Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.245.442ON27627614360.0
Kpol_1016.25.442ON3282769581e-130
TBLA0A064805.442ON3342739491e-128
TDEL0D025905.442ON3302739421e-127
TPHA0J026105.442ON3292769321e-126
NDAI0B057205.442ON3652769341e-126
KLTH0F15884g5.442ON3292769291e-126
Ecym_45135.442ON3332769221e-124
YDR372C (VPS74)5.442ON3452739181e-124
ZYRO0F10208g5.442ON3322739171e-124
Smik_4.6385.442ON3462739171e-123
Skud_4.6415.442ON3462739161e-123
KLLA0E02355g5.442ON3242769111e-123
NCAS0F034305.442ON3322769101e-123
Suva_2.5445.442ON3462739101e-122
Kwal_55.213995.442ON3292769081e-122
SAKL0G02706g5.442ON3322769071e-122
CAGL0A02926g5.442ON3282739051e-122
ACL165C5.442ON3312768931e-120
KAFR0D050605.442ON3262738921e-120
KNAG0B042005.442ON3442738881e-119
TBLA0A027805.442ON3872777594e-99
NCAS0H020905.442ON3452824712e-56
TBLA0H009708.384ON869105711.7
YGL253W (HXK2)3.581ON486164702.0
SAKL0F12716g7.402ON377152683.8
SAKL0H13970g8.384ON825109684.0
ZYRO0B13398g4.291aON537133674.9
NCAS0A040202.392ON34376666.0
Ecym_2109na 1ON1259174676.5
Skud_7.143.581ON486135666.5
Smik_7.83.581ON486164667.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.24
         (276 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   557   0.0  
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   373   e-130
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   370   e-128
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   367   e-127
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   363   e-126
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   364   e-126
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   362   e-126
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   359   e-124
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   358   e-124
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   357   e-124
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   357   e-123
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   357   e-123
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   355   e-123
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   355   e-123
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   355   e-122
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   354   e-122
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   353   e-122
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   353   e-122
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   348   e-120
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   348   e-120
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   346   e-119
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   296   4e-99
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   186   2e-56
TBLA0H00970 Chr8 (209566..212175) [2610 bp, 869 aa] {ON} Anc_8.3...    32   1.7  
YGL253W Chr7 (23935..25395) [1461 bp, 486 aa] {ON}  HXK2Hexokina...    32   2.0  
SAKL0F12716g Chr6 (993583..994716) [1134 bp, 377 aa] {ON} some s...    31   3.8  
SAKL0H13970g Chr8 (1191579..1194056) [2478 bp, 825 aa] {ON} simi...    31   4.0  
ZYRO0B13398g Chr2 (1088223..1089836) [1614 bp, 537 aa] {ON} simi...    30   4.9  
NCAS0A04020 Chr1 complement(811487..812518) [1032 bp, 343 aa] {O...    30   6.0  
Ecym_2109 Chr2 (199842..203621) [3780 bp, 1259 aa] {ON} similar ...    30   6.5  
Skud_7.14 Chr7 (28006..29466) [1461 bp, 486 aa] {ON} YGL253W (REAL)    30   6.5  
Smik_7.8 Chr7 (18636..20096) [1461 bp, 486 aa] {ON} YGL253W (REAL)     30   7.7  

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/276 (100%), Positives = 276/276 (100%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  373 bits (958), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 175/276 (63%), Positives = 223/276 (80%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEVVLLG+ DK+GYLSFWN+N+S+ LRGCI+IELA R  I+++DDP+RKRFDLS+RL+E
Sbjct: 53  MEEVVLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVE 112

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           VV+  KTGE LLDE LQ+MK++E  SI+ WIDLLSGETWN FKIN QLKQVRERISKGLV
Sbjct: 113 VVDGSKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLV 172

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+RILS L+ +T  +  +EYFPET Q + 
Sbjct: 173 DKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKV 232

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RTIALI S+YA +VLENV S L+Y+K+D+   R+  IL + + YPF+ D  S   ++ N
Sbjct: 233 IRTIALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSIN 292

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           L++LVE+E++++    L+LE +AGVF+VF KMD I+
Sbjct: 293 LSKLVEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  370 bits (949), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 174/273 (63%), Positives = 219/273 (80%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEVVLLG+RDKEGYLSFWN+N+S+ LRGCI+IELA RG I+++DDP+RKRF+LS+RL+E
Sbjct: 59  MEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVE 118

