Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1062.235.443ON1266126665810.0
ZYRO0G01606g5.443ON1305127536720.0
TDEL0D025805.443ON1272122736300.0
TPHA0E017105.443ON1283123035960.0
TBLA0A064705.443ON1320127435500.0
Smik_15.3015.443ON1272123435070.0
YOR124C (UBP2)5.443ON1272123635060.0
Suva_8.1765.443ON1270123735040.0
Skud_15.2865.443ON1278124034860.0
SAKL0G02728g5.443ON1237122734810.0
NCAS0H021005.443ON1269124634360.0
KNAG0B041905.443ON1262124533750.0
NDAI0C015505.443ON1295127933680.0
Kwal_55.213935.443ON1233122333120.0
KAFR0D050705.443ON1227123432730.0
KLTH0F15862g5.443ON1241124332710.0
CAGL0K10252g5.443ON1267126531350.0
Ecym_45145.443ON1246124330010.0
KLLA0E02377g5.443ON1220122429600.0
ACL164C5.443ON138978419130.0
Kpol_1016.15.443ON1251116018600.0
TPHA0J026205.443ON1225128516780.0
Kwal_34.162681.369ON449971245e-06
KLTH0H13354g1.369ON4951131192e-05
TBLA0C012001.369ON503651183e-05
TDEL0D024001.369ON494371183e-05
ZYRO0G01188g1.369ON500941122e-04
KLLA0A10791g1.369ON484931103e-04
SAKL0D10120g1.369ON492351084e-04
Skud_6.941.369ON499531076e-04
Ecym_27171.369ON483331069e-04
NDAI0B034302.307ON856671060.001
KAFR0L017307.390ON7011821040.002
KAFR0A075802.69ON802681040.002
Kpol_1003.532.307ON788511030.002
Skud_5.2237.390ON7481011020.003
NDAI0A016707.390ON846951020.003
TBLA0D010708.742ON483691020.003
NCAS0D006001.369ON493361010.003
AEL029W1.369ON446821010.003
KNAG0A054502.307ON764511010.003
Smik_7.3141.369ON499901010.004
SAKL0E07106g2.307ON791491010.004
Smik_5.2447.390ON7491031010.004
Suva_5.2177.390ON754911000.004
KLTH0G10934g2.307ON758731000.005
YFR010W (UBP6)1.369ON49990990.005
Smik_4.1152.307ON790501000.005
Skud_4.1332.307ON787501000.005
TPHA0A025101.369ON50553990.005
CAGL0H10582g2.307ON790491000.006
CAGL0M13783g5.18ON1196691000.006
Suva_4.1252.307ON79350990.006
YDL122W (UBP1)2.307ON80950990.006
Smik_13.4318.742ON47154980.006
Kwal_27.114442.307ON75749990.006
KNAG0F012202.69ON78468990.007
Smik_14.1442.69ON76368990.007
KLLA0C06974g8.742ON44667980.007
KLLA0D08459g2.69ON75068980.007
NCAS0B061302.307ON77051980.008
TBLA0B060802.307ON82465980.009
KAFR0C045201.369ON49991970.009
Kpol_534.231.369ON49637970.009
Suva_14.1562.69ON78873980.010
TPHA0A025401.137ON128628970.011
NDAI0F034102.69ON87066970.011
AGR389C2.307ON77549970.011
TBLA0B097602.69ON89868960.013
KAFR0I026005.18ON121358960.014
CAGL0J11352g2.69ON77168960.014
NCAS0G036802.307ON48250950.016
ABL145W2.69ON74968960.016
TBLA0C070205.18ON124758960.016
KNAG0C019401.369ON49933950.017
TDEL0G023702.307ON74765950.017
NDAI0H035501.369ON50237950.018
TDEL0A011002.69ON66168950.018
ZYRO0C17908g1.137ON1204157950.019
NCAS0G018002.69ON87568950.019
Skud_14.1482.69ON77673950.021
NCAS0A143707.390ON72991940.022
NDAI0G007802.307ON48667940.022
TPHA0G008502.307ON78251940.024
Kpol_2001.541.137ON122354940.025
Skud_13.4785.18ON123190940.025
Smik_13.5215.18ON123190940.026
CAGL0K10494g1.369ON49533930.026
YMR304W (UBP15)5.18ON123090940.027
Smik_2.497.390ON745126940.027
TBLA0J002607.514ON70796930.028
Kwal_33.144302.69ON51168930.029
KAFR0A069102.307ON67848930.029
YER098W (UBP9)7.390ON75479930.031
NCAS0I031401.137ON1201116940.031
Suva_6.831.369ON50033920.037
ZYRO0C09812g2.69ON70266920.037
Kpol_1018.937.390ON75591920.039
SAKL0E13002g2.69ON73968920.048
Suva_13.4078.742ON471119910.051
CAGL0M11198g8.742ON46167900.060
KAFR0D021605.712ON84627910.063
Suva_13.4955.18ON123090910.064
AGL357W5.18ON116657910.064
KNAG0J008003.270ON76557900.070
ZYRO0A02420g2.307ON74549900.073
Kpol_1044.242.69ON72468900.076
Kpol_513.255.18ON119049900.077
KLTH0B07150g2.69ON75668890.087
YNL186W (UBP10)2.69ON79268890.087
ZYRO0A05962g8.742ON46571890.092
Klac_YGOB_Anc_5.18b5.18ON116658890.099
KLTH0B09944g5.18ON1189163890.10
TPHA0L022905.18ON119382890.10
TBLA0E017605.712ON121227890.10
TDEL0G004105.18ON118656890.10
NCAS0E026107.390ON71770880.12
Skud_13.3928.742ON47354880.12
NDAI0E008108.742ON49348880.13
YMR223W (UBP8)8.742ON47154870.13
SAKL0H00418g5.18ON119058880.13
NCAS0D023905.18ON121199880.13
YBL067C (UBP13)7.390ON747125880.14
NDAI0I025305.18ON119748880.14
Ecym_56715.18ON117694880.15
YJL197W (UBP12)1.137ON125487880.15
Skud_10.221.137ON125553870.16
Ecym_46857.390ON77831870.17
Skud_9.125.712ON106492870.17
KAFR0F015601.137ON117127870.19
Suva_2.507.390ON75095860.19
Skud_2.387.390ON74895860.20
SAKL0D03322g3.270ON76528860.20
CAGL0I05522g7.390ON72492860.21
KNAG0L022005.712ON116127860.21
TDEL0C056401.137ON117828860.21
Kwal_26.95985.18ON119158860.22
Ecym_40095.712ON151727860.24
TDEL0B020805.712ON102527860.25
ZYRO0D07062g5.18ON119395860.25
ZYRO0D01122g7.534ON466100850.25
KNAG0B023707.390ON75376850.27
KLLA0A00396g5.712ON101227850.27
KAFR0C004103.270ON76926850.27
KNAG0E012905.18ON119669850.32
SAKL0H04994g8.742ON45450840.37
Kwal_33.136281.137ON116027840.38
CAGL0L01639g1.137ON114728840.41
CAGL0H06721g5.712ON108127840.41
Skud_2.1773.270ON78262840.42
Smik_10.371.137ON124728840.44
SAKL0E15136g5.712ON1037188830.46
TPHA0D046605.712ON104527830.51
AGR370W7.390ON74039830.52
Suva_6.2761.137ON125687830.54
Kwal_55.196455.712ON97026830.57
KLTH0F03674g1.137ON119848820.65
Smik_9.135.712ON106041820.65
TBLA0E025703.270ON78549820.65
KNAG0C021801.137ON123127820.66
Ecym_62488.742ON46668810.68
Kwal_26.91518.742ON45467810.71
NCAS0G001705.712ON103027820.78
AFR627C1.137ON128727820.78
TPHA0E008707.390ON71537810.85
AFR007W8.188ON848215810.88
KLLA0D08030g2.86ON55493810.90
KLLA0E08801g2.307ON77149810.90
YIL156W (UBP7)5.712ON107126801.1
AFR296C5.712ON116927801.1
Ecym_81401.137ON126431801.1
NDAI0F002005.712ON110527801.1
TBLA0F036108.188ON1144177801.3
NDAI0B004801.137ON125327801.3
Suva_9.305.712ON106226791.4
KNAG0G015908.188ON67170791.5
KAFR0A042108.742ON44050781.5
NCAS0B005808.742ON46651781.6
KLLA0C03476g1.137ON125227791.6
Kwal_27.108427.390ON71131781.7
KNAG0D019308.188ON98663791.7
Kpol_1045.417.390ON71237781.8
CAGL0G02563gsingletonON63126781.9
TBLA0A033205.386ON1261105782.0
KLTH0E00814g5.712ON97427782.1
SAKL0C04246g1.137ON129727782.1
CAGL0A04477g7.390ON77082772.5
ZYRO0B11044g8.202ON826116772.5
KAFR0H001505.712ON65637772.6
TDEL0B036708.742ON46349762.6
ZYRO0B16544g5.712ON104427772.7
Suva_4.2953.270ON78263762.9
KLTH0D12760g8.742ON45367763.0
TPHA0G005608.742ON46370763.3
KLTH0C06732g7.390ON71476763.6
Smik_2.1893.270ON78223753.9
AFR551W8.742ON46968754.0
Kpol_1064.488.742ON46664744.8
KNAG0C035807.390ON77639754.8
TBLA0B019308.202ON101974755.1
ZYRO0F01276g3.270ON77620745.3
KLLA0E20351g7.390ON69750745.8
NCAS0I016203.270ON79569746.3
AGR139C8.202ON78995737.4
TBLA0J006001.137ON146267737.6
SAKL0F12430g7.390ON75439737.7
TDEL0C015707.390ON76576738.2
Smik_5.3188.202ON90970738.5
TDEL0A016208.202ON79571728.6
Suva_9.482.208ON819126729.1
Ecym_55448.202ON83468729.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1062.23
         (1266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  2539   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1419   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1402   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1389   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1372   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  1355   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  1355   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  1354   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  1347   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1345   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1328   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1304   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1301   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1280   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1265   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1264   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1212   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1160   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1144   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   741   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   721   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   650   0.0  
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    52   5e-06
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    50   2e-05
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    50   3e-05
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    50   3e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    48   2e-04
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    47   3e-04
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    46   4e-04
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    46   6e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    45   9e-04
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     45   0.001
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    45   0.002
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    45   0.002
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    44   0.002
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    44   0.003
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    44   0.003
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    44   0.003
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    44   0.003
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    44   0.003
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    44   0.003
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    44   0.004
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    44   0.004
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    44   0.004
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    43   0.004
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    43   0.005
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    43   0.005
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    43   0.005
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    43   0.005
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    43   0.005
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    43   0.006
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    43   0.006
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    43   0.006
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    43   0.006
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    42   0.006
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    43   0.006
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    43   0.007
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    43   0.007
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    42   0.007
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    42   0.007
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    42   0.008
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    42   0.009
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    42   0.009
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    42   0.009
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    42   0.010
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    42   0.011
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    42   0.011
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    42   0.011
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    42   0.013
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    42   0.014
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    42   0.014
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    41   0.016
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    42   0.016
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    42   0.016
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    41   0.017
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    41   0.017
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    41   0.018
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    41   0.018
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    41   0.019
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      41   0.019
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    41   0.021
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    41   0.022
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               41   0.022
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    41   0.024
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    41   0.025
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    41   0.025
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    41   0.026
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    40   0.026
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    41   0.027
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    41   0.027
TBLA0J00260 Chr10 (45003..47126) [2124 bp, 707 aa] {ON} Anc_7.51...    40   0.028
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    40   0.029
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    40   0.029
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    40   0.031
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    41   0.031
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    40   0.037
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    40   0.037
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    40   0.039
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    40   0.048
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    40   0.051
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    39   0.060
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    40   0.063
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    40   0.064
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    40   0.064
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    39   0.070
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    39   0.073
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    39   0.076
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    39   0.077
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    39   0.087
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    39   0.087
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    39   0.092
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    39   0.099
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    39   0.10 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    39   0.10 
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    39   0.10 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    39   0.10 
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    39   0.12 
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    39   0.12 
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    39   0.13 
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    38   0.13 
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    39   0.13 
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    39   0.13 
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    39   0.14 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    39   0.14 
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    39   0.15 
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    39   0.15 
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    38   0.16 
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    38   0.17 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    38   0.17 
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    38   0.19 
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    38   0.19 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    38   0.20 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    38   0.20 
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    38   0.21 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    38   0.21 
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    38   0.21 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    38   0.22 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    38   0.24 
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    38   0.25 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    38   0.25 
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    37   0.25 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    37   0.27 
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    37   0.27 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    37   0.27 
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    37   0.32 
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    37   0.37 
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    37   0.38 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    37   0.41 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    37   0.41 
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    37   0.42 
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    37   0.44 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    37   0.46 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    37   0.51 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    37   0.52 
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    37   0.54 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    37   0.57 
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    36   0.65 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    36   0.65 
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    36   0.65 
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    36   0.66 
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    36   0.68 
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    36   0.71 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      36   0.78 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    36   0.78 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    36   0.85 
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...    36   0.88 
KLLA0D08030g Chr4 (685876..687540) [1665 bp, 554 aa] {ON} weakly...    36   0.90 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    36   0.90 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    35   1.1  
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    35   1.1  
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    35   1.1  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      35   1.1  
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    35   1.3  
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    35   1.3  
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    35   1.4  
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    35   1.5  
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    35   1.5  
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       35   1.6  
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    35   1.6  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    35   1.7  
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    35   1.7  
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    35   1.8  
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    35   1.9  
TBLA0A03320 Chr1 (793330..797115) [3786 bp, 1261 aa] {ON} Anc_5....    35   2.0  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    35   2.1  
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    35   2.1  
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    34   2.5  
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    34   2.5  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    34   2.6  
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    34   2.6  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    34   2.7  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    34   2.9  
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    34   3.0  
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    34   3.3  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    34   3.6  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    33   3.9  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    33   4.0  
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    33   4.8  
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    33   4.8  
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    33   5.1  
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    33   5.3  
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    33   5.8  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    33   6.3  
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    33   7.4  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    33   7.6  
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    33   7.7  
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    33   8.2  
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    33   8.5  
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    32   8.6  
Suva_9.48 Chr9 (80060..82519) [2460 bp, 819 aa] {ON} YIL140W (REAL)    32   9.1  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    32   9.8  

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 2539 bits (6581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1239/1266 (97%), Positives = 1239/1266 (97%)

Query: 1    MLEKEDLRVTYSEIGEQPENSNAVDLENDSEVNSSSMDLDSCGDATSVSWKDDGKQLLYP 60
            MLEKEDLRVTYSEIGEQPENSNAVDLENDSEVNSSSMDLDSCGDATSVSWKDDGKQLLYP
Sbjct: 1    MLEKEDLRVTYSEIGEQPENSNAVDLENDSEVNSSSMDLDSCGDATSVSWKDDGKQLLYP 60

Query: 61   DARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGXXXXXXXXXXXXRHNVQPFS 120
            DARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNG            RHNVQPFS
Sbjct: 61   DARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGLLKKQLLSYSKSRHNVQPFS 120

Query: 121  VGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADLKIYHLKITV 180
            VGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADLKIYHLKITV
Sbjct: 121  VGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADLKIYHLKITV 180

Query: 181  KVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLE 240
            KVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLE
Sbjct: 181  KVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLE 240

Query: 241  IFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRK 300
            IFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRK
Sbjct: 241  IFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRK 300

Query: 301  SNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXXDYLPPNLVDFETDQ 360
            SNDEPVKTLSSDNVVLNSQMNPKWLVTKYGF               DYLPPNLVDFETDQ
Sbjct: 301  SNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIETEEETEEQLIDYLPPNLVDFETDQ 360

Query: 361  DVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQTSFSTLFWSQILDE 420
            DVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQTSFSTLFWSQILDE
Sbjct: 361  DVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQTSFSTLFWSQILDE 420

Query: 421  NKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIAN 480
            NKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIAN
Sbjct: 421  NKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIAN 480

Query: 481  NRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGND 540
            NRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGND
Sbjct: 481  NRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGND 540

Query: 541  PTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIK 600
            PTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIK
Sbjct: 541  PTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIK 600

Query: 601  VNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNE 660
            VNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNE
Sbjct: 601  VNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNE 660

Query: 661  NAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLP 720
            NAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLP
Sbjct: 661  NAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLP 720

Query: 721  ADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGR 780
            ADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGR
Sbjct: 721  ADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGR 780

Query: 781  EINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQS 840
            EINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQS
Sbjct: 781  EINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQS 840

Query: 841  GNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQLIEIDDSSDSSGHKKVEEI 900
            GNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQLIEIDDSSDSSGHKKVEEI
Sbjct: 841  GNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQLIEIDDSSDSSGHKKVEEI 900

Query: 901  SQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESASNPISLEEDD 960
            SQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESASNPISLEEDD
Sbjct: 901  SQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESASNPISLEEDD 960

Query: 961  EQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEY 1020
            EQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEY
Sbjct: 961  EQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEY 1020

Query: 1021 LTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETT 1080
            LTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETT
Sbjct: 1021 LTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETT 1080

Query: 1081 DADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSSDALEKQGIE 1140
            DADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSSDALEKQGIE
Sbjct: 1081 DADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSSDALEKQGIE 1140

Query: 1141 TENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA 1200
            TENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA
Sbjct: 1141 TENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA 1200

Query: 1201 SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIE 1260
            SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIE
Sbjct: 1201 SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIE 1260

Query: 1261 PLKRIV 1266
            PLKRIV
Sbjct: 1261 PLKRIV 1266

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1419 bits (3672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/1275 (55%), Positives = 921/1275 (72%), Gaps = 35/1275 (2%)

Query: 24   VDLENDSEVNSSSMDLDSCGDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVP 83
            V+ E   E  S S   +  G    +  +D GK  LYP+A    PFKT++RLLD+I+  + 
Sbjct: 30   VETEQIGETMSESEISEDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLS 89

Query: 84   YILLSEKDESFNEFSNGXXXXXXXXXXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPE 143
            +I   +    +++ SNG                + +++G++VDQ++LQTKFEY S +CP+
Sbjct: 90   FINSDDHSILYSDLSNGILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQ 149

Query: 144  FNNIYVRLGVLIDTNHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDS 203
             N++ V +GVLID   Q ++TF+++A L I+HLK+TVK R  LERTK+  G+  YH LD 
Sbjct: 150  HNHLQVFMGVLIDVTQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDE 209

Query: 204  --LHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIK 261
              +HP+D+QDLL FD KDP+L+D+AIYVS D+NKL+L+EIF+PEFDS+EER++    +I 
Sbjct: 210  SEIHPYDKQDLLTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESIN 269

Query: 262  ERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMN 321
             R+  A  ++D+LD   IPTQ DCINT+FKIFKGPL RKS++EP KT++ +NV LNS ++
Sbjct: 270  NRYEMACNRFDSLDPTRIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHID 329

Query: 322  PKWLVTKYGFXXXXXXXXXXXXXXXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGK 381
            P WL +KYGF               +Y PP+L ++  D  VR+ RE+ TR+CLELI+LG+
Sbjct: 330  PTWLTSKYGFELHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGR 389

Query: 382  ISISLMTPEQKESASKSLRTFNLLQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLID 441
            +SI L++ E      K  R F+++QT+FST+FW Q+L E + I + + +  ++ D+H ID
Sbjct: 390  VSIRLLSQEAVNRNPKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFID 449

Query: 442  LSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEA 501
            LSA Y+Y DRDII+NYE QC LDP N+G+Y D+L+FIAN +G+Y LI YC KQD VGQEA
Sbjct: 450  LSACYNYIDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEA 509

Query: 502  LEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSS 561
            L+ AL  F +D    D  + ND++ ++IYKNE     N P R   L+N+LR+LAK K S 
Sbjct: 510  LDHALGVFQIDSKEFDPHNLNDSVLLSIYKNESASTRN-PNRHAELKNSLRLLAKFKKSP 568

Query: 562  RLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVS 621
            +LKFY DYEPY ++ +A+ ILEVDESVDDDIIQTAY++KVND+PGLKIDCDRALYT+AV 
Sbjct: 569  KLKFYADYEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVH 628

Query: 622  KRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVI 681
             RS+ L NFL Q+   FQ+++GPDQ++Y +AL  LQVNENA DDTILEIFQR+W  + V 
Sbjct: 629  SRSLALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVF 688

