSA+C+D+K+  F+ YDN  S+K KA+YV  +NL GGFWWESCG+ + N  +SL+N
Sbjct: 404 DPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLIN 463

Query: 484 AFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYRDE 531
           AF + +        ++F ++ V KYYL   GD GFLS ++  L  R +
Sbjct: 464 AFNEGLHFNVSSKPSIFQDVRVKKYYLNKYGDGGFLSPYLKHLDSRKQ 511

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  427 bits (1097), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 226/527 (42%), Positives = 326/527 (61%), Gaps = 54/527 (10%)

Query: 1   MIRVNQKWWVALALLFVIISIMVESFLY-QKFLKHGSKEESIEDSINESQIVYGKSFPNN 59
           + +++ K+W+ + +L  I+ + +  +L+  K  K GS        I+    V     P+ 
Sbjct: 7   ITKLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRV-----PSE 61

Query: 60  PDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEM 119
              G+ V  YYSNWSPY  R H P D+  S+LTHVYYAFFVVD+K+GA+ +SD+WSDFE+
Sbjct: 62  GPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL 121

Query: 120 DCYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGG 179
               PL++ +K                  GCI EL      Q     +  +FK I+ +GG
Sbjct: 122 ----PLSVGVK------------------GCIKEL------QKIKLESKHEFKTILCLGG 153

Query: 180 WSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKL 239
           WSNREA+ ++ +  KK+  F+ + ++ MF YGFDGI+LDWEFP++D  EP +YLE+++ +
Sbjct: 154 WSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGI 213

Query: 240 KWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYD 299
           +   ++LE++IF +         P F LS+A PAF EKL+IL + EM  YVD+WNMM YD
Sbjct: 214 REGMDQLERQIFGSP--AEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYD 271

Query: 300 YHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKK 359
           +HGEWS+ TGYHSNLY    +                        S+L+ D A+  +  +
Sbjct: 272 FHGEWSDVTGYHSNLYLQGHS-------------HRRSLSNRISNSSLSSDTAVKLMTDR 318

Query: 360 YHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNS 419
           ++I+ ++I LGMAAYGRGFT  N  + D  ++ K Y GVGG SEGEPG+WLYNQLPI  S
Sbjct: 319 HNISSRRIALGMAAYGRGFT--NVETNDDNYLGKKYHGVGGGSEGEPGIWLYNQLPIDGS 376

Query: 420 LEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEK 479
            E+FD + VSA+C+D KS+TFVGYDN  SM +K +Y+K+ NL GGFWWESCGD  K+P K
Sbjct: 377 KEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRK 435

Query: 480 SLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKL 526
           SL+NAF+ EIG ++E   ++F + +V +++L+ K    ++S+   KL
Sbjct: 436 SLVNAFSKEIG-LSEGFVSLFKSDKVKQFHLQ-KYPKDYISSLFQKL 480

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  419 bits (1077), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 217/514 (42%), Positives = 300/514 (58%), Gaps = 72/514 (14%)

Query: 10  VALALLFVIISIMVESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPDSGYDVGVY 69
           V+L  + VI+++     L++K   H                      P N +  Y  GVY
Sbjct: 12  VSLVSVTVILTMCFTQLLHKKTEHHHQPPAQC---------------PQNVNQKYVSGVY 56

Query: 70  YSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKL 129
           YS+WSPY PR+H P ++D S++TH+YY+FF+VD+ + AL   D+WSD EM          
Sbjct: 57  YSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEM---------- 106

Query: 130 KKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRM 189
                     P  KN +  GCIG L  LR       +    FK IM+VGGWSN++AFP  
Sbjct: 107 ----------PMGKNTVLKGCIGALNSLR-------DEKPGFKNIMAVGGWSNKDAFPLA 149

Query: 190 IRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQK 249
           +R    ++    SC+E MF YGFDGI+LDWE+PKDD  EP++YLEL++K++   NELE  
Sbjct: 150 LRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIA 209

Query: 250 IFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTG 309
           I+ +       K+ +FHLS+A PAF +KL+   ++EMD Y+D WNMMTYDY+GEWS  TG
Sbjct: 210 IWGD-------KKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTG 262