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           VV+  KTGE LLDE LQ+M+++E  +IS W+DLLSGETWN+FKIN QLKQVRERISKGLV
Sbjct: 119 VVDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLV 178

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+RILS+L+ +TA    ++YFPET   + 
Sbjct: 179 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKY 238

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RTI+LI SAY  +VLENV + L+YQK+D+   R  E+L+Q S YPF+ + ++    + N
Sbjct: 239 IRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSIN 298

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN LV+ E+  D    L LE +AGVFEVF KMD
Sbjct: 299 LNALVKEEIEADPKNALFLEVVAGVFEVFSKMD 331

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 220/273 (80%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+LLG+RDKEGYLSFWN+N+S+ LRGCI+IELA RG I++IDD +RKRFD+S+RLIE
Sbjct: 55  MEEVLLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIE 114

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           VV+  KTGE LLDETLQ+MK +E  +I+ WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 115 VVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLV 174

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE +K+R+LSVL+ +   +  +EYFP+T   + 
Sbjct: 175 DKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKL 234

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RTIALI  +Y  +VLENV + LDY+K+D    R  EIL+Q + YPF+ D  + + ++ N
Sbjct: 235 IRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSIN 294

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+ V+ ELS++K+  L+LE +AGVFEVF +MD
Sbjct: 295 LNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMD 327

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  363 bits (932), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/276 (61%), Positives = 219/276 (79%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEVVLLG+ D EGYLSFWN+N+S+VLRGCILIELA RG I++IDD +RK FDLS+RLIE
Sbjct: 54  MEEVVLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIE 113

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDETLQ+MK++E QSI +WIDLLSGETWN FK+N QLKQVRER+SKGLV
Sbjct: 114 VIDASKTGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLV 173

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE +K+RI+S L+ +T  +  +EYFPE+   + 
Sbjct: 174 DKGVLRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKV 233

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT++LI++AY+ +VLENV + L+Y+K+D    R   +L+    YPF+  N+    I+ N
Sbjct: 234 IRTVSLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISIN 293

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           LNQLVE+E+  +    L+LE +AGVF+VF KMD I+
Sbjct: 294 LNQLVEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  364 bits (934), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/276 (61%), Positives = 220/276 (79%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RDKEGYLSFWN+N+S+ LRGCILIELA RG I+++DD +RKRFDLS+RLIE
Sbjct: 90  MEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIRILDDSARKRFDLSERLIE 149

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V +  KTGE LLDETLQ+MK++E  +I+ WIDLLSGETWNI KIN QLKQVRER++KGLV
Sbjct: 150 VKDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLV 209

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+R+LSVL+ +      +EYFP+    + 
Sbjct: 210 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKI 269

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RTIALI  AY  +VLENV S LDY+K D+   R  E++ Q S +PF+ +  ++TN++ N
Sbjct: 270 IRTIALICGAYGANVLENVLSSLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVN 329

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           LN+LV+ EL ++   +L+LE IAGV EVF +MD+++
Sbjct: 330 LNRLVQQELDENPGYDLQLEVIAGVIEVFSRMDTLL 365

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  362 bits (929), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 166/276 (60%), Positives = 221/276 (80%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G++DKEGYLSFWN+N+S+ LRGCILIELA RG IQV++DP+RKRFD+S+RL+E
Sbjct: 54  MEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVE 113

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V+N  KTGE LLDE L +MK++E  +I+ WIDLLSGETWN  KI+ QLKQVRER++KGLV
Sbjct: 114 VINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLV 173

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDM THP+ D  CKE IK+RILSVL+ +   +  +EYFP +V+ + 
Sbjct: 174 DKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKL 233

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT++LI  AY  +VLENV S LDY+K+D  F R  EIL Q S +PF  D ++ T I+ N
Sbjct: 234 IRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVN 293

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           LN+ V+ E+  +++ +L+LE +AGVFEVF +MD+++
Sbjct: 294 LNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/276 (62%), Positives = 213/276 (77%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G++DKEGYLSFWN+++S+ LRGCILIELA RG I+V++D +RKRFDLS+RL+E
Sbjct: 58  MEEVLLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVE 117

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V+   KTGE LLDETL +MKS E  SI  WIDLLSGETWN+ KI+ QLKQVRER++KGLV
Sbjct: 118 VIETSKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLV 177