Query: 682  DADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLL 741
            DAD+ L LK  L+KI FERNSKLIS +++TG V+  CLPA+NWP GLNNIGNTCYLNSLL
Sbjct: 689  DADQFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLL 748

Query: 742  QYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLF 801
            QYYF IS LR YV DY+ T++   N  E  +  RRIGGREI + EVERSVQFVYQLRDLF
Sbjct: 749  QYYFSISSLRQYVLDYRNTVQHFLNNQE--YASRRIGGREITEAEVERSVQFVYQLRDLF 806

Query: 802  NEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQSGNGEDVDGD-IVFIDEDISEP 860
            + MIH+  RCVTP KELAYLAF PS + VEF+ PN  Q+     V+ +  V ID + S P
Sbjct: 807  DSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENYVNIDSEPSPP 866

Query: 861  KGKSLVLD--------EENSKV-ENSPENQLI-EIDDSSDSSGHKKVE-EISQNPC---- 905
                 +L           +SK+ +NS ++  I E D+S        V+  ++ +P     
Sbjct: 867  PNDEPLLIDLDDDSDPNNHSKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEK 926

Query: 906  --------------FGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESAS 951
                             + +TSTRVAKIS DQLENALE+GRQQDVTECIGNVLFQLESAS
Sbjct: 927  VTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESAS 986

Query: 952  NPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDA 1011
            +PISL +D+EQ DL+K+LFYG  KQ+IIPLK+  ++R K ERF+SLLVN+ DHPKD+YDA
Sbjct: 987  DPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDA 1046

Query: 1012 LDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETI 1071
            LDLYF DEYL ++EYG+VK+++AVT+FPTILQIQIQRVYYDRERFMPFKS+ PLPF+ETI
Sbjct: 1047 LDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETI 1106

Query: 1072 YMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSS 1131
            YMDRY++T +  L+ +K ET +L ++L+ ++ RQ+ELLS+NELGLSRK A +ET  FL S
Sbjct: 1107 YMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKS 1166

Query: 1132 DALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLF 1191
            D LE QGI+ +N+  L   L   +  I+DEL++LY++I  +E+KI  QFD F++IGYSLF
Sbjct: 1167 DVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLF 1226

Query: 1192 AVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYV 1251
            AVFIHRGEASYGHYW+YIKD  K+GIWRKYNDETITEVPE+EVFNF+EGNTATPYFLVYV
Sbjct: 1227 AVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYV 1286

Query: 1252 KQENLNEIEPLKRIV 1266
            KQ +  EIEPLKR++
Sbjct: 1287 KQGHEQEIEPLKRVL 1301

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1402 bits (3630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/1227 (56%), Positives = 905/1227 (73%), Gaps = 18/1227 (1%)

Query: 47   SVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGXXXXXX 106
            +++ +D GK++LY +     PFKTS+RLLD+++  + +I   + D  +++  NG      
Sbjct: 54   TLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPV 113

Query: 107  XXXXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFD 166
                     + P+S GT+VDQI LQT FEY S +CP  N + V +GVLID  H    T  
Sbjct: 114  LAYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSS 173

Query: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDS--LHPFDQQDLLNFDPKDPKLVD 224
             +++  +YHLK+TVK RS LE TK+  GV  YH +    LH FD+QDL  FDP DP+LVD
Sbjct: 174  TLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVD 232

Query: 225  HAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQID 284
            HAIYVS DTNKLVL+E+F PEFD EE+    +  AIK R+ +A +++DTLD  EIPTQ D
Sbjct: 233  HAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQAD 292

Query: 285  CINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXX 344
            CINT+ KIF+GPL R++++EP+KT++SDNVVLNS++NP WL +KYGF             
Sbjct: 293  CINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGES 352

Query: 345  XXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNL 404
              ++ PPNL ++  D+ VR+ RE+  RKC+ELI+LGK +I L+  + K + SK  RTFN 
Sbjct: 353  YFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAK-TTSKVYRTFNA 411

Query: 405  LQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLD 464
            +Q +FS   W ++L E+++I + +    ++ +Y+ I+LSA ++Y DRDII+NYE QC LD
Sbjct: 412  IQIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALD 471

Query: 465  PANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDA 524
            P N GIYFD+L +IAN +G+Y L+ YC KQD+VGQEAL+QALK F +D   +D++  +D+
Sbjct: 472  PENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDS 531

Query: 525  IFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEV 584
            + ++IYK+E   + N+  R T+L+NALR+LAK+K S +LKF+ DYEPY ++ RA+ ILEV
Sbjct: 532  LLVSIYKSETMANPNE-NRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEILEV 590

Query: 585  DESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGP 644
            DESVDDDII+TAYSI +ND+PGLKIDCDRALYT+ V KRS+ L+N+L Q+CP FQ +YGP
Sbjct: 591  DESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGP 650

Query: 645  DQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKL 704
                YSEAL  LQ+NENA D+T+LE+FQR+W  ++  ++D +L LK+ LTKI  ERNSKL
Sbjct: 651  GTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKL 710

Query: 705  ISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAV 764
            I  +++TG ++  CLPADNWP GLNNIGNTCYLNSLLQYYF ++PLR YV +YQ+T+E  
Sbjct: 711  ILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHF 770

Query: 765  ENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFA 824
             +    G + RRIGGRE+++ EVERSVQFVYQLRDLF  MI+S  RCVTP KELAYLAFA
Sbjct: 771  RH--HTGNELRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFA 828

Query: 825  PSNVEVEFDQPNELQSGN-----GEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPE 879
            PSN EVEF +P  + + +      E  + DI+        P  +S        ++++   
Sbjct: 829  PSNFEVEF-EPTTVNAQHEVSKIAESTNNDILMYG-----PTNRSDNDQTGPIELDSDSG 882

Query: 880  NQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTEC 939
            N+ I++  + + S   K +    +        TSTRVAKIS DQLENALE+GRQQDVTEC
Sbjct: 883  NEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTEC 942

Query: 940  IGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLV 999
            IGNVLFQLESAS+PI+L+ED+EQ DL+K+LFYGK KQ+IIPL  + EI+ KIER++SLLV
Sbjct: 943  IGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLV 1002

Query: 1000 NVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPF 1059
            N+ DHPKD+YDALD YFSDE LTM EYG+VK+++AVTEFPTILQIQIQRVYYDRERFMPF
Sbjct: 1003 NIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPF 1062

Query: 1060 KSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRK 1119
            KSIEPLPF+E +YMDRY+++ D  +++KK E+ +LK QLS ++ RQKELLS NELGLSRK
Sbjct: 1063 KSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRK 1122

Query: 1120 EAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQ 1179
             A+MET  +L SD ++ Q ++  N   LI++L  ++ DID ELT LY+DI  +E  ID+Q
Sbjct: 1123 AAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQ 1182

Query: 1180 FDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTE 1239
            F++F+ IGYSLFAVFIHRGEASYGHYWVYIKD +KNG WRKYNDETITEVPE EVFNFTE
Sbjct: 1183 FEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTE 1242

Query: 1240 GNTATPYFLVYVKQENLNEIEPLKRIV 1266
            GNTATPYFLVYV+Q + ++IEPLKRI+
Sbjct: 1243 GNTATPYFLVYVRQGHEHDIEPLKRII 1269

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1389 bits (3596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/1230 (56%), Positives = 918/1230 (74%), Gaps = 15/1230 (1%)

Query: 43   GDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFN------E 96
            G+   ++  DDG +LLY +  +++P KTSER+LD+I+ ++P + +    E+ N      +
Sbjct: 59   GNEMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQ 118

Query: 97   FSNGXXXXXXXXXXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLID 156
            F+N             R  V P S+G+IVDQI++Q+KFEYKS TCP  N I V +GVLID
Sbjct: 119  FNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLID 178

Query: 157  TNHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFD 216
            +  Q  +T DD++++ I H+KITVK R+ LERT+R +G+ ++HL+  LHPFDQ+DLL FD
Sbjct: 179  ST-QKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFD 237

Query: 217  PKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDK 276
                 L+DHAIYVS+DTNKL+L+EIF PEFDS+EER   T   I +R++ +  + +    
Sbjct: 238  KNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPST 297

Query: 277  DEIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXX 336
            ++IPT I+CINT+FK+FKGPLTRKS+++P+K ++SDN +L   MNP+WLV+KYGF     
Sbjct: 298  EDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLE 357

Query: 337  XXXXXXXXXXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESAS 396
                      +Y PP+L D+ ++Q  RK RE+VTRKCLELI+ GK+ I+L++ E+ E +S
Sbjct: 358  KDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLLSKEELEKSS 417

Query: 397  KSLRTFNLLQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQN 456
            KSLRTFNLLQTSFST F+  ++ E      ++     N+DYH I+LS SYHY++RDIIQ 
Sbjct: 418  KSLRTFNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQM 477

Query: 457  YELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTI 516
            +E+  K+DP NIG Y+DSL FIAN +GSY LI YC K DIVGQE+LE A+KTF+LD    
Sbjct: 478  FEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVT 537

Query: 517  DLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQ 576
             LS   D++ M+IY+ E+K       R  NLRNAL++LA +K S +LKF+VDYEPY + +
Sbjct: 538  ALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTR 597

Query: 577  RAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECP 636
             A+N+LE+DES+DDDIIQTAYSIKVND PGLK+DCDRALYT+A+++RS+ L NFL +   
Sbjct: 598  TAYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLLENNL 657

Query: 637  PFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKI 696
             FQ++Y  D ++Y+ AL  LQVNENA+D+ ILE+FQ++W  ++++  D +L LK+ LTKI
Sbjct: 658  IFQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAALTKI 717

Query: 697  AFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVAD 756
            AF+RNSKLIS++LETGV++P CLPA+NWP GLNNIGNTCYLNSLLQYYF ISPLR+ + +
Sbjct: 718  AFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777

Query: 757  YQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTK 816
            Y KT++ +EN L+     RR+GGR  N +EVERSVQFVYQLRDLF+EMI+S SRCVTP K
Sbjct: 778  YTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKK 837

Query: 817  ELAYLAFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVEN 876
            ELAYLAFAPSNVEVEFD  +E      +++  + V +  D    K  +L++D +++   N
Sbjct: 838  ELAYLAFAPSNVEVEFD--SEDGKSQRDNISTETVDVGAD---GKNDNLLVDFDSNIGAN 892

Query: 877  SPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDV 936
              + +L+ +D  S+ S   K EE+ +         TSTRVAKIS DQLENALE+GRQQDV
Sbjct: 893  GRDEKLL-VDLDSNISDKIKEEEVKKINTLKPV--TSTRVAKISPDQLENALEMGRQQDV 949

Query: 937  TECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVS 996
            TECIGNVL QLESAS P+SL++D+EQ DL+K  F  KTKQSIIPL+ +   RNKIERF+S
Sbjct: 950  TECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLS 1009

Query: 997  LLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERF 1056
            LLVN+ DHPK++YDALDLYF+DE L M+EYGEV+K+L++TEFP+ILQIQIQRVYYDRE+F
Sbjct: 1010 LLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKF 1069

Query: 1057 MPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGL 1116
            +PFKSIEPLPF   +YMDRY E  + +L+  K++   +KK+L+ M+KRQKELLSRNELGL
Sbjct: 1070 IPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGL 1129

Query: 1117 SRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKI 1176
            SRKE+ +ET++ L SD L+  GI+   K  LI ++   L +ID ELT L+N+I ++E  I
Sbjct: 1130 SRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNI 1189

Query: 1177 DRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
               F +FQ+I Y+LFAVFIHRGEASYGHYW YIKDF +N IWRKYNDETITEVP++EVFN
Sbjct: 1190 SNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFN 1249

Query: 1237 FTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            F EGNTATPYFLVYVK EN+++IEPLKRIV
Sbjct: 1250 FIEGNTATPYFLVYVKNENIDDIEPLKRIV 1279

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1372 bits (3550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1274 (54%), Positives = 913/1274 (71%), Gaps = 63/1274 (4%)

Query: 44   DATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESF--------- 94
            D+  +   DDGK +LY    + + FKT++RLLD++M  + Y+L +   E           
Sbjct: 54   DSNIIPEVDDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDN 113

Query: 95   ------------------NEFSNGXXXXXXXXXXXXRHNVQPFSVGTIVDQIILQTKFEY 136
                                + NG            R++   F++GTIVDQI LQT+FE+
Sbjct: 114  NHNNNNNTSNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEF 173

Query: 137  KSTTCPEFNNIYVRLGVLIDTNHQ-PLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGV 195
            KS TCPEFN+++V LGVL+D   Q PL TF     L +YH KITVK RS+LE+TK+HVG+
Sbjct: 174  KSVTCPEFNDVHVLLGVLMDNRSQAPLGTF-----LPVYHFKITVKTRSYLEKTKKHVGI 228

Query: 196  PRYHLLD--SLHPFDQQDL--LNFDPKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEE 251
              +HL+D   LH FD++DL   N D     L+D AI++S+DTNKLV+LEIF+PEF+  EE
Sbjct: 229  SHFHLIDFDDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEE 288

Query: 252  RNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSS 311
              S +  +I ER+I A  ++  LD+ +IPTQ++C+NT+FKIFKGPL  K+ +EP+K +++
Sbjct: 289  IESFSQESIAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINA 348

Query: 312  DNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXXDYLPPNLVDFETDQDVRKSREAVTR 371
            DN +LNS  NP WL+TKYGF               +YLPPNL D+  D + R  RE+  R
Sbjct: 349  DNPLLNSHWNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIR 408

Query: 372  KCLELIWLGKISISLMTPEQKESASKSLRTFNLLQTSFSTLFWSQILDENKNIATMKENP 431
            KCLELI++ K +ISLM P   +  SK++R+FN+LQT F+T FW Q L E+K    +    
Sbjct: 409  KCLELIFISKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHK--PQLDTYN 466

Query: 432  QMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYC 491
            +++ +YH I+L  S++YT+RDII+NY     LDP NIGIY+D+L +IA ++ SY LI + 
Sbjct: 467  KLDYEYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFV 526

Query: 492  DKQDIVGQEALEQALKTFSLDP-DTIDLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNA 550
             KQD++GQEAL QAL  F++D  D+  +S   +++  TIYK E K       RL  ++NA
Sbjct: 527  SKQDVIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQANISSARLAEMKNA 586

Query: 551  LRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIKVNDTPGLKID 610
            LR+LAK+K+S RLKFY DYEPY S  + +N LEVDESVDDDIIQTAY+IKVND PGLKID
Sbjct: 587  LRLLAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKID 646

Query: 611  CDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNENAADDTILEI 670
            CDRAL TVA  ++S+ L  FL QECP F +FYG D++ Y +AL  LQVNENA D+TILEI
Sbjct: 647  CDRALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEI 706

Query: 671  FQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNN 730
            FQ+RW++D  +D D +L+L+S L+KIA+E+NSKLIS++++TG+V+P CLP +NWPAGLNN
Sbjct: 707  FQQRWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNN 766

Query: 731  IGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVEN--CLEDGWDKRR-IGGREINKVEV 787
            IGNTCYLNSLLQYYF I PLR+++  YQ T++  +N   L    +KRR IGGRE+N++EV
Sbjct: 767  IGNTCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEV 826

Query: 788  ERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPN-ELQSGNGEDV 846
            ERSVQF+YQ+RDLF EMI S  RCV+P +ELAYLAF PSN+EVEF+  + E   G+  + 
Sbjct: 827  ERSVQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNA 886

Query: 847  DGDIVFIDE-----DISEPKGKSLVLDEENSKVENS---PENQLIEIDDSSDSSGHKKVE 898
               +V  DE     DI+  +   + L E  +KV  S   P    IEI  +SD+    K +
Sbjct: 887  QDAVVLQDEAKNDTDINLTEVNLIDL-EPATKVSTSNDQPTMDAIEILTNSDN----KSK 941

Query: 899  EISQNPCF-----GKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESASNP 953
            E+S+   F      +    STRVAKIS DQLENA E+GRQQDVTECIGNVLFQLE+  +P
Sbjct: 942  ELSKTNPFREVSPNEDITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGFDP 1001

Query: 954  ISLE-EDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDAL 1012
            ISL+ ED+EQYDL+K+LFYGKTKQSIIPL +N+  R K+ERF+SLLVN++DHPKD+YDAL
Sbjct: 1002 ISLDNEDNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYDAL 1061

Query: 1013 DLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIY 1072
            + YF+DE+LTM+EYG+VKK+L++TE+P ILQIQIQRVYYDRERFMPFKSIEPLPF + IY
Sbjct: 1062 NQYFADEFLTMEEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQVIY 1121

Query: 1073 MDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSSD 1132
            MDRY E++D +L+ KK+ET +LK +L E R RQKELLS+NELGLSRKEA MET KFL S 
Sbjct: 1122 MDRYAESSDPELISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLKSP 1181

Query: 1133 ALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFA 1192
             + + GI+T NK +L+  L   +  I++EL+ LYN I  ++ +ID QFD F+ + YSLFA
Sbjct: 1182 VILENGIDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSLFA 1241

Query: 1193 VFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVK 1252
            VFIHRGEASYGHYWVYIKD +KNGIWRKYNDE++TEVPE EVFNFTEGNTATPYFLVYVK
Sbjct: 1242 VFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVYVK 1301

Query: 1253 QENLNEIEPLKRIV 1266
            Q++L++IEPLKRI+
Sbjct: 1302 QDSLSDIEPLKRII 1315

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 1355 bits (3507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1234 (54%), Positives = 887/1234 (71%), Gaps = 35/1234 (2%)

Query: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEF---SNGXXXXXXXX 108
            DDGK LLYPD     P KTS+RLLD+I+C    I L+  D S  E    + G        
Sbjct: 54   DDGKHLLYPDIATSLPLKTSDRLLDDILCDT--IFLNSTDPSVIEKGLQTTGILRESMLS 111

Query: 109  XXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTN--HQPLSTFD 166
                R +++P ++G++ DQ+++QTK EY S +CP++N I+V   V+++ +   Q +S+FD
Sbjct: 112  YSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFD 171

Query: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226
            D+  + IYHLK+TVK+R  LER K+HVGV ++H +D LH +D+ D   FD  DP L+D+ 
Sbjct: 172  DIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYG 231

Query: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286
            IYVSDDTNKL+L+EIF+PEFDS EE  S T+ AIK R+       ++LDK+  P+Q DC 
Sbjct: 232  IYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCF 291

Query: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXX 346
             T+FKIFKGPLTRKS  EPVKT+ S N+ LN+ +NP+WL +KYGF               
Sbjct: 292  YTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFT 351

Query: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406
            +YLPP++VD+  D  VRK RE+  RKCL+L++ G++S SL+ P      +KS++  + LQ
Sbjct: 352  EYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQ 411

Query: 407  TSFSTLFWSQILDENKNIATMKENPQ---MNLDYHLIDLSASYHYTDRDIIQNYELQCKL 463
            TSFS+L W  +L E+++   +  N     ++ + H ++LS S++YTDRDII+NYE    L
Sbjct: 412  TSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSL 471

Query: 464  DPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTND 523
            DP NIG+YFD+L +IAN +G+Y LI YC KQDI+GQEALE AL  F ++P   ++++ N+
Sbjct: 472  DPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNE 531

Query: 524  AIFMTIYKNEVKLHGNDPT-RLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNIL 582
            A  ++IYK E        +  LTNL+NALR+LAK+  S +LKFYVD+EPY ++ +A++ L
Sbjct: 532  ATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL 591

Query: 583  EVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFY 642
             +DESVD+DII+TAYS+K+ND+PGLK+DCDRALYT+A+SK+S+ L NFL  ECP F  +Y
Sbjct: 592  SIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYY 651

Query: 643  GPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNS 702
            G +Q  Y EAL+ LQVNENA+D+TIL+IF+++W  +SV + D+ L+LK+ LTKI+ ERNS
Sbjct: 652  GAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNS 711

Query: 703  KLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLE 762
             LIS++L TG ++P  LP +NWP G+NNIGNTCYLNSLLQYYF I+PLR Y+ DYQKT+E
Sbjct: 712  NLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVE 771

Query: 763  AVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLA 822
               + L +    RRIGGR+I+K EVERSVQF+YQLR+LF  M+HS  RCVTP+KELAYLA
Sbjct: 772  NFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLA 831