Query: 310 YHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHINPKKINL 369
           +HSNLY                              +L  D AI Y+  K  IN +K+ L
Sbjct: 263 FHSNLYD---------------------GTNKFSEHSLCADGAIRYMTNKIGINSRKVVL 301

Query: 370 GMAAYGRGFTKVNAS--SQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEEFDPDY 427
           GMA YGRGFT V      + +  IN+ ++GVGG SEGEPGMWLYNQLPI+ + E FD  Y
Sbjct: 302 GMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQY 361

Query: 428 VSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTD 487
            SA+C+D K+KT VGYDN DS + KAQYV+ HNL GGFWWESCG+   N ++SL++ F +
Sbjct: 362 GSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNE 421

Query: 488 EIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLST 521
           +I  +      ++ + ++ ++YL+    +GFL+ 
Sbjct: 422 DIERLDRNETNLYQDPKLREHYLQIFAKSGFLAA 455

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  420 bits (1080), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 209/465 (44%), Positives = 292/465 (62%), Gaps = 46/465 (9%)

Query: 64  YDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYK 123
           +  G+YYSNWS Y PRLH PH+++F  ++HVYYAFF+VD K G L + D W+DF+    K
Sbjct: 58  FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK 117

Query: 124 PLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNR 183
                               N L  G +GELF L+           + K IM +GGWSNR
Sbjct: 118 -------------------NNKLVKGNVGELFDLKMKN--------RVKCIMCIGGWSNR 150

Query: 184 EAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQ 243
           EA+     D  K+++F    ++ MF YGFDGI+LDWE+P+DD +EP++YLE+++++K   
Sbjct: 151 EAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHM 210

Query: 244 NELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGE 303
           N+LE +IF ++     +    F LS+A PAFK+KL+I  ++EMD  +D WNMMTYDY+GE
Sbjct: 211 NKLESEIFKDTS----ATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGE 266

Query: 304 WSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHIN 363
           WSE+TGYHSNLY   +                           LNGDYA+ Y+I +  I 
Sbjct: 267 WSERTGYHSNLYDGSKGSTTIESVLRHGMSEV---------EGLNGDYAVKYMINQ-GIK 316

Query: 364 PKKINLGMAAYGRGFTKVNASS----QDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNS 419
             KI LGMAAYGRGFT V+  +    +  R+I + + GVGGASEGEPGMW Y+QLPI  +
Sbjct: 317 KDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGT 376

Query: 420 LEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEK 479
           +E+FDP YVS +C++  + TFVGYD  DS++VK QY+K  ++ GGFWWESCGD HKNPE+
Sbjct: 377 VEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPER 436

Query: 480 SLLNAFTDEIG-SVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFI 523
           SL+NA+  E+G    +K E+++ N+  + +Y ++    GFLS ++
Sbjct: 437 SLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  414 bits (1063), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 215/479 (44%), Positives = 291/479 (60%), Gaps = 34/479 (7%)

Query: 53  GKSFPNNPDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSD 112
           G     + +SG+  G+YYSNWSPY  R H PHD+DF +LTHVYYAF VV+S+TG    SD
Sbjct: 60  GTGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSD 119

Query: 113 NWSDFEMDCYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRK-- 170
            WSD +MD YK +    KKL L   F    K+ LP+GCIGELF+L++S     N      
Sbjct: 120 EWSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGV 179

Query: 171 --FKLIMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLE 228
             FK IMSVGGWSNREAF  ++    KL+ F++SC+  MF YGFDGI++DWEFPK+D  E
Sbjct: 180 NNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKE 239

Query: 229 PKMYLELVKKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDH 288
           PK+YL+++K L+ + + LE +IF +  + +H     F L+ A  A +E L  L ++E D 
Sbjct: 240 PKVYLQMLKALRERLDTLESQIFGSKDHKHH-----FALTSAISADEECLKYLPLQEADR 294

Query: 289 YVDVWNMMTYDYHGEWSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLN 348
           YVD WN+M YD+ G WS +T Y SNLY+P +T                           +
Sbjct: 295 YVDYWNLMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGRG------------------S 336