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+R+LSVL+P+   +   EYFPE+V  + 
Sbjct: 178 DKGVLRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKY 237

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           LRTIALI  AY  +VLENV S LDY+K++  F R  EIL Q S YPF  D    T I+ N
Sbjct: 238 LRTIALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVN 297

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           L   V+ E+ K+    L+LE +AGVFEVF +MD+ +
Sbjct: 298 LYNQVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  358 bits (918), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 217/273 (79%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCI+IELA RG I+++DD +RKRFDLS+RLIE
Sbjct: 70  MEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIE 129

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDETLQ+MK++E  SIS WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 130 VIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRERLAKGLV 189

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYFPET   + 
Sbjct: 190 DKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKI 249

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT+ALI  +Y  +VLENV + L+Y+K+D    R  EI+ Q S YPF+ + ++   ++ N
Sbjct: 250 IRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKETELGVSVN 309

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+ V+ E+  +   +L+LE IAGVFEVF +MD
Sbjct: 310 LNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMD 342

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  357 bits (917), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/273 (62%), Positives = 212/273 (77%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+LLG+RDKEGYLSFWN+N+S+ LRGCI+IELA RG I+V+DD +RKRFD+S+RLIE
Sbjct: 57  MEEVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIE 116

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V +  KTGE LLDE LQ+MK +E  SI+ WIDLLSGETWN  KIN QLKQVRER++KGLV
Sbjct: 117 VTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLV 176

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+RILSVL+P+   +  ++YF E V  + 
Sbjct: 177 DKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKL 236

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RTIALI  AY  +VLENV + L Y+K+D+   R  EIL Q S YPF+ D ++ + I+ N
Sbjct: 237 IRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISIN 296

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+ V  EL +     L+LE +AGVFEVF +MD
Sbjct: 297 LNKEVGQELQQHPESTLQLEVLAGVFEVFSRMD 329

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 217/273 (79%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCI+IELA RG I+++DD +RKRFDLS+RLIE
Sbjct: 71  MEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIE 130

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDETLQ+MK++E  +IS WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 131 VIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVRERLAKGLV 190

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYFPET   + 
Sbjct: 191 DKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKI 250

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT+ALI  +Y  +VLENV + L+Y+K+D    R  EI+ Q S +PF+ + ++   I+ N
Sbjct: 251 IRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKETELGISVN 310

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+ V+ E+  +   NL+LE IAGVFEVF +MD
Sbjct: 311 LNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMD 343

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  357 bits (916), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 217/273 (79%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCILIELA RG I+++DD +RKRFDLS+RL+E
Sbjct: 71  MEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRFDLSERLVE 130

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           VV+  KTGE LLDETLQ+MK++E  +IS WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 131 VVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVRERLAKGLV 190

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYFPET   + 
Sbjct: 191 DKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKI 250

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT+ALI  +Y  +VLENV + L+Y+K+D    R  EI+ Q S YPF+ + ++   ++ N
Sbjct: 251 IRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLEKETELGVSVN 310

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+ V+ E+  +   +L+LE IAGVFEVF +MD
Sbjct: 311 LNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMD 343

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  355 bits (911), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 162/276 (58%), Positives = 217/276 (78%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G++DK+GYLSFWN+N+S+ LRGCILIELA RG I+ +DDP+RKR+D+S+RLIE
Sbjct: 49  MEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIE 108

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDE+L +MK++   SI  WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 109 VIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLV 168

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+RILS+L+ + A +  + YFP+ V  + 
Sbjct: 169 DKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKY 228

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT++LI  AY  +VLENV + LDY+ +D  F R  EIL Q S +PF  D ++ST ++ N
Sbjct: 229 IRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVN 288

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           LN+ +  EL+     +L+LE +AGVFEVF +MD+++
Sbjct: 289 LNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  355 bits (910), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 218/276 (78%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RDKEGYLSFWN+N+S+ LRGCILIELA RG IQ++DD +RKRF+LS+RL++
Sbjct: 57  MEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQ 116

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDETLQ+MK++E  SI++WIDLLSGETWNI KIN QLKQVRER++KGLV
Sbjct: 117 VIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLV 176

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+R+LS+L+ +   +  + YFPET + + 
Sbjct: 177 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKI 236

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RTIALI  AY  +VLEN+   LD++  D+   R  E++ Q S +PF+ +  ++  I+ N
Sbjct: 237 IRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVN 296