Query: 823  FAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKG-KSLVLDEENSKVENSPENQ 881
            FAPSN+EVEF+       GN +  DG  +        P G K     E  +  EN P++ 
Sbjct: 832  FAPSNIEVEFEV-----EGN-KPADGAAI--------PIGLKEEATQESCTTKENDPKSI 877

Query: 882  LIEIDDSSDSSGHKKVEEISQNP------CFGKST---DTSTRVAKISFDQLENALELGR 932
              +++D+++   H+      +N         G  T   ++ TRVAKIS DQLENALE+GR
Sbjct: 878  GSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGR 937

Query: 933  QQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIE 992
            QQDVTECIGNVLFQ+ES S PI  +ED+EQYDL+K+LFYG TKQSI+PL   N++R K+E
Sbjct: 938  QQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVE 997

Query: 993  RFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYD 1052
            RF+SLL+N+ DHPKD+YDA D YF DEYLTM+EYG+V +++AVT FPTILQ+QIQRVYYD
Sbjct: 998  RFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYD 1057

Query: 1053 RERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRN 1112
            RERFMPFKSIEPLPF E IYMDRY +T +  LL KK+ET E+K++L  M+ RQ+ELLSR+
Sbjct: 1058 RERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRD 1117

Query: 1113 ELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNI 1172
              GL+RK+AF+E+ K L S  +EK  ++TE K  +I+ L   + +ID+EL  LYN+I N+
Sbjct: 1118 NSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNL 1177

Query: 1173 EAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEA 1232
            E KI  QFD F+  GYSLF+VFIHRGEASYGHYW+YIKD   NG+WRKYNDET++EV E 
Sbjct: 1178 EEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQED 1237

Query: 1233 EVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            EVFNF EGNTATPYFLVYVKQ    +IEPLKRI+
Sbjct: 1238 EVFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1271

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 1355 bits (3506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1236 (54%), Positives = 886/1236 (71%), Gaps = 39/1236 (3%)

Query: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEF---SNGXXXXXXXX 108
            DDGK LLYPD     P KTS+RLLD+I+C    I L+  D    +    S G        
Sbjct: 54   DDGKHLLYPDIATNLPLKTSDRLLDDILCDT--IFLNSTDPKVMQKGLQSRGILKESMLS 111

Query: 109  XXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTN--HQPLSTFD 166
                R +++P  +G++ DQ++ QTK EY S +CP++N I+V   V+ + +   Q +STFD
Sbjct: 112  YSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFD 171

Query: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226
            D+  + IYHLK++VKVR  LER K+HVGV ++H LD LH +D+ DL  FD  DP L+D+ 
Sbjct: 172  DIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYG 231

Query: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286
            IYVSDDTNKL+L+EIF+PEF+S EE  S T  AIK+R+     K ++LDK E P+Q+DC 
Sbjct: 232  IYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCF 291

Query: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXX 346
             T+FKIFKGPLTRKS  EP KT+ S N+ LN+ +NP+WL +KYGF               
Sbjct: 292  YTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFT 351

Query: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406
            +Y+PP++VD+  D + RK RE+  RKCL+LI+ G++S SL+ P      +KS++  + LQ
Sbjct: 352  EYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQ 411

Query: 407  TSFSTLFWSQILDENKNIATMKENPQ----MNLDYHLIDLSASYHYTDRDIIQNYELQCK 462
            TSFSTL W  +L E++    +  N Q    ++ + H I+LS S++YTDRDII+NYE    
Sbjct: 412  TSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSS 471

Query: 463  LDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTN 522
            LDP NIG+YFD+L +IAN +G+Y LI YC KQDI+GQEALE AL  F ++P   ++S+ N
Sbjct: 472  LDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELN 531

Query: 523  DAIFMTIYKNEVKLHGN-DPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNI 581
            +A  ++IYK E           LTNL+NALR+LAK+  S +LKFYVD+EPY ++ +A++ 
Sbjct: 532  EATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591

Query: 582  LEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDF 641
            L +DESVD+DII+TAYS+K+ND+PGLK+DCDRALYT+A+SKRS+ L NFL +ECP F ++
Sbjct: 592  LSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNY 651

Query: 642  YGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERN 701
            YGP++  Y EAL+ LQVNENA+D+TIL+IF+++W  ++V + D+ L L++ LTKI+ ERN
Sbjct: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERN 711

Query: 702  SKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTL 761
            S LI+++L TG ++P  LP +NWP G+NNIGNTCYLNSLLQYYF I+PLR YV +YQKT+
Sbjct: 712  STLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTV 771

Query: 762  EAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYL 821
            E   + L +    RRIGGREI++ EVERS+QF+YQLR+LF  M+H+  RCVTP+KELAYL
Sbjct: 772  ENFNDHLSNSGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYL 831

Query: 822  AFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQ 881
            AFAPSNVEVEF+            V+G+ V     +     K    D   +K++++    
Sbjct: 832  AFAPSNVEVEFE------------VEGNKVVDQTGVLSDSKKETTDDAFTTKIKDT---S 876

Query: 882  LIEID-------DSSDSSGHKKVE----EISQNPCFGKSTDTSTRVAKISFDQLENALEL 930
            LI+++       D    +  KK E    E+S+N      T + TRVAKIS DQLENALE+
Sbjct: 877  LIDLEMEDGLNGDVGTDANRKKNESNDAEVSENEDTTGLT-SPTRVAKISSDQLENALEM 935

Query: 931  GRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNK 990
            GRQQDVTECIGNVLFQ+ES S PI  +ED+EQYDL+K+LFYG TKQSI+PL   N++R K
Sbjct: 936  GRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTK 995

Query: 991  IERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVY 1050
            +ERF+SLL+N+ DHPKD+YDA D YF DEYLTM+EYG+V +++AVT FPTILQ+QIQRVY
Sbjct: 996  VERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVY 1055

Query: 1051 YDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLS 1110
            YDRER MPFKSIEPLPF E IYMDRY +T +  LL KK ET E+K++L  M+ RQ+ELLS
Sbjct: 1056 YDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLS 1115

Query: 1111 RNELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIV 1170
            R++ GL+RK+AF+E+ K L SD ++K  ++ E    +I  L   +++ID+EL KLYNDI 
Sbjct: 1116 RDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDIN 1175

Query: 1171 NIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVP 1230
            ++E KI  QFD F+  GYSLF+VFIHRGEASYGHYW+YIKD  +NGIWRKYNDETI+EV 
Sbjct: 1176 SLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQ 1235

Query: 1231 EAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            E EVFNF EGNTATPYFLVYVKQ    +IEPLKRI+
Sbjct: 1236 EEEVFNFNEGNTATPYFLVYVKQGQEGDIEPLKRIL 1271

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 1354 bits (3504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/1237 (53%), Positives = 884/1237 (71%), Gaps = 43/1237 (3%)

Query: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEF---SNGXXXXXXXX 108
            DDGK LLYPD     P KTS+RLLD+I+C   +   +  D S  E    ++G        
Sbjct: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAF--FNSTDPSVIERGLQTSGILKKSMLS 111

Query: 109  XXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTN--HQPLSTFD 166
                R  ++P ++G++ DQ++LQTK EY S +CP++N I V   V+ + +   Q ++ FD
Sbjct: 112  YSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFD 171

Query: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226
            D+  + IYHLK+TVK+R  LER K+HVGV ++H LD LH +D  DL  FD  DP L D+ 
Sbjct: 172  DIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYG 231

Query: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286
            IYVSDDTNKL+L+EIF PEFDS EER+S T  AI++R+     K ++L+++E P+Q DC 
Sbjct: 232  IYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCF 291

Query: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXX 346
             T+FKIFKGPL RKS  +P+KT+ S N+VLN+ +NP+WL +KYGF               
Sbjct: 292  YTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFT 351

Query: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406
            +Y+PP++VD+  D  +RK RE+  RKCL+LI+ G++S SL+ P      +KS++  + +Q
Sbjct: 352  EYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGLSSIQ 411

Query: 407  TSFSTLFWSQILDENKNIATMKENPQ----MNLDYHLIDLSASYHYTDRDIIQNYELQCK 462
            TSFS L W Q+L E++    +  N Q    ++ + H I+LS S++YTDRDII+NYE    
Sbjct: 412  TSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSS 471

Query: 463  LDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTN 522
            LDP NIG+YFD+L +IAN +G+Y +I YC KQDI+GQEALE AL  F +DP   D+++ N
Sbjct: 472  LDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELN 531

Query: 523  DAIFMTIYKNEVKLHGNDPT-RLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNI 581
            +A  ++IYK E        +  LTNL+NALR+LAK+  S +LKFYVD+EPY ++ +A++ 
Sbjct: 532  EATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591

Query: 582  LEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDF 641
            L +DESVD+DII+TAYSIK+ND+PGLK+DCDRALYT+A+SKRS+ L NFL  ECP FQ++
Sbjct: 592  LAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNY 651

Query: 642  YGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERN 701
            YGP++  Y EAL+ LQVNENA+D+TIL+IF+ +W  ++V + D+ L LK+ LTKI+ ERN
Sbjct: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERN 711

Query: 702  SKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTL 761
            S LI+++L TG ++P  LP +NWP G+NNIGNTCYLNSLLQYYF I+PLR+Y+ +YQKTL
Sbjct: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTL 771

Query: 762  EAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYL 821
                + L +    RR+GGREI++ EVERS+QF++QLR+LF  M+HS  RCVTP+KELAYL
Sbjct: 772  NNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYL 831

Query: 822  AFAPSNVEVEFDQPNELQSGNG-----EDVDG-------DIVFIDEDISEPKGKSLVLDE 869
            AFAPSNVEVEF+     +S +      E+  G       D + ID ++ E     +  DE
Sbjct: 832  AFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKDE 891

Query: 870  ENSKVENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALE 929
             N +   S + ++I  DD++D +                   + TRVAKIS DQLENALE
Sbjct: 892  NNHEKTESNDVEIIMTDDATDLA-------------------SPTRVAKISSDQLENALE 932

Query: 930  LGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRN 989
            +GRQQDVTECIGNVLFQ+ES S PI  +ED+EQYDLIK+LFYG TKQ I+PL   +++R 
Sbjct: 933  MGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRT 992

Query: 990  KIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRV 1049
            K+ERF+SLLVN+ DHPKD+YDA D YF DEYLTM EYG+VK+++AVT FPTILQ+QIQRV
Sbjct: 993  KVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRV 1052

Query: 1050 YYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELL 1109
            YYDRERFMPFKSIEPLPF E IYMDRY +T +  LL KK+ET +LK++  +M+ RQ+ELL
Sbjct: 1053 YYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELL 1112

Query: 1110 SRNELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDI 1169
            +R+  GL+RK+AF+ET K L S  +E   +  E+K+ LI  L   + DID+EL  LY+DI
Sbjct: 1113 NRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDI 1172

Query: 1170 VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEV 1229
             ++E KI  QFD F+  GYSLF+VFIHRGEASYGHYW+YIKD  +NG+WRKYNDETI+EV
Sbjct: 1173 NSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEV 1232

Query: 1230 PEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            PE EVFNF EGNTATPYFLVYVKQ    +IEPLKRI+
Sbjct: 1233 PEEEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRIL 1269

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 1347 bits (3486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1240 (53%), Positives = 890/1240 (71%), Gaps = 41/1240 (3%)

Query: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEF---SNGXXXXXXXX 108
            DDGK LLYPD     P KTS+RLLD+++C    I L+  D +  E    ++G        
Sbjct: 54   DDGKHLLYPDIATSLPLKTSDRLLDDVLCDT--IFLNSTDPNVIEKGLQTSGILRESMLS 111

Query: 109  XXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTN--HQPLSTFD 166
                R +++P ++G++ DQ+ +QTK EY S +CP +N IYV   V+++ +   Q +S+FD
Sbjct: 112  YSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFD 171

Query: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226
            D+  + IYHLK+TVK+R  LER K+HVGV ++H LD LH +D+ DL  FD  DPKL+D+ 
Sbjct: 172  DIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYG 231

Query: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286
            IYVSDDTNKL+L+EIF+PEF+S EE  S T  AIK+R+     K ++L+K E P+Q DC 
Sbjct: 232  IYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCF 291

Query: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXX 346
             T+FKIFKGPLTRKS +EP+KT+ S N+VLN+ +N +WL +KYGF               
Sbjct: 292  YTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFT 351

Query: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406
            +Y+PP++V +  D + RK RE+  +KCL+LI+ G++S SL+TP      +KS++  + LQ
Sbjct: 352  EYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQ 411

Query: 407  TSFSTLFWSQILDENKNIATMKENPQ----MNLDYHLIDLSASYHYTDRDIIQNYELQCK 462
            TSFST  W  +L E++    +  N Q    ++ + H I+LS S++YTDRDII+NYE    
Sbjct: 412  TSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSS 471

Query: 463  LDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTN 522
            LDP NIG+YFD+L +IAN +G+Y LI YC KQ+I+GQEALE AL TF +DP   ++++ N
Sbjct: 472  LDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELN 531

Query: 523  DAIFMTIYK----NEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRA 578
            +A  ++IYK    N+ K+  N    LTN +NALR+LAK+  S +LKFYVD+EPY ++ +A
Sbjct: 532  EATLLSIYKFETSNKSKVTSN---HLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQA 588

Query: 579  FNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPF 638
            ++ L +DESVD+DII+TAYSIK+ND+PGLK+DCDRALYT+A+SKRS+ L NFL  ECP F
Sbjct: 589  YDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQF 648

Query: 639  QDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAF 698
              +YGP++  Y EAL+ LQVNENA+D+T+L+IF+++W  +SV + D+ L L++ LT+I+ 
Sbjct: 649  LKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISI 708

Query: 699  ERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQ 758
            ERNS LI+++L TG ++P  LP +NWP G+NNIGNTCYLNSLLQYYF I+PLR Y+ +YQ
Sbjct: 709  ERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQ 768

Query: 759  KTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKEL 818
            KTL+   + L +    RRIGGREI++ EVERS+QF+YQLR+LF  M+HS  RCVTP+KEL
Sbjct: 769  KTLDNFNDHLSNSGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKEL 828

Query: 819  AYLAFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSP 878
            AYLAFAPSNVEVEF+        NG  +  D           KG+ +  +   +  E  P
Sbjct: 829  AYLAFAPSNVEVEFEVEGNKVGSNGAAISAD----------SKGE-VTQEAATTSEEKDP 877

Query: 879  ENQLIEIDDSSDSSGHKKVEEISQNPC---------FGKS-TD--TSTRVAKISFDQLEN 926
                +E++D ++S   K +E +  N            G++ TD  + TRVAKI  DQLEN
Sbjct: 878  SLIDLEMEDKTNSDVDKDIENVKANEANEANDIEITVGENITDLASPTRVAKIGSDQLEN 937

Query: 927  ALELGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNE 986
            ALE+GRQQDVTECIGNVLFQ+ES S PI  +ED+EQYDLIK+LFYG TKQSI+PL   ++
Sbjct: 938  ALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDK 997

Query: 987  IRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQI 1046
            +R K+ERF+SLLVN+ DHPKD+YDA D YF DEYLTM+EYG+VK+++AVT FPTILQ+QI
Sbjct: 998  VRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQI 1057

Query: 1047 QRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQK 1106
            QRVYYDRERFMPFKSIEPLPF E IYMDRY++T +  LL KK+ET ++K+ L  M+ RQ+
Sbjct: 1058 QRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQR 1117

Query: 1107 ELLSRNELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLY 1166
            ELL R+E GL+RK+AF+E+ K L S+ +  +   +E+ + +I  L   + DID+EL  LY
Sbjct: 1118 ELLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLY 1177

Query: 1167 NDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETI 1226
            NDI ++E KI  QFD F+  GYSLF+VFIHRGEASYGHYW+YIKD    G+WRKYNDETI
Sbjct: 1178 NDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETI 1237

Query: 1227 TEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            +EV E EVFNF EGNTATPYFLVYVKQ   ++IEPLKRI+
Sbjct: 1238 SEVQEEEVFNFNEGNTATPYFLVYVKQGQESDIEPLKRIL 1277

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1345 bits (3481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/1227 (55%), Positives = 880/1227 (71%), Gaps = 37/1227 (3%)

Query: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGXXXXXXXXXXX 111
            DDGK LLYP      PFKTS+RLLD+I   + ++   E D  +++  NG           
Sbjct: 34   DDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHNGVLRLPMLEYSR 93

Query: 112  XRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADL 171
             +   QP SVG ++DQ+ L+TK+EY+S TCPE N I V +GVL+D + +P  + DDV ++
Sbjct: 94   KK-TTQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVDQHIRP-ESLDDVINV 151

Query: 172  KIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHAIYVSD 231
             IYHLKITVK R  LER K+HVGV  YHL+D LH FD+QD+     +  +LVD A YVS 
Sbjct: 152  PIYHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDIF-MTTESEQLVDSATYVSS 210

Query: 232  DTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFK 291
            DTN+L+ +EIF+PEF ++E+    +   +KER+  A +K+  LD   +PTQ++C+NT+FK
Sbjct: 211  DTNRLLRIEIFKPEF-TKEDLAIFSQEKVKERYASACEKFQDLDPTSVPTQVECLNTLFK 269

Query: 292  IFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXXDYLPP 351
            IFKGPL R+S+++ +KT+S+DN  LNSQ++P WL  KY F               ++ PP
Sbjct: 270  IFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETGELIREFEPP 329

Query: 352  NLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQTSFST 411
            +L D+  D  VR  RE+ TRKCLELI+LGK S  L+  +     SKS R+FNL QT+FST
Sbjct: 330  DLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKS-RSFNLYQTNFST 388

Query: 412  LFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIY 471
             FW  +L + +N          + DYH I+LSAS +Y+D+DII+NYE Q  LDP N+GIY
Sbjct: 389  SFWFHLLGDGRNFQDHNLQQPFDNDYHFINLSASSYYSDKDIIKNYETQISLDPENVGIY 448

Query: 472  FDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYK 531
            FD+L++IAN +G Y LI YC KQ+IVG+EAL+ AL  F +D    D+    D + ++IYK
Sbjct: 449  FDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKSITDELLLSIYK 508

Query: 532  NEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDD 591
            NE+K       + T+L+NALR+LAK K S +LKF+VDYEPY+S  +A+ +LE+ ESVD D
Sbjct: 509  NELK--AASVQKRTDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAYQLLEIGESVDLD 566

Query: 592  IIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSE 651
            IIQTAY+I+V D PGLKIDCDRALYT+AV+KRS++L NFL QECP FQ+FY  D ++Y E
Sbjct: 567  IIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQEFYNIDNWSYKE 626

Query: 652  ALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLET 711
            AL  LQVNENA DD ILEIFQR+W+ + +   D+ L LK+ LTK+  ERNSKLI+++++T
Sbjct: 627  ALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIERNSKLINNFIDT 686

Query: 712  GVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDG 771
            G+V+  CLPA NWP GLNNIGNTCYLNSLLQYYF ISPLR+YV +YQK L    NC  D 
Sbjct: 687  GIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQKML----NCFRDI 742

Query: 772  WD-------KRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFA 824
             D       KRRIG RE++K EVERSVQFVYQLRDLF +M+H+  R VTPTKELAYLAFA
Sbjct: 743  EDATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTKELAYLAFA 802

Query: 825  PSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQLIE 884
            PSN+EVEF+ P  + +   ED       +DE  ++     L  D  +++ E   ++ L++
Sbjct: 803  PSNIEVEFEAPT-ITTVAPED-------LDERTNKLDIIDLAADGIDNETEKGSKSSLLD 854

Query: 885  IDDSSDSSGHKKVEEISQNPCFG-----KSTDTSTRVAKISFDQLENALELGRQQDVTEC 939
            + +       +K EE +++   G     ++ + S RVAKIS DQLEN LELGRQQDVTEC
Sbjct: 855  VHN------QQKPEEQTEDIIMGGTQEEEAVNASMRVAKISSDQLENTLELGRQQDVTEC 908

Query: 940  IGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLV 999
            IGNVLFQLESAS+P SLEED+EQ+DLIK+LFYGK KQ +IP+KN ++IR KIERFVSLLV
Sbjct: 909  IGNVLFQLESASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRTKIERFVSLLV 968

Query: 1000 NVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPF 1059
            N+ DHPKD+YDALDLYF D+ L +DE GEVK+++AVT  P ILQIQIQRVYYDRERFMPF
Sbjct: 969  NIGDHPKDIYDALDLYFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQRVYYDRERFMPF 1028