Query: 349 GDYAINYVIKKYHINPKKINLGMAAYGRGFTKVNASSQDTR-FINKPYRGVGGASEGEPG 407
            D A+ ++  K  +  KKI LGM AYGRGF  V  S +     I KP++ V G+SEGE G
Sbjct: 337 ADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEG 396

Query: 408 MWLYNQLPIKNSLEEFDPDYVSAFC----YDKKSKTFVGYDNRDSMKVKAQYVKEHNLKG 463
           + LY QLP+K  +E FD + VSA+C    ++KK    + YDN DSM  KA YV++++L G
Sbjct: 397 ISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGG 456

Query: 464 GFWWESCGDDHKNPEKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTF 522
           GFWWESCG+D+K   KSL+ AFT EI  + +   T+++  EV+++YLK        STF
Sbjct: 457 GFWWESCGEDYKG--KSLVGAFTKEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTF 513

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  414 bits (1063), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 234/526 (44%), Positives = 320/526 (60%), Gaps = 52/526 (9%)

Query: 9   WVALALLFVIISI-MVESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPDSG-YDV 66
           W+ + L+ +I+ +  +   + +KF K  S  E    S         +    N   G Y V
Sbjct: 12  WILVLLVAIILEMTFIPKLMIEKFKKPRSDIERTALS------TITRPVDRNLQHGKYAV 65

Query: 67  GVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLA 126
           GVYY++WSPY PRLH PHD+DF R+T+V YAFFVVD KTG +  +D+WSD EM  + P  
Sbjct: 66  GVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAP-- 123

Query: 127 MKLKKLQLDHFFNPKFKNGLPMGC---IGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNR 183
                             G+P G    IGEL YL+  +      +  F+L M+VGGWSNR
Sbjct: 124 ------------------GIPQGVTGMIGELNYLKLQR------NTNFRLFMAVGGWSNR 159

Query: 184 EAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQ 243
           EAFP+++R  +KL  FVNS I+ MF YGFDGI+LDWEFPKDD  EP MYLE+  +L+ K 
Sbjct: 160 EAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKM 219

Query: 244 NELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGE 303
           ++LE +I+      N++  PKF LS+A PAF + L IL + EM+ +V +WNMMTYD+HG 
Sbjct: 220 DKLEDEIWG----ANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGS 275

Query: 304 WSEKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHIN 363
           WS++TGYHSNLY   +                           LN D AI  +++ + ++
Sbjct: 276 WSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDN-------EGLNADDAIKIMVENFKVH 328

Query: 364 PKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEEF 423
            KK+ LGM AYGRGFT V     D   +NK Y GVGG SEGEPG+WLYNQLP+ N+ E+F
Sbjct: 329 AKKVRLGMPAYGRGFTNVQTKDDDD-LLNKKYSGVGGGSEGEPGIWLYNQLPLANTAEKF 387

Query: 424 DPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLN 483
           D  +VSA+C+DK  KTFVGYDN  SM+VK+ YVK+ +L GGF+WESCGD H +P+++L+ 
Sbjct: 388 DDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVR 447

Query: 484 AFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYR 529
           AF+ E+  +  +  T+F +   + YYLK +   GFL +   + L +
Sbjct: 448 AFSQELSEM--RIPTIFKDPRAIAYYLKHR-QKGFLYSLFSQHLQK 490

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  395 bits (1015), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/514 (44%), Positives = 314/514 (61%), Gaps = 53/514 (10%)

Query: 14  LLFVIISIMVESFLYQKFLKHGSKEESIEDSINESQI-VYGKSFPNN----PDSGYDVGV 68
           +L ++ +I++E     K +K     E +   I    + V+ ++ P      PD  Y VGV
Sbjct: 13  ILILVAAIVLEMTFLPKLIK-----EKLSRRIRPKPLEVHEETRPVPDAPYPDGEYTVGV 67

Query: 69  YYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMK 128
           YYS+WSPY PRLH P ++DF R+THVYYAFFVVD KTG + + D WSD +M         
Sbjct: 68  YYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM--------- 118

Query: 129 LKKLQLDHFFNPKFKNGLPMG---CIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREA 185
                      P    G+P G    IGEL YL+      +     FKL+M+VGGWSNRE 
Sbjct: 119 -----------PMNLTGMPRGLNGAIGELNYLK------TRPGTDFKLMMAVGGWSNREP 161