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           LN+ V+ EL+     +L+LE IAGV EVF +MD+++
Sbjct: 297 LNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 215/273 (78%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCILIELA RG I+++DD +RKRFDLS+RL+E
Sbjct: 71  MEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRFDLSERLVE 130

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDETLQ+MK++E  +IS WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 131 VIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVRERLAKGLV 190

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYFPET   + 
Sbjct: 191 DKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKI 250

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT+ALI  +Y  +VLENV + L+Y+K+D    R  EI+   S YPF+ +  +   ++ N
Sbjct: 251 IRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKDTDLGVSVN 310

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+ V+ E+  +   +L+LE IAGVFEVF +MD
Sbjct: 311 LNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMD 343

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  354 bits (908), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 216/276 (78%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G++DKEGYLSFWN+N+S+ LRGCILIELA RG IQV++D +RKRFD+S+RL+E
Sbjct: 54  MEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVE 113

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V+N  KTGE LLDE L +MK++E  +I+ WIDLLSGETWN  KI+ QLKQVRER++KGLV
Sbjct: 114 VINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLV 173

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDM THP+ D  CKE IK+RILSVL+ +   +  +EYFP +V  + 
Sbjct: 174 DKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKL 233

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           LRT++LI  AY  +VLENV   LDY+K+D  F R  EIL Q S +PF  D ++ T I+ N
Sbjct: 234 LRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVN 293

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           +N+ ++ E+  + +  L+LE +AGVFEVF +MD+++
Sbjct: 294 INKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  353 bits (907), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 217/276 (78%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G++DKEGYLSFWN+N+S+ LRGCILIELA R  I+V+DDP+RKRFD+SDRLIE
Sbjct: 57  MEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIE 116

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDE L ++K++E   I+ WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 117 VIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLV 176

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYF E +  + 
Sbjct: 177 DKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKI 236

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT++LI  AY  +VLENV + LDY K+D  F R  EIL Q S +PF  D  + + I+ N
Sbjct: 237 IRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVN 296

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           LN+ V+ E++++   +L+LE +AGVFEVF +MD+++
Sbjct: 297 LNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  353 bits (905), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 166/273 (60%), Positives = 211/273 (77%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCILIELA R  I+++D P+R RFD+S+RLIE
Sbjct: 53  MEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIE 112

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDETLQ+M ++E  SI+ WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 113 VIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLV 172

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+RILSVL+ +   I  + YFPE+   + 
Sbjct: 173 DKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKL 232

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT++LI  AY  +VLENV S L+Y K+D    R  EIL Q S YPF+   +S   I+ N
Sbjct: 233 IRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVN 292

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+ ++ EL  +   +LKLE IAGVFEVF +MD
Sbjct: 293 LNKELQEELESNPGSDLKLEVIAGVFEVFSRMD 325

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  348 bits (893), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 207/276 (75%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G++DKEGYLSF NEN+S+ LRGCILIELA RG IQV+DD  R+RFD S+RLIE
Sbjct: 56  MEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIE 115

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           VV+  KTGE LLDE L +MK  E  +I  W+DLLSGETWN  KIN QL+QVRER++KGLV
Sbjct: 116 VVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLV 175

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDM THPV D  CKE IK+RILSVL+P+   +   E FPETV  + 
Sbjct: 176 DKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKY 235

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           LRTIALI SA+  +VLE V S LDY+K+D  F R  E+L Q S YPF  D    T I+ N
Sbjct: 236 LRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVN 295

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           LN+LV+ EL ++    L LE +AGV +V+ +MD ++
Sbjct: 296 LNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  348 bits (892), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 161/273 (58%), Positives = 210/273 (76%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RD+EGYLSFWN+N+S+ LRGCILIELA R  I+++DD +RKRFD+S+RL+E
Sbjct: 51  MEEVLLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVE 110

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           V++  KTGE LLDE LQ+MK++E  +I+ WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 111 VIDGSKTGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLV 170

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+RILS L+ +   +  + YF ET   + 
Sbjct: 171 DKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKY 230

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +R +AL+  +Y  +VLENV S LDY+K+D    R  EIL Q + YPF+    +   I+ N
Sbjct: 231 IRIVALVCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVN 290

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+ VENE++++    L+LE IAGV EVF +MD
Sbjct: 291 LNKEVENEVNENPQFTLQLEVIAGVIEVFSRMD 323