Query: 1060 KSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRK 1119
            KSIEPLPFSETIYMDRY +T D  +L K+D+T +LK++L  ++ RQ +LLS+N+ GLS K
Sbjct: 1029 KSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLLSKNDTGLSFK 1088

Query: 1120 EAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQ 1179
             + ++T+KFL S+ L+K  I  ENK  L+  +   +  ID EL+ LY  I  +E +I  Q
Sbjct: 1089 GSLLQTKKFLQSEVLDKHEIAVENKGALVCHIDSMITKIDGELSSLYQKITALEVQIANQ 1148

Query: 1180 FDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTE 1239
            F++F  IGYSLFA FIHRGEASYGHYW+YIKD  KNGIWRKYNDE++TEVP++EVFNFTE
Sbjct: 1149 FNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEVFNFTE 1208

Query: 1240 GNTATPYFLVYVKQENLNEIEPLKRIV 1266
            GNTATPYFLVY+K+ + +EIEPLKR++
Sbjct: 1209 GNTATPYFLVYIKEGHEDEIEPLKRVI 1235

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1328 bits (3436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1246 (53%), Positives = 891/1246 (71%), Gaps = 40/1246 (3%)

Query: 48   VSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNE-----FSNGXX 102
            V   DDGKQLLYP+  +  P KT+ERL+D+I+  + ++     D            NG  
Sbjct: 32   VRVADDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDIDTMLGNGIL 91

Query: 103  XXXXXXXXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPL 162
                      ++    F +G+++DQ+ LQTK+EYKS TCPE N + V  GVL + + Q +
Sbjct: 92   KQSMLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFNNSTQ-I 150

Query: 163  STFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKL 222
            +  D+V    IYHLK+TVK R+ LE TK+H GV ++HL+D LH +D+QD+  F+P+DP L
Sbjct: 151  TNLDEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDIPTFNPEDPNL 210

Query: 223  VDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQ 282
            +D+AIYVS+DTNKL+L+E+F+PEF S +E  S     I ER+ KA +++DTL+ +E PTQ
Sbjct: 211  LDYAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEPPTQ 270

Query: 283  IDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXX 342
            +DC+NT+FK+FKGPL+RKS+DEP KT+ S N  LNS +NP+WL +KYGF           
Sbjct: 271  LDCLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNIVVDEDLPNA 330

Query: 343  XXXXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTF 402
                +Y PP LV++  D +VR+ RE   R+CL+LI+ GK+SI+L   +     SKS ++ 
Sbjct: 331  QQSVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKSYKSI 390

Query: 403  NLLQTSFSTLFWSQILDENKNIATMKENPQMNLDY--HLIDLSASYHYTDRDIIQNYELQ 460
            N LQT+F+     Q+   +     M    +  LD+  H I+LSA YHYTDRD+I+NYE  
Sbjct: 391  NALQTNFTITPLLQLFKGSGQNFLMGPESRSPLDFNFHFINLSACYHYTDRDVIRNYERL 450

Query: 461  CKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSD 520
            C LDP N+G+YFD+L++IAN +GSY LI YC KQDIVGQEAL+QALK+F+LDP  +D++ 
Sbjct: 451  CHLDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEVDITK 510

Query: 521  TNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFN 580
             ND++ +T+YKNE+K+  +D   + NL+NA+R+ AK K+SS+LKFY+D+EPY  + +A+ 
Sbjct: 511  INDSVLLTLYKNELKISTSD---IPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQAYE 567

Query: 581  ILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQD 640
             L++DESVDDDI+QTAY IKV D+PGL +DCDRALYT+A+ KRS++L  FL + CP FQ+
Sbjct: 568  TLDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDFQE 627

Query: 641  FYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFER 700
            +Y PD++TY +AL   QVNENAAD+ I++ FQ RW ++SV + +  +     L +I  +R
Sbjct: 628  YYCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGLQR 687

Query: 701  NSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKT 760
            NS LIS++L+TG ++P CLP  +WPAG+NNIGNTCYLNSLLQYYF I+PLRNYV  Y KT
Sbjct: 688  NSSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYSKT 747

Query: 761  LEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAY 820
            +E  +    +    RRIGGRE++  EVERS+QF+YQLRDLF+ M++S+ RCVTP +ELAY
Sbjct: 748  IEDFKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRRELAY 807

Query: 821  LAFAPSNVEVEF-----------DQPNELQSGNGEDVD--------GDIVFIDEDISEPK 861
            LAFAPSN+EVEF           D P    +  G+D D        GDI   D +I+ PK
Sbjct: 808  LAFAPSNIEVEFETNENQPATQQDNPEVTTAELGQDKDEKERSVDSGDISMSD-NIT-PK 865

Query: 862  GKSLVLDEENSKVENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISF 921
                  +EE  +V  S +NQ +    +  SS  K +           +  TST+VAKIS 
Sbjct: 866  DA----EEEEDQVAESNKNQDVS---AIVSSPTKDIIMTDNTDTVVSNEGTSTKVAKISS 918

Query: 922  DQLENALELGRQQDVTECIGNVLFQLESASNPISLEEDD-EQYDLIKKLFYGKTKQSIIP 980
            DQLENALE+GRQQDVTECIGNVLFQLES S P+ L E+D EQ DL+K+LFYG+ +Q+I+P
Sbjct: 919  DQLENALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLFYGELEQTIVP 978

Query: 981  LKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPT 1040
            L N ++ R K+ERF+SLLVN+ DHP+D+YDALDLYF DEYL M+EYG+VK+++AVT+FPT
Sbjct: 979  LANPDQRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKMEEYGDVKRTVAVTKFPT 1038

Query: 1041 ILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSE 1100
            ILQIQIQRVYYDRE+FMPFKSIEPLPF E IYMDRY+ T + +L+ +K+ET  +K++L E
Sbjct: 1039 ILQIQIQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNETLLMKEKLVE 1098

Query: 1101 MRKRQKELLSRNELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDD 1160
            ++K+Q++LLSRN +GLS+K++++E  K LSSD+LE QGI    K  ++  L      IDD
Sbjct: 1099 LKKKQRDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVSSLKTLTAGIDD 1158

Query: 1161 ELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRK 1220
            EL +LY +I  +E  I+ QF++F+ IGYS+FAVFIHRGEASYGHYW+YIKD ++NGIWRK
Sbjct: 1159 ELNQLYAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRK 1218

Query: 1221 YNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            YNDET++EVPE EV+NFTEGNTATPYFLVYVK+    EIEPLKRI+
Sbjct: 1219 YNDETVSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLKRII 1264

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1304 bits (3375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1245 (52%), Positives = 885/1245 (71%), Gaps = 27/1245 (2%)

Query: 33   NSSSMDLDSCGDATSVS----WKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLS 88
            N+   D+D      SVS      DDGK LLY D ++ +P KTS+RL+D+I+C +   L  
Sbjct: 29   NTRDTDVDMESSLKSVSPTDQLPDDGKHLLYTDLKNGSPMKTSDRLIDDILCDLS--LNG 86

Query: 89   EKDESFNEFSNGXXXXXXXXXXXXRHNVQPFSV-GTIVDQIILQTKFEYKSTTCPEFNNI 147
            +     +E S G            R  +Q  S+ G+++DQ++ QTKFEY S +CP+ N +
Sbjct: 87   QSQCLLSEQSQGILKLLPIIYSKQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKL 146

Query: 148  YVRLGVLIDTNHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPF 207
             V LGVL++ +    ST DDV    ++HLK+TVK RS LE  K+H GV ++  +DSLH +
Sbjct: 147  QVFLGVLLNVSSSFEST-DDVVRSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSY 205

Query: 208  DQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKA 267
            D++DL  FDP+D +L+D+AIYVS DTNKLVL+EIF PEF++ EE  S T+  I++R++  
Sbjct: 206  DKEDLGTFDPEDTRLIDYAIYVSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDT 265

Query: 268  SKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVT 327
              + D+L+ ++IP Q DC+NT++K FK P+ +     P++T+ + N +LNS MN  WL  
Sbjct: 266  CSRLDSLNPEDIPNQFDCLNTLYKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTE 325

Query: 328  KYGFXXXXXXXXXXXXXXXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLM 387
            +YGF                  PPN   +  D  VRK +E   RKCL+LI+  K+ I ++
Sbjct: 326  RYGFTLLPGENEDDEDEYE---PPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVV 382

Query: 388  TPEQKE---SASKSLRTFNLLQTSFSTLFWSQILDENKN--IATMKENPQMNLDYHLIDL 442
               Q+    ++SKS ++ + +    ++    Q+  E+KN  + +  +N   + +YH I L
Sbjct: 383  DNTQRSKLAASSKSFKSLSGIAVQNTSKPLYQLFGESKNAFLNSNDQNYMWDTNYHFIAL 442

Query: 443  SASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEAL 502
            SASYHY DRDII NYE    +D  NIGIYFD++ FIAN +GSY L+ YC KQ+IVG EAL
Sbjct: 443  SASYHYNDRDIIMNYETYSVIDKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEAL 502

Query: 503  EQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSR 562
            E A++ F LDP  ID++  + ++ +++YK+E ++   + + L++L+NALR+LAK K++  
Sbjct: 503  EAAMRAFKLDPAAIDINKLDISLLLSMYKHE-QISNQNTSHLSDLKNALRVLAKFKDNRF 561

Query: 563  LKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSK 622
            +KFYVD+EPY ++ +A+N LEVDESVDDDIIQTAYSIKVND+PGLKI+C RALYT+A++K
Sbjct: 562  VKFYVDHEPYKTVSQAYNELEVDESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINK 621

Query: 623  RSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVID 682
            RSM L N+L +ECP FQDFYGP++Y+Y +AL  +QVNENA+D+ IL+IFQ++W  + +++
Sbjct: 622  RSMALFNYLIEECPEFQDFYGPEKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVE 681

Query: 683  ADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQ 742
             D+ LSLK+ L K+  E+NSKLIS +L TG+++P CLP +NWP GLNNIGNTCYLNSLLQ
Sbjct: 682  YDQFLSLKAALLKLCIEKNSKLISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQ 741

Query: 743  YYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFN 802
            YYF I+PLRNY+  YQ T E+ E    D    RRIGGR++   EVERS+QF YQLRDLFN
Sbjct: 742  YYFAIAPLRNYICSYQSTTESFEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFN 801

Query: 803  EMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKG 862
             MI S+SRCV+PT+ELAYLAF+PSN+EVEFD  + + S +G    G      +D   P  
Sbjct: 802  GMIFSNSRCVSPTQELAYLAFSPSNIEVEFDAGSGIASESG----GTFSLNGKDTDAPL- 856

Query: 863  KSLVLDEENSKVENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFD 922
              + L+E+ +  E + E QL   DD+   +  +    + Q     +  ++ST+VAKI  D
Sbjct: 857  TDMPLNEDVTMTE-AGEPQL---DDTGLLAPVEADVPVDQMKLAKEVINSSTKVAKIGSD 912

Query: 923  QLENALELGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLK 982
            QLENALELGRQQDVTECIGNVL+QLESAS+PI L+ED+EQYDLIK LFYGKT+Q I+PL 
Sbjct: 913  QLENALELGRQQDVTECIGNVLYQLESASDPIKLDEDNEQYDLIKHLFYGKTRQDIVPLS 972

Query: 983  NNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTIL 1042
            N+ ++R+K ERF+SLLVNVSDHPKD+YDALD YF +EYLT++EYG+V++++A+TEFPTIL
Sbjct: 973  NSTDVRSKYERFLSLLVNVSDHPKDIYDALDSYFMEEYLTLEEYGDVRRTVAITEFPTIL 1032

Query: 1043 QIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMR 1102
            QIQIQRVYYDRERFMPFKSIEP+PF+ T+YMDRY  T D  +L K+ ET ELK +L E +
Sbjct: 1033 QIQIQRVYYDRERFMPFKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETSELKTRLRECK 1092

Query: 1103 KRQKELLSRNELGLSRKEAFMETRKFLSSDALEK-QGIETENKQMLIDRLTGALKDIDDE 1161
             RQ+ELLSRN++GLSRKEA+ ET K L SD LE+   +  E++  ++  L+  +  ID+E
Sbjct: 1093 VRQQELLSRNDMGLSRKEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEE 1152

Query: 1162 LTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKY 1221
            L +LY +I  +E +ID QFD FQ +GYSLFAVFIHRGEASYGHYWVY+KDF  +GIWRKY
Sbjct: 1153 LVQLYTEIGQLETQIDHQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKY 1212

Query: 1222 NDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            NDET++EVPE EVFNFTEGN ATPYFLV VKQ +  +IEPL RI+
Sbjct: 1213 NDETVSEVPEEEVFNFTEGNNATPYFLVLVKQTHEQDIEPLHRII 1257

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1301 bits (3368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1279 (52%), Positives = 878/1279 (68%), Gaps = 54/1279 (4%)

Query: 20   NSNAVDL---ENDSEVNSSSMDLDSCG---DATSVSWKD--DGKQLLYPDARDLT-PFKT 70
            NS+  DL    ND E N S+ +    G   D   V+ +D   G  LLYPD      P KT
Sbjct: 36   NSDKPDLPSKTNDDETNKSNPNSTGQGPTCDTPRVTTQDIDPGNTLLYPDLGTANFPMKT 95

Query: 71   SERLLDEIMCSVPYILLSEKDESFNEFSNGXXXXXXXXXXXXRHNVQPFSVGTIVDQIIL 130
            S R++D+I+C + +I     +     F NG            R N Q +  G++VDQ+ L
Sbjct: 96   SNRIIDDILCDLSFI-----NGPNLSFKNGILQESMIMYSKERINNQAYLFGSMVDQVAL 150

Query: 131  QTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADLKIYHLKITVKVRSFLERTK 190
            QTK+EY S TCP  N + V+ G+L++      +  + ++ + IYHLKITVK R  LE +K
Sbjct: 151  QTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISKVPIYHLKITVKTRQLLEVSK 210

Query: 191  RHVGVPRYHLLD--SLHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDS 248
            +  G+ +YHLLD   LH FD++DL+ FDP +P L+D+AIYVS DTN+L+L+EIF  EFDS
Sbjct: 211  KQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDTNRLILIEIFSTEFDS 270

Query: 249  EEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRKSNDEPVKT 308
             EER S     IK R+ +A KK+DTLD + +PT IDC+NT+ K+ K PLTRK+N++ ++T
Sbjct: 271  REERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNTVLKLLKQPLTRKNNNDKIRT 330

Query: 309  LSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXXDYLPPNLVDFETDQDVRKSREA 368
            +SS+N +L+S  NP+WL+ KY F               +Y PP+L+ +     VR  RE 
Sbjct: 331  VSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEYEPPDLISYVQGYKVRSLREK 390

Query: 369  VTRKCLELIWLGKISISLMTPEQKES--ASKSLRTFNLLQTSFSTLFWSQILDENKN--- 423
              R+CL+LI+ GK  + L   +   +   SKS R FNLL T+ ST    Q+L+++K+   
Sbjct: 391  YIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFNLLNTTTSTNPLYQLLNDSKSNFL 450

Query: 424  IATMKENPQMNLD--YHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIANN 481
             +T  ++  M LD  +H I+LS S +YTDRDII+NYE    LDP NIG YFD+L +IAN 
Sbjct: 451  ASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLIALDPPNIGTYFDALSYIANR 510

Query: 482  RGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGNDP 541
            +GSY LI YC KQD+VGQE +  ALK F++DP+ ++L   +D++ ++IYKNE    G D 
Sbjct: 511  KGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLESIDDSLLLSIYKNESVKEGAD- 569

Query: 542  TRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIKV 601
                NL+NA+R+ AK +NS +LKFYVD+EPY ++ +A+  LE+D SVDDDIIQTAYSIK 
Sbjct: 570  --FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSVDDDIIQTAYSIKT 627

Query: 602  NDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNEN 661
             D PGLKIDCDRALYT+A+ +RSMIL NFL + C  FQ +Y   +Y Y +AL  LQVNEN
Sbjct: 628  VDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYDYRQALGILQVNEN 687

Query: 662  AADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPA 721
            A D+ IL+ FQ +W ++ + +AD+ L+ K  L K+  ERNSKLI+++L  GV++P CLP 
Sbjct: 688  ANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSKLINNFLMNGVIDPSCLPV 747

Query: 722  DNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGRE 781
            +NWP G+NNIGNTCYLNSLLQYYF ISPLR YV  Y KT E   +   +    RRIGGRE
Sbjct: 748  ENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGRE 807

Query: 782  INKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEF-----DQPN 836
            +   EVERS+QF+YQLRDLF  MI+++ RCVTP +ELAYLAFAPSNVEVEF     D   
Sbjct: 808  VGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPSNVEVEFENGVTDAKE 867

Query: 837  ELQSGNGEDVDGDIVFI---DEDISEPKGKSLVLDEENSKVENSPENQLIEIDD-----S 888
            ++   N +     ++ I   DED+ E +           + E SP   +   DD     +
Sbjct: 868  DVSHYNDDKTSDTLIKIGEGDEDLGEAE-----------RTEASPTEDIYMTDDDMLGAA 916

Query: 889  SDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLE 948
              + G  K +E ++N   G     ST+VAKIS DQLENALE+GRQQDVTECIGNVL+QLE
Sbjct: 917  KATDGINKEDESTEN---GIDILPSTKVAKISSDQLENALEMGRQQDVTECIGNVLYQLE 973

Query: 949  SASNPISLE-EDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKD 1007
            S S P+ +  ED+EQ DL+K+LFYG+ KQ IIPL    E R K+ERF+SLLVNV DHP+D
Sbjct: 974  SGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRD 1033

Query: 1008 VYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPF 1067
            +YDALD+YF DE+LTMDEYGEVK+++A+T+FPTILQ+QIQRVYYDRERFMPFKSIEPLPF
Sbjct: 1034 IYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSIEPLPF 1093

Query: 1068 SETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRK 1127
            S  IYMDRY +T D ++L+ ++ T ++K +L +++KRQ+ELLSRNE+GLSRKEA+ ET  
Sbjct: 1094 SAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKEAYSETVN 1153

Query: 1128 FLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIG 1187
            FL S+AL+ QGI  E +  L   L  A  DIDDEL+ +YN I  +E  I  QF++F+ +G
Sbjct: 1154 FLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISHQFEQFKKVG 1213

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYF 1247
            YSLFAVFIHRGEASYGHYWVYIKD+ +NGIWRKYNDET++EVP+ EVFNFTEGNTATPYF
Sbjct: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273

Query: 1248 LVYVKQENLNEIEPLKRIV 1266
            LVYVK+ +  +IEPLKRI+
Sbjct: 1274 LVYVKEGSEKDIEPLKRII 1292

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1280 bits (3312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/1223 (53%), Positives = 857/1223 (70%), Gaps = 36/1223 (2%)

Query: 51   KDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGXXXXXXXXXX 110
            KD GK LLY DA +L PFKTSERLLD+I   + Y    E D  ++E   G          
Sbjct: 35   KDTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDILYSELHKGVLRLPIL--- 91

Query: 111  XXRHNVQP----FSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFD 166
               ++ +P    +++G +VDQ++L+T++EY S TCP  N I V +GVL++++  P   +D
Sbjct: 92   --EYSRKPTDDVYNIGHLVDQVVLKTRYEYDSKTCPGLNKITVFMGVLLNSSQMP-KIYD 148

Query: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226
            DV    +YHLK+TVK R  LERT++  GVP+YHLL  LHPFD++DLL  D +DP L+D  
Sbjct: 149  DVTQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPELHPFDKEDLLLTDAEDPHLIDSV 208

Query: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286
            +YVS DTNKL+ +EIF+PEF S+ +       AIK+R+  A  KY  LD D IP+Q +C 
Sbjct: 209  MYVSSDTNKLICIEIFKPEF-SQADLTEFCPDAIKKRYSSACDKYPDLDPDMIPSQAECF 267

Query: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXX 346
            +T+ KIFKGPL R+  ++ +KT+S+DN  LNSQ++PKWL  K+ F               
Sbjct: 268  STLLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKWLTEKFAFKLCQANDTDEAGSAM 327

Query: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406
            ++ PP+L ++  D  VR+ RE+ TRKCLELI+LGK+S SLMT E     S++ R+F L Q
Sbjct: 328  EFQPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIAKDSRA-RSFQLYQ 386