Query: 186 FPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNE 245
           F +++RD +K + F++S I+ MF YGFDGI+LDWEFPKDD  EP+MYLE+  +L+ K +E
Sbjct: 162 FHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDE 221

Query: 246 LEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWS 305
           LE  I+   G    +  P+FHLS+AAPAF + L I  + EM+ Y+ +WNMMTYDYHG WS
Sbjct: 222 LEDNIWGPGG----TTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWS 277

Query: 306 EKTGYHSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHINPK 365
           E+TGYHSNLY+   +                          LN   AI  + +++ ++P+
Sbjct: 278 ERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNF-----DELNAHDAILMMTEQFKVSPR 332

Query: 366 KINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEEFDP 425
           KI LGMAAYGRGFT V    +  + I + Y GVGG SEGEPGMWLYNQLP+ +  E+FD 
Sbjct: 333 KIALGMAAYGRGFTNVRGDGE--QLIGQKYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDN 390

Query: 426 DYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAF 485
            +VSA+ YD  +KT V YDN DSMK+K +YVK+  L G F WESCGD+ K+ +++L+ AF
Sbjct: 391 VWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAF 450

Query: 486 TDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFL 519
           T+ +     +  T + + ++++YYL+T+ + GFL
Sbjct: 451 TENMKGA--RKATAYKDSKLIQYYLRTRPE-GFL 481

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  389 bits (999), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/518 (40%), Positives = 298/518 (57%), Gaps = 42/518 (8%)

Query: 17  VIISIMVESF--LYQKFLKHGSKEESIEDSINESQIVYGKSFPNNPDSGYDVGVYYSNWS 74
           ++ SI +++F  LY    +    + +++D  N   I        + + G   G+YYSNWS
Sbjct: 30  IVKSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLI--------SSERGLTSGIYYSNWS 81

Query: 75  PYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQL 134
           PY  R H PHD+DF RLT V+Y+F VV+ +TG    SD WSD +MD YK +    +K+ L
Sbjct: 82  PYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQMFSAFEKVDL 141

Query: 135 DHFFNPKFKNGLPMGCIGELFYLRH----SQLFDSNNSRKFKLIMSVGGWSNREAFPRMI 190
              F    +N LP+GCIGELFYL++    S++    + + FK IMSVGGWSNREAF  ++
Sbjct: 142 KRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWSNREAFESLV 201

Query: 191 RDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKI 250
           +   K+  F+NSC++ MF YGFDGI++DWEFPK+D  EPK YL++++ L+ K ++LE  I
Sbjct: 202 QSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDDLESDI 261

Query: 251 FNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGY 310
           F    +  H     F L+ A  A    L+ L + E+D YVD WN+M YD+ G WS  T Y
Sbjct: 262 FGTEKHTQH-----FLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAY 316

Query: 311 HSNLYSPQETXXXXXXXXXXXXXXXXXXXXXXXXSNLNGDYAINYVIKKYHINPKKINLG 370
            SNLYS                               + D A+  ++ K+ +  KKI LG
Sbjct: 317 QSNLYSRSSLGKRSENSEGG-----------------SADTAVRLLLNKHKLPAKKIVLG 359

Query: 371 MAAYGRGFTKVNASSQ-DTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEEFDPDYVS 429
           M AYGRGF  V+     +   I + ++ V G SEGE G+ LYNQLP+K   E FD D VS
Sbjct: 360 MPAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWFDQDAVS 419

Query: 430 AFCY----DKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAF 485
           A+      +K+    V YDN  SMK+KAQYV ++NL GGFWWESCG+++ +  +SL  AF
Sbjct: 420 AYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAF 479

Query: 486 TDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFI 523
           T EI  + +   T++   +V +YY K   D GFL++ I
Sbjct: 480 TQEIKYLNKTVPTIYALPQVGEYYHKKYPD-GFLASII 516

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,335,124
Number of extensions: 2935271
Number of successful extensions: 8327
Number of sequences better than 10.0: 27
Number of HSP's gapped: 8446
Number of HSP's successfully gapped: 31
Length of query: 533
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 419
Effective length of database: 40,409,475
Effective search space: 16931570025
Effective search space used: 16931570025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)