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  346 bits (888), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 158/273 (57%), Positives = 211/273 (77%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEEV+L+G+RD+EGYLSFWN+N+S+ LRGCI+IELA R  I+++DD +RKRFD+S+RL+E
Sbjct: 69  MEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRFDISERLVE 128

Query: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120
           VV+  KTGE LLDETLQ+MK++E  +I+ WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 129 VVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVRERLAKGLV 188

Query: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+RILS ++ +   +  + YFPE+   + 
Sbjct: 189 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFPESTSFKY 248

Query: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240
           +RT+AL+ S Y  SVLENV S LDY+++D    R  E+L++   YPF+ + +  + I+ N
Sbjct: 249 IRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQGDSGISCN 308

Query: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273
           LN+  + E+ +  N  L LE +AGV EVF +MD
Sbjct: 309 LNKEAQREVDESPNSALYLEVVAGVIEVFSRMD 341

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  296 bits (759), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 195/277 (70%), Gaps = 1/277 (0%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60
           MEE+VLLG++DK+GYLSFWN+N+S+VLRGCILIELA R  I+VIDDP R  +D+S R+IE
Sbjct: 111 MEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIE 170

Query: 61  VVNP-KKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGL 119
           VV P  KTG  LLDE L MM  E  +SI  WIDLLSGETWN+FK NLQLK VRER+SKGL
Sbjct: 171 VVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGL 230

Query: 120 VDKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLR 179
           VDKGIL+    NF  FDM+THP+ D+  KE +K+RI S+L+P+ + +L + YFPE V  +
Sbjct: 231 VDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFK 290

Query: 180 CLRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIAT 239
            +R++ LI  AY   VL++    ++Y   D+ F +  ++ +  S +P   D +  + +  
Sbjct: 291 IIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPV 350

Query: 240 NLNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
           ++ + +++EL +    +L LE +AGV +V L+MDS++
Sbjct: 351 DIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  186 bits (471), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 166/282 (58%), Gaps = 15/282 (5%)

Query: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDR--L 58
           M+E+ LL ++DKEGY+S W+  LS+VLR C++IELA RG IQ + +  +K+ DL+     
Sbjct: 68  MDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLAPHECK 126

Query: 59  IEVVNPKKTGEFLLDETLQMMKSEESQ-SISTWIDLLSGETWNIFKINLQLKQVRERISK 117
           IEV++   TG+ LLD+TL +MK E+   S+S WI LLSGE+ N  K + QL  VR+RI +
Sbjct: 127 IEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRKRIER 186

Query: 118 GLVDKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQ 177
            LV+ GIL  + K      + THP++D+KCK  I+ R+  +L      + + +YFP+TV 
Sbjct: 187 ILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFPDTVS 246

Query: 178 LRCLRTIALILSAYAGSVLENVASDLDYQKKDDLFV---RTSEILDQSSVYPFEFDNKSS 234
            R LRTI L  +AY   +L+       +Q +++  +   R   +L   S +PFE +    
Sbjct: 247 YRVLRTIVLACAAYGADILDKGF----FQTENETVIGKGRARVLLSLFSKFPFELNQA-- 300

Query: 235 TNIATNLNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276
             +  +LN+ V  EL +      +LE +AG  +V   +D+++
Sbjct: 301 --VQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>TBLA0H00970 Chr8 (209566..212175) [2610 bp, 869 aa] {ON} Anc_8.384
           YLR166C
          Length = 869

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 51/105 (48%), Gaps = 2/105 (1%)

Query: 114 RISKGLVDKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFP 173
           R  K  +    L  +  +F++ D  +  +E L+     KK++ +V+L +  +ILA +   
Sbjct: 153 RKKKSYIKSIDLINQYNSFYVDDKVSDQLESLRTSPNWKKKLQAVILVKNVLILAHKI-- 210

Query: 174 ETVQLRCLRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEI 218
           ET  L        I+  YAG +  ++  + +   +D+ F++ +EI
Sbjct: 211 ETNSLPKTSQTTQIIEEYAGLMENSLLENFNSAYRDNNFIQLNEI 255

>YGL253W Chr7 (23935..25395) [1461 bp, 486 aa] {ON}  HXK2Hexokinase
           isoenzyme 2 that catalyzes phosphorylation of glucose in
           the cytosol; predominant hexokinase during growth on
           glucose; functions in the nucleus to repress expression
           of HXK1 and GLK1 and to induce expression of its own
           gene
          Length = 486