Query: 407  TSFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPA 466
            TS S  F+  +L+E + +       +++ +Y+ ++LS+ Y+YTD+DII+NYE Q  LD  
Sbjct: 387  TSNSLSFFFHLLNETRGVMDYGSQ-EIDRNYNFMNLSSCYYYTDKDIIKNYETQALLDRE 445

Query: 467  NIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIF 526
            NIGIYFD+L +IAN +GSY LI YC KQD+VG+EAL+ AL  F +DP    L    D + 
Sbjct: 446  NIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGIDPSDTSLMTIPDELL 505

Query: 527  MTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDE 586
            + +Y+ E    G+     T L+NALR+LAK KNSS L+FY  YEPY ++ +A+++LEVDE
Sbjct: 506  LGVYRKECS-QGSTQKHAT-LKNALRLLAKAKNSSTLQFYAAYEPYDNVHQAYSLLEVDE 563

Query: 587  SVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQ 646
            SVD D+IQTAY+IKV D+PGLKIDCDRA+YT+AV+KRSM L NFL ++CP F++FY  D+
Sbjct: 564  SVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNFLVEQCPVFEEFYSADK 623

Query: 647  YTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLIS 706
             TY +AL  LQVNENA+DD ILE+FQR+W  ++V+  D+ L   S LTKI   RNS LI+
Sbjct: 624  LTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSSSALTKIGQVRNSLLIN 683

Query: 707  SYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVEN 766
             YLETG ++  CLPA NWP GLNNIGNTCYLNSLLQYYFCISPLR ++ DYQKTL    +
Sbjct: 684  RYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFIVDYQKTLAEFHD 743

Query: 767  CLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPS 826
             + +   KRRIGGRE+++ EVERSVQFVYQLRDLF +MIH+ SR VTP KELAYLAFAPS
Sbjct: 744  SIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESRFVTPRKELAYLAFAPS 803

Query: 827  NVEVEFDQPNELQSGNGEDVDGDIVFID---EDISEPKGKSLVLDEENSKVENSPENQLI 883
            N+EVEF+    ++    E+ + D+  ID   E  +      L   E  ++V  +  N+  
Sbjct: 804  NIEVEFEGTPTVEPAK-ENSENDVEVIDLTAEGEASEDVDMLKPAESETQVVTTQLNEDT 862

Query: 884  EIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNV 943
             ++D            I+  P       +STRVAKIS DQLENALE+GRQQDVTECIGNV
Sbjct: 863  VMNDV-----------IATEPMV-----SSTRVAKISTDQLENALEMGRQQDVTECIGNV 906

Query: 944  LFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSD 1003
            LFQLESAS+PI+L+ D EQ DLIK+LF+GK KQ + PLK+ ++IR KIERFVSLLVNV D
Sbjct: 907  LFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLKDPSKIRTKIERFVSLLVNVGD 966

Query: 1004 HPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIE 1063
            HPK+VYDALD YF D+ L +++ G+VK++LA+ E P +LQIQIQRVYYDRE+FMPFKSIE
Sbjct: 967  HPKNVYDALDQYFKDDVLQLED-GDVKRTLAIKELPVVLQIQIQRVYYDREKFMPFKSIE 1025

Query: 1064 PLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFM 1123
            PLPF +TIYMDRY +T DA++ +K+ E  + K +L  ++ RQK LL +N  G+S K + +
Sbjct: 1026 PLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLKLRQKALLEKNGNGMSFKTSLL 1085

Query: 1124 ETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKF 1183
            ET +FL S  LE+  IE + K   +  +   L  ID+EL+++Y+ I  ++ K+   FD F
Sbjct: 1086 ETERFLESGVLEQNAIEIQKKDSALKAIESMLLKIDNELSEIYSRITALDQKLSSHFDNF 1145

Query: 1184 QNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA 1243
            + +GYSLFAVFIHRGEASYGHYW+YIKD  +NGIWRKYNDET+TE PE EVFNFTEGNTA
Sbjct: 1146 KELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFNFTEGNTA 1205

Query: 1244 TPYFLVYVKQENLNEIEPLKRIV 1266
            TPYFLVYVK  + +EI+PL R++
Sbjct: 1206 TPYFLVYVKNGHESEIQPLHRVI 1228

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1265 bits (3273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1234 (52%), Positives = 869/1234 (70%), Gaps = 42/1234 (3%)

Query: 41   SCGDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNG 100
            +  D  S+   DDGKQLLYP      PFKT +RL+D+I+  + +I  S+    F     G
Sbjct: 25   TTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSSEFK----G 80

Query: 101  XXXXXXXXXXXXRHNVQP-FSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNH 159
                        R  ++P + +GT +DQI LQTK+EY+S +CP+ N I V  GVLID+N 
Sbjct: 81   ILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNM 140

Query: 160  QPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKD 219
            +  ++FD VA+  IYHLK+TVK R+ LE  K+HVG+  YHL+  LHPFD+QDLL FD  D
Sbjct: 141  ENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESD 200

Query: 220  PKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEI 279
              L+D A YVS DTNKL+L+EIF+PEF SEEE  S     I  R+    ++YD+L+ D I
Sbjct: 201  ENLIDFAAYVSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVCEQYDSLNSDTI 260

Query: 280  PTQIDCINTMFKIFKGPLTRKSND-EPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXX 338
            P+Q+DC  T+F++FKGPL RKS D +P+KT+++ N  LNS M+ KWLV+KYGF       
Sbjct: 261  PSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQN 320

Query: 339  XXXXXXXXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKS 398
                    +Y PP+L+D + D  +RK R++ TRKCL+L + GK+S  L++    +   KS
Sbjct: 321  PEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKS 380

Query: 399  LRTFNLLQTSFSTLFWSQILDENKNIATMKENPQMNLD--YHLIDLSASYHYTDRDIIQN 456
             R FN + T  ST    QI +++       +     LD  YH I+LS+SY+YTDRDIIQN
Sbjct: 381  YRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQN 440

Query: 457  YELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTI 516
            YE  C +D  N GIYFD+L +IAN +GSY LI YC KQD+VGQE L+ +L+   LD  ++
Sbjct: 441  YETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSV 500

Query: 517  DLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQ 576
            D+   ND++  +IYK E      D  RLT L++A+R++ K   S +L+F++D+EPY ++ 
Sbjct: 501  DIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVM 560

Query: 577  RAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECP 636
             A+N+L++DESVDDDI+QTAY+I++ND+PGLK+DCD+ALYT+A+  RS+ L NFL ++CP
Sbjct: 561  DAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCP 620

Query: 637  PFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKI 696
             F  +YGPD  ++ +AL  LQVNENA D+ +++IFQ+RW    + + D++L LK+ LTKI
Sbjct: 621  DFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQLLILKAALTKI 680

Query: 697  AFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVAD 756
            A E+NSKLIS +LETGV++   L  +NWP GLNNIGNTCYLNSLLQYYF I+PLR Y+ +
Sbjct: 681  ASEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILN 740

Query: 757  YQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTK 816
            Y+ ++   E  +++  +KRRIGGRE+++ EVERS+QF+YQLRDLFN+MI+S SRC+TP  
Sbjct: 741  YKGSISNYE--IDETSNKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKH 798

Query: 817  ELAYLAFAPSNVEVEFDQPNELQSGNGE---DVDGDIVFIDEDISEPKGKSLVLDEENSK 873
            ELAYLAFAPSN+EVEF   +E++    +   D +GDI  +D            L  +N  
Sbjct: 799  ELAYLAFAPSNIEVEF-AASEVERTTVDLPFDKEGDIDLVD------------LSNDNLN 845

Query: 874  VENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQ 933
              N+ +    E+      +   KV            T+TST+ AKIS DQLENALE+GRQ
Sbjct: 846  TTNNAQ----EVTSDISVATEDKV-----------MTNTSTKTAKISSDQLENALEMGRQ 890

Query: 934  QDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIER 993
            QDVTECIGNVL+Q+ESAS PI L+ED EQYDLIK+LFYGKTKQ I+PL + ++ R K E 
Sbjct: 891  QDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEG 950

Query: 994  FVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDR 1053
            F SLLVN+SDHP+D+YDAL+  F+ E+L MDEYG+V++++++T FP ILQIQIQRVYYDR
Sbjct: 951  FSSLLVNISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDR 1010

Query: 1054 ERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNE 1113
            ERFMPFKSIEPLPFS TIYMDRY    +  L  KK+ET EL+ +L  ++ RQ ELL+RNE
Sbjct: 1011 ERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNE 1070

Query: 1114 LGLSRKEAFMETRKFLSSDA-LEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNI 1172
            LGLSRKE+++ET  FLS +A +  QG+   N+  +I++L  A+ +ID EL+++Y++I  I
Sbjct: 1071 LGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLI 1130

Query: 1173 EAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEA 1232
            E KID QFD+F++IGYSLFAVFIHRGEASYGHYWVYIKD  ++GIWRKYNDET+TEV E 
Sbjct: 1131 ENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDETVTEVNEE 1190

Query: 1233 EVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            EVFNFTEGNTATPYFLV+VK     +IEPLKRI+
Sbjct: 1191 EVFNFTEGNTATPYFLVFVKDYYKGDIEPLKRII 1224

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1264 bits (3271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/1243 (51%), Positives = 856/1243 (68%), Gaps = 30/1243 (2%)

Query: 32   VNSSSMDLDSCGDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKD 91
             +S S  +D  G     S +D+GK LLYPDA  L PFKTSERLLDEI   + Y   +  D
Sbjct: 16   ADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHD 75

Query: 92   ESFNEFSNGXXXXXXXXXXXXRHNV-QPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVR 150
              ++   +G            R  V  PFS+G ++DQ++L+T++EY+S TCP  N + V 
Sbjct: 76   ILYSALHSGVLKLPVLEYS--RKPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVF 133

Query: 151  LGVLIDTNHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQ 210
            +GVL+  +  P    +D+A   IYHLK+TVK R  LE T++  GV +YH+L  LHP D+Q
Sbjct: 134  MGVLVSPSIVPREP-EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQ 192

Query: 211  DLLNFDPKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKK 270
            DL   +  DP L+D A+YVS DTNKLV +EIF+PEF S E+  + +  +I+ R  +A  K
Sbjct: 193  DLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGK 251

Query: 271  YDTLDKDEIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYG 330
            +  LD +++P+Q +C +T+ KIFKGPL R+S D+ +KT+S+DN  LNSQ+ P WL  ++ 
Sbjct: 252  FPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQ 311

Query: 331  FXXXXXXXXXXXXXXXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPE 390
            F               +Y PP+L D+  +  VRK RE  TRKCLEL++LGK++++LM+ +
Sbjct: 312  FQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKD 371

Query: 391  QKESASKSLRTFNLLQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTD 450
                 S++ R+F+L Q S+S  F+  +L E + +       +++ +YH I+LSA ++Y+D
Sbjct: 372  DVAQDSRA-RSFHLYQISYSPSFFFHLLGETRGVMDYGTQ-EIDKNYHFINLSACHYYSD 429

Query: 451  RDIIQNYELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFS 510
            +DII+NYE Q +LDP NIGIYFD+L+FIAN +GSY LI YC KQD+VG+EAL+ AL  F 
Sbjct: 430  KDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFG 489

Query: 511  LDPDTIDLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYE 570
            +D    DLS   D + + IY+ E         + ++L+N+LR++AK K S  L+FY  YE
Sbjct: 490  IDASDTDLSTVPDDLLLGIYRKESSQASQQ--KRSSLKNSLRLIAKAKKSQILQFYTAYE 547

Query: 571  PYSSIQRAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINF 630
            PY +  +A+++LEV+ESVD DIIQTAY++KV D+PGLKIDCDRA+YT+AVS+RSM L NF
Sbjct: 548  PYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNF 607

Query: 631  LFQECPPFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLK 690
            L ++CP F +FY  D+ TY EAL  LQVNENA+DD ILE+FQR+W  + V   D+ L   
Sbjct: 608  LAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISS 667

Query: 691  SVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPL 750
            S LTKI   RNS LI+ YLETG+++  CLPA NWP GLNNIGNTCYLNSLLQYYFCISPL
Sbjct: 668  SALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPL 727

Query: 751  RNYVADYQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSR 810
            R  + +YQKTL      +     KRRIGGRE+++ EVERS+QFVYQLRDLF +M+H+ +R
Sbjct: 728  RQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENR 787

Query: 811  CVTPTKELAYLAFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEP-KGKSLVLDE 869
             VTPTKELAYLAFAPSN+EVEF+         G    G +   +++     K  + V+D 
Sbjct: 788  YVTPTKELAYLAFAPSNIEVEFE---------GTPSSGSVGEAEDEEEGAIKETTEVIDL 838

Query: 870  ENSKVENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTD------TSTRVAKISFDQ 923
              + V N+ ++  IE+ D   S     VE+   +P   K  D      TSTRVAKIS DQ
Sbjct: 839  --TSVPNAEQD--IEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQ 894

Query: 924  LENALELGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKN 983
            LENALE+GRQQDVTECIGNVLFQLESAS P  L+ D EQ DLIK+LF+GK +Q + PL +
Sbjct: 895  LENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLND 954

Query: 984  NNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQ 1043
              ++R KIERFVSLLVNV DHPKDVYDALD YF ++ L +++ G+V +S+A+ E P +LQ
Sbjct: 955  PTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQ 1013

Query: 1044 IQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRK 1103
            IQIQRVYYDRERFMPFKSIEPLPF ++IYMDRY +T D  +LKK++E   LKK+L  +++
Sbjct: 1014 IQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKE 1073

Query: 1104 RQKELLSRNELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELT 1163
            +Q+ LL +N  G+S K + +ET++FL SD LE   IE+ NK+  I  +   L  ID+EL 
Sbjct: 1074 KQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELA 1133

Query: 1164 KLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYND 1223
             +Y+ I  +E K+   FD F+  GYSLFAVFIHRGEASYGHYW+YIKD  KNGIWRKYND
Sbjct: 1134 SVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYND 1193

Query: 1224 ETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266
            E++TE PE+EVFNF+EGNTATPYFLVYVK    ++IEPL R+ 
Sbjct: 1194 ESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVT 1236

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1212 bits (3135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1265 (50%), Positives = 871/1265 (68%), Gaps = 71/1265 (5%)

Query: 42   CGDATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGX 101
              D T++  +DDG+QLLYP+     P KTS+RLLD+I+CSV ++   +     N  SN  
Sbjct: 31   SADVTNI--EDDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSGDNKSILN--SN-- 84

Query: 102  XXXXXXXXXXXRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQP 161
                       R +++  +VG   DQ+I+QTK+EY S +CPE N I+V +G+LI T++  
Sbjct: 85   ----TLEYSKQRPHIKGSAVGFFQDQVIIQTKYEYPSKSCPEHNKIFVIMGILIGTDYLE 140

Query: 162  LS---TFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPK 218
             +      +V ++ IYH+KI+VKVRS LE +K+ VGV RY+ LD LH +D+ D  ++DP 
Sbjct: 141  KAEKKQISEVTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQLHDYDRVDFPSYDPT 200

Query: 219  DPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDE 278
            D KL+D A+Y +DDTNK+VL+EI++PEFD E++  S++   IK R  +A +K+  L K+E
Sbjct: 201  DSKLLDSALYATDDTNKIVLIEIYKPEFDPEDKDLSVSSVQIKNRFAQAKEKFPQLAKEE 260

Query: 279  IPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXX 338
             PTQ+D INT+FK+FKGPL RKS+D P K++ +++ +L S MNP  LVT +GF       
Sbjct: 261  SPTQLDSINTLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTYTNENI 320

Query: 339  XXXXXXXXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESA--S 396
                    +Y+ P+LV++  D +++K R+  TRKCLELI  G I IS +      +A  S
Sbjct: 321  PGG-----EYMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFS 375

Query: 397  KSLRTFNLLQTSFSTLFWSQILDE--NKNIATMKENPQ----------------MNLDYH 438
            K  R    +Q  FS   W Q+L +  ++NI  +  N                   ++D +
Sbjct: 376  KKYRILRTIQPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSN 435

Query: 439  LIDLSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVG 498
              +LS   HY +RDIIQNYE    LD  NIGIYFDSL  +AN +GSY L+ YC KQD++G
Sbjct: 436  FTNLSVCLHYAERDIIQNYERLITLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIG 495

Query: 499  QEALEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHK 558
            QEAL+ +L  F +D   + L   ++ + +++YK+E K    D  R+++L+NALR+LAK+ 
Sbjct: 496  QEALQNSLAVFGIDYTKVTLESLDENLLLSVYKHEWK-ENPDNNRISDLKNALRLLAKYF 554

Query: 559  NSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTV 618
             S  LKFYVDYEPY  IQ+A+++LE+DESVD+DIIQTAY+IK+ND PGLKIDCDRALYT+
Sbjct: 555  TSDYLKFYVDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTI 614

Query: 619  AVSKRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSD 678
            A S+RS++L NFLF +CP FQ +YG     Y ++ + LQ+NEN  +  +L +FQ++W + 
Sbjct: 615  AYSRRSLMLFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNT 674

Query: 679  SVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLN 738
             + + D++L  ++ LTKIA ERNS L+ ++LETG +NP  LPA+NWP G+NNIGNTCYLN
Sbjct: 675  LLEEPDQLLKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLN 734

Query: 739  SLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLR 798
            SLLQ+YF ISPLR Y+  YQKT+  + +  +    KRRIGGR++ K E+ERSVQF+YQLR
Sbjct: 735  SLLQFYFAISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQVGKNEIERSVQFLYQLR 794

Query: 799  DLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQP------NELQSGN---------- 842
            DL+N+MI SS RCVTP +ELAYLAFAPS+++VEF+        + ++  N          
Sbjct: 795  DLYNDMIFSSQRCVTPKRELAYLAFAPSSIDVEFENAKTKSPISNIEGSNSTTDSQPMPS 854

Query: 843  -GEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQLIEIDDSSDSSGHKKVEEIS 901
             GE++D ++    E+ +  +  S    E N  V N+ + ++++ D   ++ G+ ++E   
Sbjct: 855  TGENIDHNMDIEQEERNNEEINSTNNIESNDLVSNNHDIEMLDTD--KENEGNMEIE--- 909

Query: 902  QNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESASNPISLEEDDE 961
                     DT+ +VAKI  +QLENALELGRQQDVTECIGNVLFQLES+S+P SL ED E
Sbjct: 910  ---------DTAIKVAKIDPEQLENALELGRQQDVTECIGNVLFQLESSSSPTSLSEDHE 960

Query: 962  QYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYL 1021
            Q DLIK+LF+G+T Q I PLK ++  R K+ERFVSLLVN++DHPKDVYDALDLYF +EYL
Sbjct: 961  QNDLIKELFFGETNQHIKPLKADSVTRTKVERFVSLLVNIADHPKDVYDALDLYFKEEYL 1020

Query: 1022 TMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTD 1081
            TM+EYGEVK+ LA+ +FPTILQIQIQRVYYDRERFMP+KSIEPLPF   IY+DRY +T D
Sbjct: 1021 TMEEYGEVKRELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPLPFESDIYLDRYADTDD 1080

Query: 1082 ADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSSDALEKQGIET 1141
              LL+K++ET ELK+QL   ++RQKELLSRNELGLSR++A+ ET  FL S+ L+   I  
Sbjct: 1081 VKLLQKREETAELKRQLRSFKERQKELLSRNELGLSRRDAYKETANFLRSEVLQNTNISI 1140

Query: 1142 ENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEAS 1201
             +  +L  +L  +   + DEL+ LY  I N+E KI+ QFD F   GY+LFAVFIHRGEAS
Sbjct: 1141 SDPDLLATKLEESASKVADELSDLYVKITNLEEKINHQFDDFTEHGYTLFAVFIHRGEAS 1200

Query: 1202 YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEP 1261
            YGHYWVYIKDF  N IWRKYNDET+TEVPE EV NFTEGNTATPYF+V+VK+ +  +IEP
Sbjct: 1201 YGHYWVYIKDFV-NSIWRKYNDETVTEVPEEEVMNFTEGNTATPYFIVFVKKGHEKDIEP 1259

Query: 1262 LKRIV 1266
            LKR++
Sbjct: 1260 LKRMI 1264

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1160 bits (3001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1243 (49%), Positives = 837/1243 (67%), Gaps = 42/1243 (3%)

Query: 44   DATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGXXX 103
            +  S   ++ GK +LYP      PFKTS+RLLD+I  ++ ++L   +        NG   
Sbjct: 20   ECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVLEGVR-------GNGVLK 72

Query: 104  XXXXXXXXXRHNVQPFSVGTIVDQIILQTKFEYKS------TTCPEFNNIYVRLGVLIDT 157
                     R  ++ +S+G ++DQ++LQT +EY S          + + I V +G+L D 
Sbjct: 73   SPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINVFMGLLCDP 132

Query: 158  NHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDP 217
              + L + DD+ +   YHL++TVK R  LER KR  G+ +YHL++ LHP D+QDL  F+ 
Sbjct: 133  MVK-LCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFED 191

Query: 218  KDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKD 277
             D  ++D A YVS  TN+LV +EI +PEF + EE +  T  +I++R++   +KY  L+++
Sbjct: 192  DDECVIDSATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRE 250

Query: 278  EIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXX 337
             +P Q +C+NT+FK+FK PL+R+ +D+ +KT+S++N VLNSQ++P WLV K+GF      
Sbjct: 251  NVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEVQ 310

Query: 338  XXXXXXXXXDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASK 397
                     +Y PP+  ++  D +VR  RE   RK LEL+++GK SI L+ P++  +AS 
Sbjct: 311  EEDGRKEY-EYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL-PKEVVAASS 368

Query: 398  SLRTFNLLQTSFSTLFWSQILDE-NKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQN 456
             LR+F L QT FS  FW Q+L E ++N    ++    + + H I+LS +Y+Y DRDII+N
Sbjct: 369  KLRSFQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRN 428

Query: 457  YELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTI 516
            YE Q  LDP N GIY+D L FIAN +GS+ L+ +  KQ+IVGQEAL  AL+ F +DP   
Sbjct: 429  YESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSET 488

Query: 517  DLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQ 576
            D     D + ++ YK E K +GN   +  +LRNALR+LAK+K S +LKFYV+ EP+    
Sbjct: 489  DPKQIPDEMLLSCYKEECK-YGN-TRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQES 546

Query: 577  RAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECP 636
            +A++ILE+DESVD DII+TAY+IKV+D PGLK+DCDRALYT+A++KRSM L N+L Q CP
Sbjct: 547  QAYSILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCP 606

Query: 637  PFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKI 696
             FQ FY    ++Y+ ALQ LQVN NA DD ILEIF+R+W  + VI  D+ L+LK  L KI
Sbjct: 607  RFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKI 666

Query: 697  AFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVAD 756
            A ERNSKLI+ +LETG+++   L + NWP GLNNIGNTCYLNSLLQYYF ISPLR+Y+ +
Sbjct: 667  AHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQN 726

Query: 757  YQKTL-EAVENCLEDG-WDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTP 814
            Y+ T  + + N  + G   KRRIGGR +NK EVERSVQFVYQLRDLFN+M HS  RCVTP
Sbjct: 727  YEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTP 786

Query: 815  TKELAYLAFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKV 874
            ++ELAYL+F+PS   VEF+   ++   +        + ++++      +   +  E S V
Sbjct: 787  SRELAYLSFSPSTTNVEFESAAQVPFRDT------TILLEQEPPNEDTEVFDISIEGSNV 840

Query: 875  ENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTD------------TSTRVAKISFD 922
            E     + I  DD+ D+         S +    +  +            TST VAKIS D
Sbjct: 841  ETEAAAEDIIADDNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEPITSTCVAKISPD 900

Query: 923  QLENALELGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLK 982
            QLEN LE+GRQQDVTECIGNVL+Q+ESAS P++ +E  EQYDL+K+LFYGK KQ +IP++
Sbjct: 901  QLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIE 960

Query: 983  NNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTM-DEYGEVKKSLAVTEFPTI 1041
            N  + R K ERF+SLLVNV DHPKD+YDALDLYF D+ L + D+   V++S+AV E PTI
Sbjct: 961  NPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTI 1020

Query: 1042 LQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEM 1101
            LQIQIQRVYYDRE+ MPFKS EPLPF E +YMDRY  +T+++LL KK E+ +L + L  +
Sbjct: 1021 LQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAI 1080

Query: 1102 RKRQKELLSRNELGLSRKEAFMETRKFLSSDAL-EKQGIETENKQMLIDRLTGALKDIDD 1160
            ++R+K++LS+N+ GL+ K++  ET+ FL S  L E +G     K+ LI +L     +ID 
Sbjct: 1081 KQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDK 1140

Query: 1161 ELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRK 1220
            EL+ L + I ++E  I  +FD+F N GY+LFAVFIHRGEASYGHYWVYIKD   +GIWRK
Sbjct: 1141 ELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRK 1200

Query: 1221 YNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLK 1263
            YNDE++TEVPE+EVF+FTE NTATPYFLVY+K  + +EIEPLK
Sbjct: 1201 YNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1144 bits (2960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/1224 (48%), Positives = 811/1224 (66%), Gaps = 55/1224 (4%)

Query: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGXXXXXXXXXXX 111
            DDGK LLY D     PFKT +R+LD+I  S P+ L         +F +            
Sbjct: 39   DDGKTLLYGDISKSFPFKTCDRILDDIRIS-PWFL--------KKFGSSVMKQPMLQYSR 89

Query: 112  XRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADL 171
             R  +QP+++  ++DQ+ L+++++Y S TCP  N I V   +L+D N  P + FDD+   
Sbjct: 90   ERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNFTP-NDFDDIDKF 148

Query: 172  K--IYHLKITVKVRSFLERTKRHVGVPRYHLLD--SLHPFDQQDLLNFDPKDPKLVDHAI 227
                +HLKITVK RS+LE   RHVG+  YH+L+  SLHPFD++D+   + KD +LVD +I
Sbjct: 149  PEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCRLVDQSI 208

Query: 228  YVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCIN 287
            +VS DTNKL+L+EI +PEF+SE      T   I+ER+  A +++D L+ D+IP+Q +C+ 
Sbjct: 209  FVSADTNKLILVEIIKPEFNSENLAEYRT-AKIEERYKNACQEFDLLNPDDIPSQAECLK 267

Query: 288  TMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXXD 347
            T+F IFK PL RKS +   K +S D+V LNSQ+N  WL T + F               +
Sbjct: 268  TLFMIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDNVQSGEE 327

Query: 348  YLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQT 407
            Y PP+LVD+ TD  VR  REA TRK +E++ +GK S+ L+  E         + F+    
Sbjct: 328  YKPPDLVDYITDFKVRGIREAYTRKSMEVVLIGKQSM-LLENELGTEKKTVAKCFSNQHF 386

Query: 408  SFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPAN 467
            S S  +W  IL+         E    +++YH I+LS ++ Y D+DII+NYE Q  LD  N
Sbjct: 387  SASHTWWFNILNHQH-----IEPFPYDINYHFINLSVAFKYIDKDIIKNYETQIALDQEN 441

Query: 468  IGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFM 527
            I  YFD+L ++ N +GSY LI YC KQD+VG E L  AL+ F LDP  ID S   DA  M
Sbjct: 442  ISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDAS-LLDANTM 500

Query: 528  TIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDES 587
              Y N   L  +D  R  +LRNALR+L K+  S ++ F V+YEPY ++Q+A+ +L+VDE+
Sbjct: 501  IEYYNSHLLRSSDNQR-KDLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQAYTLLKVDET 559

Query: 588  VDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQY 647
            VDDDIIQTAY+I + D PGLK D DRA++T+A+ +RS+ L+N L  ECP F  +Y     
Sbjct: 560  VDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPEFAQYYNCTDI 619

Query: 648  TYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISS 707
            +Y EAL  ++++ NA+DD ILE+FQ++W+   +   D +L LK  L  I F RNSKLI+ 
Sbjct: 620  SYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIGFTRNSKLINH 679

Query: 708  YLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY----QKTLEA 763
            +L+TG+V+  CLP   WPAG+NN+GNTCYLNSLLQ++F I PLR+++ +Y     K L+A
Sbjct: 680  FLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLLDA 739

Query: 764  VENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAF 823
             E        +RRIGGRE++K E  RSVQFVY LRDLFN+MIH++SRCVTPTKEL YLAF
Sbjct: 740  SEY-----HSRRRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKELVYLAF 794

Query: 824  APSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQLI 883
            APSNVEVEF        G+      +++ +  D+ E          + ++   S ++ +I
Sbjct: 795  APSNVEVEF--------GDDTVAQKELIDLTTDVVEDPT-------DTTRHLASCDDDII 839

Query: 884  EIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNV 943
                      HK   E         +   S +VAKIS DQLEN LE+GRQQDVTECIGNV
Sbjct: 840  MCQSPVALPEHKTSSE-------AGTQQYSVQVAKISADQLENTLEIGRQQDVTECIGNV 892

Query: 944  LFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSD 1003
            L QLE AS P+SLE+D EQ DL+K+LFYG+ KQ +IP+ +   +R K ERF+SLLVN  D
Sbjct: 893  LAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNTGD 952

Query: 1004 HPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIE 1063
            HPKD+YDALD YF ++YL ++EYG+VK++++++E P +LQIQIQRVYYDRE+FMPFKSIE
Sbjct: 953  HPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKSIE 1012

Query: 1064 PLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFM 1123
            PLPF ET+YMDRY  T D  LL +  +  ELK++L ++++RQ++LLS+NE+GL+ K + +
Sbjct: 1013 PLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSSLI 1072

Query: 1124 ETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKF 1183
            ET+KFL S  L+   I+ +N    I  +   + +ID+EL  L+N I ++E  I +QF +F
Sbjct: 1073 ETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFSEF 1132

Query: 1184 QNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA 1243
            ++IGYSLFAVFIHRGEASYGHYWVYIKD TKNGIWRKYND+++TEVP++EVFNFTEGNTA
Sbjct: 1133 KHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTA 1192

Query: 1244 TPYFLVYVKQENLNE-IEPLKRIV 1266
            TPYFLVYV++    E IEPLKRI+
Sbjct: 1193 TPYFLVYVREGQEQETIEPLKRIL 1216

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/784 (48%), Positives = 521/784 (66%), Gaps = 20/784 (2%)

Query: 52  DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGXXXXXXXXXXX 111
           DDG+ +LY +     P KTS+RLLD++  +V          S +E               
Sbjct: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTV----------SLSEEGREVLRAPMLEYAR 70

Query: 112 XRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADL 171
            R N + +SVG ++DQ++LQT FEY S TC + N ++V +GVL D   Q  ++ D++ + 
Sbjct: 71  QRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG-QRFASQDELVNY 128

Query: 172 KIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHAIYVSD 231
           +IYHL++TVK+R  LER ++H GV +YHL+D LHP+D+ D   F+  DP +VD A YV+ 
Sbjct: 129 RIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVAS 188

Query: 232 DTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFK 291
            TN+LV +E+ RPEF   +E    T   I+ R+++  K++  LD  +IP+Q +C+NT+FK
Sbjct: 189 GTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFK 247

Query: 292 IFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXXDYLPP 351
           +FK PL+R+   + +KT+S+DN VLNSQ+   WLVTK+GF               +Y PP
Sbjct: 248 VFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEEDGQKIY--EYKPP 305

Query: 352 NLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQTSFST 411
           +  +   + +VR+ RE+  RK LELI+LGK S+ L+  +   S SK LR+F L QT FS 
Sbjct: 306 DFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTHFSH 364

Query: 412 LFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIY 471
            FW  ++ E  +    ++    + +YH + LS++Y+Y+DRDII+NYE Q  LDPAN  IY
Sbjct: 365 SFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIY 424

Query: 472 FDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYK 531
           +D L F+AN++GS  L+ Y  KQ++VG EAL  AL+ F LDP + D    +D   +  YK
Sbjct: 425 YDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLESYK 484

Query: 532 NEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDD 591
              K  G  P +  +LRNALR+LA++K S +LKFYV+ EP+ +  +A+ +LE+DESVD D
Sbjct: 485 EVCKDSG--PQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLEIDESVDID 542

Query: 592 IIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSE 651
           II+TAYSIKV+D PGLK+DC RALYT+AV+KRS+IL N LFQ+CP F  FY     +Y  
Sbjct: 543 IIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQS 602

Query: 652 ALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLET 711
           ALQ L VN NA DD ILEIFQR+W+ D ++  +++L+LK  LTKI FERNSKLI+ +LET
Sbjct: 603 ALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLET 662

Query: 712 GVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDG 771
           G+V+   LPA NWP G+NNIGNTCYLNSLLQYYF ISPLR Y+  Y  T   + N     
Sbjct: 663 GLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASNLLNNAVSS 722

Query: 772 WD--KRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVE 829
            D  +RRIGGR I++ EVERSVQFVYQLR LF+EM+HS  R VTPT+EL YL+F+PS+ E
Sbjct: 723 SDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTE 782

Query: 830 VEFD 833
           VEF+
Sbjct: 783 VEFE 786

 Score =  399 bits (1026), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/362 (56%), Positives = 270/362 (74%), Gaps = 2/362 (0%)

Query: 907  GKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLI 966
             +  +TST VAKIS DQLEN LE+GRQQDVTECIGNVL+Q+ESAS P+SL+E+ EQ+DL+
Sbjct: 1027 AEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLV 1086

Query: 967  KKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYF-SDEYLTMDE 1025
            K+LFYGK KQ +IPL+  +  R KIERF+SLLVN+ DHPKD+YDALD YF  D     ++
Sbjct: 1087 KQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDED 1146

Query: 1026 YGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLL 1085
             G+V++S+AV E P +LQIQIQRVYYDRE+FMPFKS EPLPF E +YMDRY  T +A+L 
Sbjct: 1147 DGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELN 1206

Query: 1086 KKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSSDALEKQGIETENKQ 1145
             KK +   L+++L  +R+R++ LL++N+ G++   A  +TR+FL +  L     + + + 
Sbjct: 1207 AKKQQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQY 1266

Query: 1146 MLIDRLTGALK-DIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGH 1204
                    AL+  +D+EL  L   I +++  I  +FD F + GYSL AVFIHRGEASYGH
Sbjct: 1267 HATTSHLDALRVALDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGH 1326

Query: 1205 YWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKR 1264
            YWVYIKD    GIWRKYNDE++TEVPE+EVF+F+E NTATPYFLVYVK+ +  +IEPLKR
Sbjct: 1327 YWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKR 1386

Query: 1265 IV 1266
            ++
Sbjct: 1387 LL 1388

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1160 (38%), Positives = 657/1160 (56%), Gaps = 110/1160 (9%)

Query: 129  ILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLST----FDDVADL----KIYHLKITV 180
            ++  +FEY+S T  + N I     +L    H+P       ++ +A      + YHLK+++
Sbjct: 168  LINYRFEYESKTNHQDNKILEFFSIL----HKPKDASNLDYESMAKFWSQNEFYHLKVSI 223

Query: 181  KVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLE 240
            K R+ LE +K+H  +  ++++D  +  D+ D +NF+P +P L+D+AI++S +TNK+VL+E
Sbjct: 224  KTRNQLELSKKHTPIQHFYVIDEFNEEDKLDFINFNPDNPNLLDYAIFISSNTNKVVLVE 283

Query: 241  IFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTR- 299
            IF+ EF+  ++   L    +   +    K  ++  K ++PTQ D +  +   F       
Sbjct: 284  IFKSEFNLNDKLIILDDLQVLNNY---EKYKNSNHKLKLPTQTDVLLVLMYCFNKQQNFD 340

Query: 300  --KSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXXDYLPPNLVDFE 357
               S+++ +K    D+  +   +NP WL  ++                 +    NL+  E
Sbjct: 341  NIHSSEDEIKL--KDSKAIKISLNPSWLTERFSLKFQEDESLIFMNLRNNL---NLIKKE 395

Query: 358  TDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQTSFSTLFWSQI 417
                 ++  +  TR  LEL  L K +   +     +  +  ++  + +  + S  FWSQI
Sbjct: 396  -----KRRFDVFTRCLLELFVLIKSAPQKLVKCNSKDTN-IIKVVDTISINSSLSFWSQI 449

Query: 418  LDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHF 477
            L E K+I +     Q +     I+LS    YT+ +I++NYE+   L+P  IG+YFDSL F
Sbjct: 450  LGEYKSILSQNNFNQYSKHAEFINLSILPTYTESEIVKNYEILTILNPDKIGVYFDSLKF 509

Query: 478  IANNRGSY-TLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAI----FMTIYKN 532
            ++     Y  L  Y +K +I+G E   Q+LK F +D   ++ ++ +D++    ++T Y++
Sbjct: 510  VSQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDK--LEFTNCSDSVLWEKYLTYYED 567

Query: 533  EVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDI 592
            +     N       LRN+++ L+  KNS  LKF   YEPY +   AF  L + ESVD D 
Sbjct: 568  K-----NFDYNHAILRNSIKSLSIVKNSPILKFLCKYEPYKNPDNAFVTLNIHESVDSDT 622

Query: 593  IQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSEA 652
            I  +Y+ K+ND    K   D+AL T+A+ ++ + L + L++ C  F + Y      Y  A
Sbjct: 623  IIVSYTTKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLYENCKDFVNLYHSMNIEYKTA 682

Query: 653  LQKLQVNENAADDTILEIFQRRWTSDSVI------DADEILSLKSVLTKIAFERNSKLIS 706
            LQ +  +E  +D+ ++  F++RW    V       D   +L+L+ V+  I+  RNS L++
Sbjct: 683  LQAIDSSELNSDNELILSFKKRWYRIDVNNDTFGDDTVNLLTLRKVMMVISSNRNSLLLN 742

Query: 707  SYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKT-LEAVE 765
            +Y+E G+VNP  LP+ +WP GLNNIGNTCYLNSLLQYYF ISPLR Y+ ++    L+  E
Sbjct: 743  NYIEYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISPLREYLINFNDIELDGRE 802

Query: 766  NCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAP 825
                   +KRR+GGR ++  E  RS+QFVYQLRDL+ EM+HSSSR V+P  +LAYLAFAP
Sbjct: 803  ---MKNLEKRRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHSSSRKVSPRLQLAYLAFAP 859

Query: 826  SNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQLIEI 885
            S      D P E + G    +  +  + D+     +  S+       K  NS  N   + 
Sbjct: 860  S------DTPIEFRDGIQNAIGKNDYYSDKTNGGSESSSI-------KGLNSNLNSDSDA 906

Query: 886  DDSSDSSGHKKVEEISQNPCFGKST-DTSTRVAKISFDQLENALELGRQQDVTECIGNVL 944
            D S DS     +      P    ST +  T + KIS  QLE  LE+G QQDVTECI NVL
Sbjct: 907  DSSLDSDSESSLLTFDNLPIIKTSTTNLPTLIPKISSSQLETTLEMGSQQDVTECIENVL 966

Query: 945  FQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDH 1004
            FQ+E+ASNPIS++ED+EQ DL+K+LF+GKT+Q I P    +++  K ERF+SLLV+VSD 
Sbjct: 967  FQIEAASNPISIDEDNEQVDLVKQLFFGKTEQKIKPFNEVSKVHPKRERFLSLLVSVSDK 1026

Query: 1005 PKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEP 1064
            P+D+YDALD YF DE   M+EYG+VKKSL ++ FPTILQ+QIQRVYYD E+ +PFK +EP
Sbjct: 1027 PRDIYDALDTYFKDEVFDMEEYGKVKKSLTISSFPTILQVQIQRVYYDIEKGVPFKDLEP 1086

Query: 1065 LPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFME 1124
            L FSE++Y+DRY    D  L +KK E   LKK+L  +   +KEL  +N            
Sbjct: 1087 LRFSESLYLDRYANDIDEKLAEKKIEVASLKKRLKGLITIKKELEKKN------------ 1134

Query: 1125 TRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQ 1184
                   D +E + I                K+I+D           +E KID  F +F 
Sbjct: 1135 -------DNVEIRTIS---------------KEIND-----------VETKIDTAFSEFH 1161

Query: 1185 NIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
              GYSLFAVFIHRG+A++GHYW+YIKDF  +G WRKYND  +TE+   EVFNF+EGN++T
Sbjct: 1162 KHGYSLFAVFIHRGQATFGHYWIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNSST 1221

Query: 1245 PYFLVYVKQENLNEIEPLKR 1264
            PYFLVY+K  +  ++EPLKR
Sbjct: 1222 PYFLVYIKNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1285 (32%), Positives = 664/1285 (51%), Gaps = 122/1285 (9%)