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 26/164 (15%)

Query: 46  DPSRKRFDLSDRLIEVVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKIN 105
           D ++ ++ L D +    NP +  EF+ D     +  +  Q IS  I L  G T++     
Sbjct: 106 DTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEPIPL--GFTFSF---- 159

Query: 106 LQLKQVRERISKGLVDKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRI---LSVLLPQ 162
                     S+  +++GIL+   K F + ++  H V  +  K++ K+ I   +  L+  
Sbjct: 160 --------PASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNIPIEVVALIND 211

Query: 163 TAVILADEYF--PETVQLRCLRTIALILSAYAGSVLENVASDLD 204
           T   L   Y+  PET        + +I          +V SD++
Sbjct: 212 TTGTLVASYYTDPET-------KMGVIFGTGVNGAYYDVCSDIE 248

>SAKL0F12716g Chr6 (993583..994716) [1134 bp, 377 aa] {ON} some
           similarities with uniprot|P40065 Saccharomyces
           cerevisiae YER106W MAM1 Monopolin kinetochore associated
           protein involved in chromosome attachment to meiotic
           spindle
          Length = 377

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 67/152 (44%), Gaps = 19/152 (12%)

Query: 92  DLLSGETWNIFKINLQLKQV----RERISKGL-------VDKGILRTEMKNFFLFDMATH 140
           DL  G T ++ K NL   Q     RERI           ++K +  TE +N FLF++   
Sbjct: 142 DLFGGCTESLNKRNLDRLQGMILERERIPACCNHVFCRNLEKKLPSTEYRNLFLFELEMF 201

Query: 141 P----VEDLKCKEMIK-KRILSVLLP--QTAVILADEYFPETVQLRCLRTIALILSAYAG 193
           P    +E    + +    R+   ++P  Q   +L D Y  E  +   +  + +  S+   
Sbjct: 202 PGVAWLETGNLRNVCYWDRVYLSIIPDWQVKCVLQD-YGHELHEAFDVSQLIIEWSSSPP 260

Query: 194 SVLENVASDLDYQKKDDLFVRTSEILDQSSVY 225
            ++     +  + + DD+ VR SE LD SSV+
Sbjct: 261 DLINKTVQERSFLRLDDVQVRISESLDGSSVH 292

>SAKL0H13970g Chr8 (1191579..1194056) [2478 bp, 825 aa] {ON} similar
           to uniprot|Q06245 Saccharomyces cerevisiae YLR166C SEC10
           Essential 100kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 825

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 41/109 (37%), Gaps = 11/109 (10%)

Query: 126 RTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLL---PQTA---VILADEYFPETVQLR 179
           RTE  N   F   +   E L       K I+  LL   PQ     V L + YF      R
Sbjct: 587 RTEDINLSYFKYVSKSAEILSLVSAATKTIILPLLNNSPQIKRKIVTLINAYFK-----R 641

Query: 180 CLRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFE 228
           C   I +IL            + L  QKK D   R+ E LDQ ++   E
Sbjct: 642 CEMLINVILEETVQLYSRKFTNSLSKQKKKDFIPRSQEFLDQDTLPAIE 690

>ZYRO0B13398g Chr2 (1088223..1089836) [1614 bp, 537 aa] {ON} similar
           to uniprot|P15365 Saccharomyces cerevisiae YJR152W DAL5
           Allantoin permease ureidosuccinate permease expression
           is constitutive but sensitive to nitrogen catabolite
           repression
          Length = 537

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 55/133 (41%), Gaps = 21/133 (15%)

Query: 23  LSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDR-LIEVVNPKKTGEFLLDETLQMMKS 81
           L FV+ GC+ I + F     + D+P++  F LS+R  + VV+  KT +       Q   +
Sbjct: 244 LLFVITGCMTIFIGFLIAFWIPDEPTKAIF-LSEREKLMVVDRIKTNQ-------QGFGN 295

Query: 82  EESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLVDKGI-------LRTEMKNFFL 134
            + ++   W  L    TW IF     L  +   I  G V   +        +   K  FL
Sbjct: 296 HKIKTHQVWEALKDVRTWLIF-----LFSISSNIPNGGVTNFMTILFKEDFQYSTKQTFL 350

Query: 135 FDMATHPVEDLKC 147
            +M    VE + C
Sbjct: 351 MNMPYGAVEFIGC 363

>NCAS0A04020 Chr1 complement(811487..812518) [1032 bp, 343 aa] {ON}
           Anc_2.392
          Length = 343

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 51  RFDLSDRLIEVVNPKKTGEFLLDETLQMMKSEESQSI--STWIDLLSGETWNIFKINLQL 108
           +F    R++ + NP  +   +  ETL+MM   ++  +   T +DL+  ET+ +  + LQ 
Sbjct: 106 KFAPDARILIISNPVNSMVPIAVETLKMMGKFQAGKVMGVTMLDLVRAETFLVDFLGLQD 165

Query: 109 KQVRERISKGLVDKGI 124
              ++ + KG +DK I
Sbjct: 166 SSKKKGLDKGAMDKNI 181

>Ecym_2109 Chr2 (199842..203621) [3780 bp, 1259 aa] {ON} similar to
           Ashbya gossypii AAR073W
          Length = 1259

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 83/174 (47%), Gaps = 24/174 (13%)

Query: 83  ESQSISTWIDLLSGETWNIFKIN-------LQLKQVRERISKGLVDKGILRTEMKNFFL- 134
           +S +I  ++D  SGE++++  +N         L  +     + LVDKG    ++K+F+L 
Sbjct: 341 KSNAIDEYMDSDSGESFDVLTLNKIYYARGSALYHLFVSYLRSLVDKG----KIKDFYLI 396

Query: 135 --FDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEY---FPETVQLRCLRTIALILS 189
             F++  +P         + +R L++ +P+   ++ DE    F   ++L    +  +  S
Sbjct: 397 DNFNVEQYPPAPYTP---MTQRALTLTVPK--FLVDDEMRNDFNHLIKLVSKASSRIYSS 451

Query: 190 AYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATNLNQ 243
            +A S LEN  S LD  +++ L V  S     S  Y ++ D + STN    LN+
Sbjct: 452 HHAFSKLEN--SFLDKFEENPLKVIESLFSKSSKRYLYKLDKQFSTNYFKTLNE 503

>Skud_7.14 Chr7 (28006..29466) [1461 bp, 486 aa] {ON} YGL253W (REAL)
          Length = 486

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 59/135 (43%), Gaps = 19/135 (14%)

Query: 46  DPSRKRFDLSDRLIEVVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKIN 105
           D ++ ++ L D +    NP +  EF+ D     +  +  Q IS  I L  G T++     
Sbjct: 106 DTTQSKYKLPDAMRTTQNPDELWEFIADSLKTFINEQFPQGISEPIPL--GFTFSF---- 159

Query: 106 LQLKQVRERISKGLVDKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRI---LSVLLPQ 162
                     S+  +++G+L+   K F + ++  H V  +  K++ K+ I   +  L+  
Sbjct: 160 --------PASQNKINEGVLQRWTKGFDIPNIENHDVVPMLQKQITKRDIPIEVVALIND 211

Query: 163 TAVILADEYF--PET 175
           T   L   Y+  PET
Sbjct: 212 TTGTLVASYYTDPET 226

>Smik_7.8 Chr7 (18636..20096) [1461 bp, 486 aa] {ON} YGL253W (REAL)
          Length = 486

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 68/164 (41%), Gaps = 26/164 (15%)

Query: 46  DPSRKRFDLSDRLIEVVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKIN 105
           D ++ ++ L D +    NP +  EF+ D     +  +  + IS  I L  G T++     
Sbjct: 106 DTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPKGISEPIPL--GFTFSF---- 159

Query: 106 LQLKQVRERISKGLVDKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRI---LSVLLPQ 162
                     S+  +++GIL+   K F + ++  H V  +  K++ K+ I   +  L+  
Sbjct: 160 --------PASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNIPIEVVALIND 211

Query: 163 TAVILADEYF--PETVQLRCLRTIALILSAYAGSVLENVASDLD 204
           T   L   Y+  PET        + +I          +V SD++
Sbjct: 212 TTGTLVASYYTDPET-------KMGVIFGTGVNGAYYDVCSDIE 248

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,120,710
Number of extensions: 1194037
Number of successful extensions: 4804
Number of sequences better than 10.0: 58
Number of HSP's gapped: 4954
Number of HSP's successfully gapped: 58
Length of query: 276
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 168
Effective length of database: 41,097,471
Effective search space: 6904375128
Effective search space used: 6904375128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)