Query: 11   YSEIGEQPE---NSNAVDLENDSEVNSSSMDLDSCGDATSVSWKDDGKQLLYPDARDLTP 67
            + ++GE+ +   + +  D  N +  NSS+ +++   + TS+   DDG  LLY +      
Sbjct: 30   FKKLGEESKLKKHHHDADKINPNTANSSAQNVEK--NDTSI---DDGMHLLYQNIEKEGV 84

Query: 68   FKTSERLLDEIMCSVPYILL-SEKDESFNEFSNGXXXXXXXXXXXXRHNVQPFSVGTI-V 125
            FKTS+R+LD+I+  + ++ L SEK +   +F +G            R  ++PF +     
Sbjct: 85   FKTSQRILDDILTDIAFMSLDSEKSDDI-DFKDGVLNLPTIKYSLWRKYIKPFKIILFNT 143

Query: 126  DQIILQTKFEYKSTTCPEFNNIYVRLGVLIDT--NHQPLSTFDDVADLK-IYHLKITVKV 182
            +  ++  K ++KS T P+ N I    G+L+        L+TFD+    K +Y ++ITVK 
Sbjct: 144  NNPVVDVKLQHKSVTSPKNNTITELYGLLVPKIPRRSELNTFDEYIRSKPLYSIRITVKT 203

Query: 183  RSFLERTKRHVGVPRYHLLD---SLHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLL 239
            R  LE  K+H+ +  Y LLD    LH  D+ D   F+     L+D +IY+S DTNK++L+
Sbjct: 204  RHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFNKDSKDLLDFSIYISSDTNKIILI 263

Query: 240  EIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDE----IPTQIDCINTMFKI--- 292
            EIF+P F+  E    L+  ++  R  +    ++ L  D     +  QID I  +      
Sbjct: 264  EIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQPDYNDAIVEEQIDTIEILLHCIMQ 323

Query: 293  -FKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFXXXXXXXXXXXXXXXDYL-- 349
              KG   R+   +    L SD+V L + ++ KWL   +                 D    
Sbjct: 324  NLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEENFDIKVKEQKRKDHVSITLDEALK 383

Query: 350  -------PPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTF 402
                   P N   F+           +TR  +EL++LGK+  S  + E++         F
Sbjct: 384  LSFDDPNPKNQAKFD----------KITRYAMELMYLGKVLQSFYSNEEEIEEYMEDTIF 433

Query: 403  NLLQTSFSTLFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCK 462
              ++   +T FW+QIL+E ++I + ++     +D H I+L    + +++DII NYE+Q +
Sbjct: 434  KQVKVHHTTSFWTQILNEYQSIFSSQKTSTRCVDEHFINLCIDSNVSEKDIITNYEIQLR 493

Query: 463  LDPANIGIYFDSLHFIANNRGSYTLI-GYCDKQDIVGQEALEQALKTFSLDPDTIDLSDT 521
             DP N   YF+SL +++     Y ++  YC +  I+ + A   AL+ F    +  +  + 
Sbjct: 494  TDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISKAAYLHALEIFKYSEEYFNAIEH 553

Query: 522  NDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNI 581
               I+    +     + ND     +L ++   LA  K SS L +   YEP+     A+  
Sbjct: 554  VSEIWDKYTELVQSNNNNDDQYRVDLVDSFYSLATVKKSSPLIYITKYEPFFHPVTAYLK 613

Query: 582  LEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDF 641
            L VD  +D + I  AY++++ + P  KI  DRAL+ +A+ +  + L+  L Q C  F + 
Sbjct: 614  LNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAIAIQRHDLSLLYVLKQNCSAFNEC 673

Query: 642  YGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERN 701
                  T  +A + + + + +++ +I+  F + W      +    +   + L +++  R 
Sbjct: 674  ISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKETDDSNPVNFILASAALREVSKHRA 733

Query: 702  SKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTL 761
            S L+  + E G VNP  + ++ WP G+NNIGNTCYLNSLLQYYF I+  R ++ +YQ   
Sbjct: 734  SALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSLLQYYFSITLFREFIENYQSIE 793

Query: 762  EAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYL 821
              + N   +   KRR+GGREI   E+ RSVQF+YQ++DLF  M+H+ SR VTP+ +LAYL
Sbjct: 794  SDLLNSNAE-MSKRRVGGREIQNNEINRSVQFIYQVQDLFKLMVHTKSRKVTPSNQLAYL 852

Query: 822  AFAPSNVEVEFDQPNELQSGNGEDVDGDIVFIDEDISEPKGKSLVLDEENSKVENSPENQ 881
            AFAP+N E++F   +EL+S              E+       S+ L              
Sbjct: 853  AFAPNNAEIKFKHKSELESS-------------EEHQLTTSHSIAL-------------- 885

Query: 882  LIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIG 941
                  S+ S  H  ++    +     ++ ++  VA ++ D LE  LE+G QQDVTECI 
Sbjct: 886  -----SSATSISHSDIDTQDHDISLNSTSYSNRLVAMVTRDDLETTLEIGNQQDVTECIN 940

Query: 942  NVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNV 1001
             VL+Q+E+ S P+ L+ D+EQ DL+K+LFYG+T Q I P+K   +   K E + SLLVN+
Sbjct: 941  TVLYQVETGSMPLYLDADNEQMDLVKELFYGETIQEICPIKKFIKGHEKRELYSSLLVNI 1000

Query: 1002 SDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKS 1061
             D P D+Y+ LD YF+DEY++M+EYGEVKK+L++T+ PTIL IQIQRVYYD+E+ +P+K 
Sbjct: 1001 LDSPTDLYEVLDEYFADEYMSMEEYGEVKKTLSITKLPTILNIQIQRVYYDKEKLVPYKC 1060

Query: 1062 IEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEA 1121
               LPF   I++DRY +                        K++ ++L +  L L  K A
Sbjct: 1061 GTALPFKNEIFLDRYIKGN----------------------KKENDVLEKARLEL--KLA 1096

Query: 1122 FMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFD 1181
             ++ R+                   L+       K I D +   Y+ I  + A I+ +  
Sbjct: 1097 KVKYRE-------------------LVSEYNSVNKSISDRIITTYDRIEELNAVIEEEVT 1137

Query: 1182 KFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGN 1241
            K   I YSLFAVFIHRG+AS+GHYWVYI+DF +NGIWRKYND  +T   E E+F   +G+
Sbjct: 1138 KDAKIRYSLFAVFIHRGQASFGHYWVYIRDF-ENGIWRKYNDHQVTGAHEDEIFKCVDGD 1196

Query: 1242 TATPYFLVYVKQENLNEIEPLKRIV 1266
             +TPYFL YV     + ++PL R V
Sbjct: 1197 ISTPYFLAYVDSSKKSIVKPLVRDV 1221

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 43/97 (44%), Gaps = 21/97 (21%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINK 784
           P GL N+GNTCY+NS LQ  + I PLR+ V +Y+   E                     K
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPRE---------------------K 97

Query: 785 VEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYL 821
              E+  Q V +LR  F ++       VTP   LA L
Sbjct: 98  PSEEQHHQLVSELRRCFQQLKDKPQESVTPMLLLAML 134

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ ++ + + ++ +   G  + + 
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKIESLAGGGESDSA 439

Query: 1246 YFLVY 1250
              L+Y
Sbjct: 440  LILIY 444

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 48/113 (42%), Gaps = 26/113 (23%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINK 784
           P GL N+GNTCY+NS LQ  + I PLR  + ++Q   E             R G      
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKE------------NRSG------ 146

Query: 785 VEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELA-----YLAFAPSNVEVEF 832
              E+ +Q V +L+  F ++        TP   LA     Y  FA  + E  F
Sbjct: 147 ---EQHIQLVAELKRCFQQLRDRPQESTTPILLLATLRKCYPQFAERDQESGF 196

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ ++ + + ++ +   G  + + 
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKIESLAGGGESDSA 485

Query: 1246 YFLVY 1250
              L+Y
Sbjct: 486  LILIY 490

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 14/65 (21%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY-------------QKTLEAVENCLEDG 771
           P GL N+GNTCYLN+ LQ  F I PLR  + +Y             QK +  + NC  D 
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSPADEVHQKIVLELRNCF-DS 166

Query: 772 WDKRR 776
            DK++
Sbjct: 167 LDKKK 171

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y+L  +  H+G  S  GHY  +I+D     IW K+ND+ +T V + ++     G  +   
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAGGGESDSA 493

Query: 1247 FLVYVK 1252
             ++  K
Sbjct: 494  LILLYK 499

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 721 ADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           A++ P G  N+GNTCYLN+ LQ  + I PLR+ + DY
Sbjct: 104 ANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDY 140

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y L  V  H+G  S  GHY  +I+D      W  +ND+ ++ VP+ ++     G  + + 
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKIEGLAGGGESDSA 484

Query: 1246 YFLVY 1250
              L+Y
Sbjct: 485  LILIY 489

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 15/94 (15%)

Query: 721 ADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGR 780
           + + P G  N+GNTCYLNS LQ  + I PLR  +  Y  +  A  +  +           
Sbjct: 103 SSDLPIGFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADS---------- 152

Query: 781 EINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTP 814
                 VE   + V +L+  F  + + S + V P
Sbjct: 153 -----TVESHKKIVLELQRCFQNLKNKSFKSVMP 181

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ + + G  + + 
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIESLSGGGESDSA 490

Query: 1246 YFLVY 1250
              L+Y
Sbjct: 491  LILIY 495

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 36/93 (38%), Gaps = 25/93 (26%)

Query: 722 DNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGRE 781
           D  P GL N+GNTCY N+ LQ  + I PLR  V  Y                        
Sbjct: 102 DTIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAY------------------------ 137

Query: 782 INKVEVERSVQFVYQLRDLFNEMIHSSSRCVTP 814
            N+   +   Q V QLR+ FN       +  TP
Sbjct: 138 -NEPNPDLHGQLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y+L  V  H+G  S  GHY  +++D      W KYND+ +  V   +V     G  + + 
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKVEQLAGGGESDSA 474

Query: 1246 YFLVY 1250
              L+Y
Sbjct: 475  LILIY 479

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 25/35 (71%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQK 759
           P GL N+GNTCY+N+ LQ  + I+PLR  + ++ K
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDK 137

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ + + ++ +   G  + + 
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKIESLAGGGESDSA 482

Query: 1246 YFLVY 1250
              LVY
Sbjct: 483  LILVY 487

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRI 777
           P G  N+GNTCYLN+ LQ  + +  LR+ + +Y  + EA  + ++D    ++I
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQI 160

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1247 FLVYVK 1252
             ++  K
Sbjct: 490  LILMYK 495

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           P G+ N+GNTCY+N+ LQ  F I PLR  V ++
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 1172 IEAKIDRQFDK--FQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEV 1229
            I   I ++FD      + YSL +V +H G  +YGHY  + K     G+W + +DET+  V
Sbjct: 704  IPQTIRKKFDSTPIGPLTYSLRSVIVHYGTHNYGHYIAFRK---YRGVWWRISDETVYIV 760

Query: 1230 PEAEVFN 1236
             EAEV +
Sbjct: 761  DEAEVLS 767

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 5/37 (13%)

Query: 706 SSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQ 742
           SS +++ V+N G      + AGL N GNTC++NS+LQ
Sbjct: 113 SSQMDSNVLNHG-----GYIAGLLNDGNTCFMNSVLQ 144

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 78/182 (42%), Gaps = 25/182 (13%)

Query: 1087 KKDETFELKKQLSEMRKRQKELLSRNE-------LGLSRKEAFMETRKFLSSDALEKQGI 1139
            K+DE   +++ L      Q+ELL+ ++        GL   E  +  ++   + +L  +  
Sbjct: 466  KEDENLNIQRHLESFH--QRELLNGSDKFYCDRCCGLQEAERLVGLKRLPKTLSLHLKRF 523

Query: 1140 ETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGE 1199
            +    +M   +L      ID      Y   + + +  D +  K     Y L +  IH G+
Sbjct: 524  KYSEDKMANIKL---FNKID------YPTFLTVSSTFDSKLSK----RYELASAVIHLGD 570

Query: 1200 A-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNE 1258
               YGHY    K  T+   W  ++DET+  V E  V +FT  N+ T Y L Y +    +E
Sbjct: 571  GPQYGHYISLCK--TETFGWLLFDDETVEAVDEQTVLSFTGENSDTAYVLFYNEVSEYDE 628

Query: 1259 IE 1260
            ++
Sbjct: 629  VK 630

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 27/62 (43%), Gaps = 15/62 (24%)

Query: 727 GLNNIGNTCYLNSLLQYYFCIS---------PLRNYVADYQKTLEAVENCLEDGWDKRRI 777
           G  N GNTCY NS+LQ +F  S         P  N   +  +TLE        G  KR I
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSFPSSNSDGERARTLETF------GRSKRNI 181

Query: 778 GG 779
            G
Sbjct: 182 NG 183

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G+W  Y+DE I ++ + EV   T      
Sbjct: 671  VKYQLISVVVHEGRSLSSGHYVAHCKQ--PDGLWATYDDEYINKISDKEVLRETNA---- 724

Query: 1245 PYFLVYVK 1252
             Y+LVY +
Sbjct: 725  -YYLVYSR 731

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            + YSL +V +H G  +YGHY  + K     G W + +DE++T V EAEV +
Sbjct: 685  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDESVTIVDEAEVLS 732

 Score = 33.1 bits (74), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 5/37 (13%)

Query: 706 SSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQ 742
           +S LE  ++N G      + AGL N GNTC++NS+LQ
Sbjct: 74  NSQLEEKILNRG-----GFVAGLVNDGNTCFMNSVLQ 105

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 50/101 (49%), Gaps = 7/101 (6%)

Query: 1164 KLYNDIV-NIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKY 1221
            KL+N I+  +   +   FD   +  Y L  V IH G    +GHY    K+  K G W  Y
Sbjct: 568  KLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICKN-EKFG-WLLY 625

Query: 1222 NDETITEVPEAEVFNFTE--GNTATPYFLVYVKQENLNEIE 1260
            +DET+  + E  V  FT   G+  T Y L Y K+ ++NE +
Sbjct: 626  DDETVESIREETVLKFTGHPGDQTTAYVLFY-KETHVNEAD 665

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAV 764
           G  N GNTCY NS+LQ  + IS  R  V  Y + +  V
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRYPERVPVV 164

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 46/95 (48%), Gaps = 14/95 (14%)

Query: 1164 KLYNDI-----VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGI 1217
            KL+N +     +N+ +  D   +K     Y L  V IH G +  +GHY    K+  K G 
Sbjct: 667  KLFNKVYYPLTLNVASTFDSSIEK----AYELTGVVIHMGSSPQHGHYVSLCKN-DKFG- 720

Query: 1218 WRKYNDETITEVPEAEVFNFT--EGNTATPYFLVY 1250
            W  ++DET+  V E+ V  FT    N AT Y L Y
Sbjct: 721  WLLFDDETVESVSESTVLEFTGDPNNQATAYVLFY 755

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 9/69 (13%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYF 1247
            Y L  +  HRG  + GHY  Y K  T +G+W ++ND  + +VP  ++           Y 
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTK--TADGVWYQFNDSVVMKVPLEQMLK------EQAYL 474

Query: 1248 LVY-VKQEN 1255
            L+Y ++Q N
Sbjct: 475  LIYTIRQFN 483

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 722 DNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           D+ P GL N+GNTCY+N+ LQ  F +  +R+ + +Y
Sbjct: 103 DSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y+L  +  H+G  S  GHY  +I+D T    W K+ND+ ++ V + ++     G  +   
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKIEALAGGGESDSA 483

Query: 1247 FLVYVK 1252
             ++  K
Sbjct: 484  LILMYK 489

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 14/82 (17%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINK 784
           P G+ N+GNTCY+N+ LQ  + I PLR  +  +       E             G ++  
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAE-------------GMDLYH 105

Query: 785 VEVERSVQFVY-QLRDLFNEMI 805
           V++ R +Q  + +LRD   E I
Sbjct: 106 VQLIREIQATFRKLRDKKGEAI 127

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y L  V  H+G  S  GHY  +++D   +  W K+ND+ +T + + ++ +   G  + + 
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKIESLAGGGESDSA 436

Query: 1246 YFLVY 1250
              L+Y
Sbjct: 437  LILIY 441

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            + YSL +V +H G  +YGHY  + K     G W + +DET+  V EAEV +
Sbjct: 622  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVGIVTEAEVLS 669

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 702 SKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVAD 756
           +K ++SY     ++   L    + AGL N GNTC++NS+LQ       L +++ D
Sbjct: 42  AKRMTSYYSAPSMDDVILKRGGFVAGLVNDGNTCFMNSVLQSLASSRELAHFLDD 96

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 16/90 (17%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINK 784
           P G  N+GNTCYLN+ LQ  + ++ LR  + +Y  +     N ++D          E +K
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQD---------EETHK 158

Query: 785 VEVERSVQFVYQLRDLFNEMIHSSSRCVTP 814
                  Q V +++  F  + + S + V P
Sbjct: 159 -------QIVIEMKRCFENLQNKSFKSVLP 181

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1247 FLVYVK 1252
             ++  K
Sbjct: 490  LILMYK 495

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            YSL +V +H G  +YGHY  + K     G W + +DET+  V EAEV +
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAFRK---HRGFWWRISDETVYIVDEAEVLS 753

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 6/103 (5%)

Query: 1164 KLYNDIV-NIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKY 1221
            KL+N I+  +   +   FD   +  Y L  V IH G    +GHY    K+  K G W  Y
Sbjct: 574  KLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICKN-EKFG-WLLY 631

Query: 1222 NDETITEVPEAEVFNFTE--GNTATPYFLVYVKQENLNEIEPL 1262
            +DET+  + E  V  FT   G+  T Y L Y + +  N  E +
Sbjct: 632  DDETVESIREETVLQFTGHPGDQTTAYVLFYKESQVNNRTEKI 674

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 42/91 (46%), Gaps = 6/91 (6%)

Query: 1164 KLYNDI-VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKY 1221
            KL+N I   +   +   FD   +  Y L  V IH G    +GHY    K+  K G W  Y
Sbjct: 579  KLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICKN-EKFG-WLLY 636

Query: 1222 NDETITEVPEAEVFNFT--EGNTATPYFLVY 1250
            +DET+  V E  V  FT   G+  T Y L Y
Sbjct: 637  DDETVESVSEETVLKFTGHSGDQTTAYVLFY 667

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 10/73 (13%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            + Y+L +V +H G  +YGHY  + K     G+W + +DET+  V EAEV        +TP
Sbjct: 677  LTYALRSVIVHYGTHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVL-------STP 726

Query: 1246 YFLVYVKQENLNE 1258
               +   + + NE
Sbjct: 727  GIFMLFYEHDYNE 739

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 16/90 (17%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINK 784
           P G  N+GNTCYLN+ LQ  + ++ LR+ + +Y  +     +  +D          EI+K
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQD---------EEIHK 158

Query: 785 VEVERSVQFVYQLRDLFNEMIHSSSRCVTP 814
                  Q V +++  F  + + S + V P
Sbjct: 159 -------QIVIEMKRCFENLQNKSFKSVLP 181

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V + ++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1247 FLVYVK 1252
             ++  K
Sbjct: 490  LILMYK 495

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            + YSL +V +H G  +YGHY  + K     G W + +DET+  V EAEV 
Sbjct: 680  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 726

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            + YSL +V +H G  +YGHY  + K     G W + +DET+  V EAEV 
Sbjct: 681  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 727

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 706 SSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQ 758
           SS++E    +      ++ P G  N+GNTCY+NS LQ  F +  L++ + +Y+
Sbjct: 89  SSFIEDLAPDQQMQKLNDLPIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y L  +  H+G  S  GHY  +I+D      W K+ND+ ++E  + ++     G  + + 
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKIEQLAGGGESDSA 495

Query: 1246 YFLVY 1250
              L+Y
Sbjct: 496  LILIY 500

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            Y+L +V +H G  +YGHY  Y K     G+W + +DE++  V EAEV +
Sbjct: 689  YALRSVIVHYGTHNYGHYIAYRK---FRGVWWRISDESVYVVDEAEVLS 734

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 1177 DRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            D + +K  N  Y+L  V +H G+ S GHY+  IK   ++  W +++DE + +V + +VF 
Sbjct: 428  DSKKEKENNCVYNLHGVLVHAGDISTGHYYTLIKPGLEDQ-WYRFDDERVWKVTKNQVFE 486

Query: 1237 FTEGNTATP 1245
               G  A P
Sbjct: 487  ENYGLDALP 495

 Score = 39.3 bits (90), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 79/179 (44%), Gaps = 23/179 (12%)

Query: 915  RVAKISFDQLENALELG-------RQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIK 967
            +V+K   D LE     G        Q DV E    ++ +LE+     S+E       ++ 
Sbjct: 257  QVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTSVE------GMLN 310

Query: 968  KLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMD--- 1024
            ++F GK K  I  +  + E  +++E F  L +NV +  K + ++ D Y   E L  +   
Sbjct: 311  EIFVGKMKSYIKCIDVDYE-SSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGENQY 368

Query: 1025 ---EYG--EVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTE 1078
               +YG  + +K +    FP +L +Q++R  YD       K  +   F ETI +  Y E
Sbjct: 369  QAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLE 427

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV 754
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            + YSL +V +H G  +YGHY  + K     G W + +DET+  V EAEV 
Sbjct: 683  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 729

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            + YSL +V +H G  +YGHY  + K     G W + +DET+  V EAEV 
Sbjct: 679  LTYSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 725

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 1182 KFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            K  +I Y L  +  HRG  + GHY  + K     G W K+ND  +T + + EV 
Sbjct: 405  KVPDIIYELIGIVSHRGTVNEGHYIAFCK--ISGGQWFKFNDSVVTSIAQGEVL 456

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            Y+L +V +H G  +YGHY  + K     G+W + +DET+  V EAEV +
Sbjct: 678  YALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVLS 723

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E +V    E N   
Sbjct: 643  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWSTYDDEYINKITERDVLR--ESNA-- 696

Query: 1245 PYFLVYVK 1252
             Y+LVY +
Sbjct: 697  -YYLVYTR 703

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E +V   T      
Sbjct: 642  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISERDVLKETNA---- 695

Query: 1245 PYFLVYVK 1252
             Y+L+Y +
Sbjct: 696  -YYLLYTR 702

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 1185 NIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            NI Y L  V  H+G    GHY    K  T++G W K+ND  +T V E +V          
Sbjct: 386  NIAYDLLNVVSHQGTVDQGHYTTVSK--TEDGQWFKFNDSVVTSVTEEQVLE------QQ 437

Query: 1245 PYFLVYV 1251
             Y L Y+
Sbjct: 438  AYLLFYI 444

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E ++    E N   
Sbjct: 637  VRYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISEKQLLK--EPNA-- 690

Query: 1245 PYFLVYVK 1252
             YFLVY +
Sbjct: 691  -YFLVYTR 697

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            + YSL +V +H G  +YGHY  + K     G W + +DET+  V EAEV +
Sbjct: 642  LTYSLRSVIVHYGTHNYGHYIAFRK---FRGCWWRISDETVYIVDEAEVLS 689

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            + Y L +V +H G  +YGHY  + K     G W + +DET+  V EAEV      +T + 
Sbjct: 670  LTYELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSV 721

Query: 1246 YFLVY 1250
            + L Y
Sbjct: 722  FMLFY 726

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 18/91 (19%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINK 784
           P G  N+GNTCYLN+ LQ  + I  LR+ V ++  ++   +N                  
Sbjct: 106 PIGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDKNG----------------- 148

Query: 785 VEVERSVQFVYQLRDLFNEMIHSSSRCVTPT 815
            E E  ++ V +L+  F  + + S + V P 
Sbjct: 149 -ENETHIKLVTELKRCFEGLKNKSFKSVMPV 178

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGN 1241
            Y L  +  H+G  S  GHY  +I+D     IW K+ND+ ++ + + ++ +   G 
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVSIIEKEKIESLAGGG 484

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%)

Query: 722 DNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQ 758
           +  P GL N+GNTCY+NS LQ  + +  LR+ V  Y+
Sbjct: 105 NQMPIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYK 141

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA-TP 1245
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ ++ V   ++     G  + + 
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVSVVEREKIEALAGGGESDSA 486

Query: 1246 YFLVY 1250
              L+Y
Sbjct: 487  LILIY 491

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 8/73 (10%)

Query: 1181 DKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTE 1239
            DK   + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E +V    E
Sbjct: 662  DKDLPVKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGTWATYDDEYINKISERDVLK--E 717

Query: 1240 GNTATPYFLVYVK 1252
             N    Y+L+Y +
Sbjct: 718  PNA---YYLLYTR 727

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNY 753
            GLNN+GNTCY+NS LQ    I P+R+Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1188 YSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y L +V +H G + S GHY  + +    +G W  Y+DE I ++ E ++   TE N    Y
Sbjct: 761  YQLLSVVVHEGRSLSSGHYIAHCRQ--PDGTWATYDDELINKISELKL--LTEPNA---Y 813

Query: 1247 FLVYVK 1252
            +LVY +
Sbjct: 814  YLVYTR 819

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            YSL +V +H G  +YGHY  + K     G+W + +DET   V EAEV +
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRK---FRGVWWRISDETAYIVDEAEVLS 719

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E E+    E N   
Sbjct: 753  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISEREMLK--EPNA-- 806

Query: 1245 PYFLVYVK 1252
             Y+L+Y +
Sbjct: 807  -YYLLYTR 813

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            Y L  V +H G+ S GHY+  IK  T++  W +++DE + +V + +VF+   G    P
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVWKVTKTQVFDENFGLDRIP 487

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLE------AVENCLEDGWDKRRIGG 779
            G  N G TCYLNSLLQ YF     R  V  YQ   E      +V   L+  + + ++  
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV--YQIPTENDSPNNSVPLALQRAFYQLQVSD 250

Query: 780 REINKVEVERS 790
             ++ +E+ RS
Sbjct: 251 EPLDTLELTRS 261

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E EV    E N   
Sbjct: 660  VKYELLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKITEREVLK--ERNA-- 713

Query: 1245 PYFLVYVK 1252
             Y+++Y +
Sbjct: 714  -YYVLYTR 720

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            I Y L AV IH G  +YGHY  Y K   +   W + +DE++ EV E EV 
Sbjct: 420  IIYDLKAVIIHYGTHNYGHYISYRKFMNQ---WWRISDESVIEVDEMEVL 466

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E  V          
Sbjct: 636  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGTWATYDDEYINKITERNVL-----KEVN 688

Query: 1245 PYFLVYVK 1252
             Y+LVY +
Sbjct: 689  AYYLVYTR 696

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            Y+L  V +H G+ S GHY+  IK  T +  W +++DE +  V + +VF+   G    P
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKP-TTDDKWYRFDDEKVWRVTKKQVFDENFGLNRLP 552

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV 754
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV 287

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 79/188 (42%), Gaps = 24/188 (12%)

Query: 915  RVAKISFDQLENALELG-------RQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIK 967
            +V+    D LE     G        Q DV E    ++ +LES     S+E        + 
Sbjct: 313  QVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMKGTSVEGK------LT 366

Query: 968  KLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSD-----HPKDVYDALDLYFSDEYLT 1022
             +F GK K S I   N +   +++E F  + +NV       +  + Y  ++L   +    
Sbjct: 367  DVFVGKMK-SYIKCVNIDYESSRVEDFWDIQLNVKGLEGLANAFENYIEVELMDGENQYA 425

Query: 1023 MDEYG--EVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETT 1080
              +YG  + KK +    FP +L +Q++R  YD       K  +   F ETI +  Y    
Sbjct: 426  AQDYGLQDAKKGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPY---M 482

Query: 1081 DADLLKKK 1088
            D ++LKK+
Sbjct: 483  DKEVLKKQ 490

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           P G  N+GNTCYLN+ LQ  F +  LR  + +Y
Sbjct: 107 PIGFKNMGNTCYLNATLQSLFRMDQLRELILNY 139

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGN 1241
            Y+L  V  H+G  S  GHY  +I+D     +W K+ND+ ++ V +  V     G 
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVSIVEKERVEALAGGG 484

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            + Y L +V +H G  +YGHY  + K     G W + +DET+  V EAEV      +T+  
Sbjct: 656  LTYVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVL-----STSGV 707

Query: 1246 YFLVY 1250
            + L Y
Sbjct: 708  FMLFY 712

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 61/153 (39%), Gaps = 30/153 (19%)

Query: 712 GVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVE------ 765
           G V+   L    + AGL N GNTC++NS++Q     + L  ++ D     E ++      
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLDDEIAKKEEIDETELLQ 137

Query: 766 -----NCLEDGWDKRRIGGREINKV---------------EVERSVQFVYQLRDLFNEM- 804
                  +E    +R++ G+   K                E    V F   LR++ N++ 
Sbjct: 138 DEEKPTSVEPDTIERKVKGKSYGKAKKHANRKLANGVSDEEKTPDVTFSLALREMLNKLN 197

Query: 805 --IHSSSRCVTPTKELAYLAFAPS-NVEVEFDQ 834
              +    C    K L  +  +P+ N+ + +DQ
Sbjct: 198 TKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQ 230

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 722 DNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQ 758
           D+ P G  N+GNTCY+N+ LQ  +    +R  + DY+
Sbjct: 107 DSTPIGFQNMGNTCYMNATLQALYRTDDIRQMILDYK 143

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 92/227 (40%), Gaps = 41/227 (18%)

Query: 1035 VTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYM-DRYTETTDADLLKKKDETFE 1093
            +T+ P  L +Q  R Y+ R      K +  + F   + + D  T     + +K +D   +
Sbjct: 304  ITKLPKFLTVQYVRFYWKRSTGKKSKILRKVVFPFQLDLSDMLTPEYQQEKIKVRDAMRQ 363

Query: 1094 LKK----QLSEMRKRQKELLSR--NELGLSRKEAFMETRKFLSSDALEKQGIETENKQML 1147
            ++K    +  E++KR+    +R  NEL   R+EA  ET K           IE   K+  
Sbjct: 364  VEKNKLEKERELKKRKLSPTARSTNELMTPREEA--ETEK----------AIEESEKEYW 411

Query: 1148 IDRLTGAL-KDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEAS-YGHY 1205
            ++       KD+                   RQ +    + Y+L  +  H+G  S  GHY
Sbjct: 412  LNEYAKCFPKDL-------------------RQGENPSCV-YNLIGIITHQGANSESGHY 451

Query: 1206 WVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVK 1252
              +++D      W K+ND+ +T V + ++     G  +    ++  K
Sbjct: 452  QAFMRDENDENKWYKFNDDKVTVVEKEKIEALAGGGESDSALILMYK 498

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L  V +H G + S GHY V+ K    +G W  Y+DE I ++ E +V    E N   
Sbjct: 547  VKYQLTTVVVHEGRSLSSGHYIVHCKQ--PDGTWATYDDEYINKITERDVLK--EPNA-- 600

Query: 1245 PYFLVYVK 1252
             Y+L+Y +
Sbjct: 601  -YYLLYTR 607

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 67/157 (42%), Gaps = 26/157 (16%)

Query: 685 EILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYY 744
           +IL+   V+    + +N   +S+Y     + P      +   GL N+GNTCY+NS LQ  
Sbjct: 257 DILTGDFVVELRQYNKNYHWLSNYFMYNQLTPS-----SGITGLYNLGNTCYMNSALQCL 311

Query: 745 FCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEM 804
             I  LR+Y          + NC ED  +     G +     V R+  F   +++LF   
Sbjct: 312 VHIPELRDYF---------LYNCFEDEINCNNPLGYQ---GYVARA--FSGLVQNLFGCK 357

Query: 805 IHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQSG 841
             SS   +TP       A++P+  +      N + SG
Sbjct: 358 TLSSGSTLTP-------AYSPTGFKSTIGHFNSMFSG 387

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + +    +G W  Y+DE I ++ E  V        A 
Sbjct: 689  VKYELLSVVVHEGRSLSSGHYIAHCRQ--PDGSWATYDDEYINKISELNVL-----KEAN 741

Query: 1245 PYFLVYVK 1252
             Y+L+Y +
Sbjct: 742  AYYLLYTR 749

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 8/73 (10%)

Query: 1181 DKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTE 1239
            DK   + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E +V    E
Sbjct: 650  DKDLPVKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGNWATYDDEYINKISERDVLK--E 705

Query: 1240 GNTATPYFLVYVK 1252
             N    Y+L+Y +
Sbjct: 706  PNA---YYLLYTR 715

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 1164 KLYNDI-VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKY 1221
            KL+N +   ++  +   FD      Y L  V IH G +  +GHY    K+  K G W  +
Sbjct: 563  KLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGSPQHGHYVSLCKN-DKFG-WLLF 620

Query: 1222 NDETITEVPEAEVFNFT--EGNTATPYFLVY 1250
            +DET+  V E  V  FT    N AT Y L Y
Sbjct: 621  DDETVESVTEKTVLEFTGDSSNQATAYVLFY 651

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           G  N GNTCY NS+LQ  + ++ LR  + +Y
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 9/67 (13%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYF 1247
            YSL ++ +H G   YGHY  Y + F     W + +DE++ +V E EVF      +A+  F
Sbjct: 428  YSLKSIVVHYGSHDYGHYISY-RRFEDQ--WWRISDESVLKVDEDEVF------SASGIF 478

Query: 1248 LVYVKQE 1254
            +V+ +Q+
Sbjct: 479  IVFYEQD 485

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            + YSL +V +H G  +YGHY  + +     G W + +DE++  V EAEV +
Sbjct: 672  LTYSLRSVIVHYGTHNYGHYIAFRR---YRGCWWRISDESVYIVEEAEVLS 719

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 700 RNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNY 753
           +N   +S+Y     + P          GLNN+GNTCY+NS LQ    I  LR+Y
Sbjct: 321 KNYHWLSNYFHYNALTPS-----RGNIGLNNLGNTCYMNSALQCLVHIPQLRDY 369

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 24/90 (26%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF------------ 1235
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +  V + +VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1236 -----------NFTEGNTATPYFLVYVKQE 1254
                       N+      + Y LVY++QE
Sbjct: 508  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQE 537

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVEN----CLEDGWDKRRIGGRE 781
            G  N G TCYLNSLLQ YF     R  V +     E+  N     L+  + + ++    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQVSDIP 264

Query: 782 INKVEVERS 790
           ++ +E+ RS
Sbjct: 265 LDTMELTRS 273

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 78/187 (41%), Gaps = 24/187 (12%)

Query: 915  RVAKISFDQLENALELG-------RQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIK 967
            +V+ I  D +E     G        Q DV E    ++ +LE+      +E        + 
Sbjct: 259  QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGK------LN 312

Query: 968  KLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPK-----DVYDALDLYFSDEYLT 1022
            ++F GK K S I   N +    ++E F  L +NV +        D Y  ++L   +    
Sbjct: 313  EIFVGKMK-SYIKCINVDYESARVEDFWDLQLNVKNFENLQGSFDNYIEMELMNGENQYA 371

Query: 1023 MDEYG--EVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETT 1080
              +YG  + +K +    FP +L +Q++R  YD       K  +   F ETI +  +    
Sbjct: 372  AQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPF---V 428

Query: 1081 DADLLKK 1087
            D D+L+K
Sbjct: 429  DKDVLRK 435

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 24/90 (26%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF------------ 1235
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +  V + +VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1236 -----------NFTEGNTATPYFLVYVKQE 1254
                       N+      + Y LVY++QE
Sbjct: 508  KVRTMTREDYQNYIIQRHTSAYMLVYIRQE 537

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVEN----CLEDGWDKRRIGGRE 781
            G  N G TCYLNSLLQ YF     R  V +     E+  N     L+  + + ++    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQVSDIP 264

Query: 782 INKVEVERS 790
           ++ +E+ RS
Sbjct: 265 LDTMELTRS 273

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 26/188 (13%)

Query: 915  RVAKISFDQLENALELG-------RQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIK 967
            +V+ I  D +E     G        Q DV E    ++ +LE+      +E        + 
Sbjct: 259  QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGK------LS 312

Query: 968  KLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYL------ 1021
            ++F GK K S I   N +    ++E F  L +NV +  K++ ++ D Y   E +      
Sbjct: 313  EIFVGKMK-SYIKCVNVDYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGENQY 370

Query: 1022 TMDEYG--EVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTET 1079
               +YG  + +K +    FP +L +Q++R  YD       K  +   F ETI +  +   
Sbjct: 371  AAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPF--- 427

Query: 1080 TDADLLKK 1087
             D ++LKK
Sbjct: 428  VDKEVLKK 435

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           P GL N+GNTCYLN+ LQ  F    L++ +  Y
Sbjct: 108 PLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y L  V  H+G  S  GHY  +I+D +    W K+ND+ ++ + + ++     G  +   
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKIEALAGGGESDSA 485

Query: 1247 FLVYVK 1252
             ++  K
Sbjct: 486  LILLYK 491

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 24/90 (26%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF------------ 1235
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +  V + +VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1236 -----------NFTEGNTATPYFLVYVKQE 1254
                       N+      + Y LVY++QE
Sbjct: 508  KVRTMTRGEYQNYIIQRHTSAYMLVYIRQE 537

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 81/188 (43%), Gaps = 26/188 (13%)

Query: 915  RVAKISFDQLENALELG-------RQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIK 967
            +V+ I  D LE     G        Q DV E    ++ +LE+      +E        + 
Sbjct: 259  QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGK------LN 312

Query: 968  KLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYL------ 1021
            ++F GK K S I   N +    ++E F  L +NV +  K++ ++ D Y   E +      
Sbjct: 313  EIFVGKMK-SYIKCINVDYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGENQY 370

Query: 1022 TMDEYG--EVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTET 1079
               +YG  + +K +    FP +L +Q++R  YD       K  +   F ETI +  +   
Sbjct: 371  AAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPF--- 427

Query: 1080 TDADLLKK 1087
             D D+LKK
Sbjct: 428  VDKDVLKK 435

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVEN----CLEDGWDKRRIGGRE 781
            G  N G TCYLNSLLQ YF     R  V +     E+  N     L+  + + ++    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQVSDIP 264

Query: 782 INKVEVERS 790
           ++ +E+ RS
Sbjct: 265 LDTLELTRS 273

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 56/126 (44%), Gaps = 31/126 (24%)

Query: 1149 DRLTGALKDIDDELT----------------KLYNDI-----VNIEAKIDRQFDKFQNIG 1187
            +RL G LK + D LT                KL+N+I     +N+ + I+ +  +     
Sbjct: 547  ERLVG-LKQLPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVCSSINSEVCQ----K 601

Query: 1188 YSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFT--EGNTAT 1244
            Y L  + +H G    +GHY V +    K G W  ++DET+  V E  V  FT    N AT
Sbjct: 602  YELAGIVVHMGGGPQHGHY-VSLCKHQKFG-WLLFDDETVEAVKEETVLEFTGESANMAT 659

Query: 1245 PYFLVY 1250
             Y L Y
Sbjct: 660  AYVLFY 665

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY-QKTLEA 763
           G  N GNTCY NS+LQ  + +SPLR  +  + +K +E+
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQFPEKPIES 178

>TBLA0J00260 Chr10 (45003..47126) [2124 bp, 707 aa] {ON} Anc_7.514
            YLR452C
          Length = 707

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 11/96 (11%)

Query: 1112 NELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVN 1171
            NE  +   +A++E RKFL   AL K+ I+++N ++   R  G      +      N I  
Sbjct: 462  NEFCVENLDAYIEIRKFLKQMALLKKIIDSKNNKL--KRKVGRGGQSGN------NIITT 513

Query: 1172 IEAKIDRQFDKFQNIGYSLFAVFIHRG---EASYGH 1204
            IE+ + +Q ++   +GY L+++FI  G   + + GH
Sbjct: 514  IESALGKQANQCLEMGYHLYSLFIMIGAPYQINIGH 549

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E ++          
Sbjct: 393  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWSTYDDEYINKISEKQML-----KEPG 445

Query: 1245 PYFLVYVK 1252
             Y+LVY +
Sbjct: 446  AYYLVYTR 453

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            YSL +V +H G  +YGHY  + K     G W + +DET+  V E EV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRK---YRGYWWRISDETVYIVDETEVL 621

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%)

Query: 686 ILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQ 742
           IL L    TK  +  N+          + +   +    + AGL N GNTC++NS+LQ
Sbjct: 18  ILKLSYPFTKRMYNNNNFFSRKMYNNAINDKKFIKRGGYIAGLVNDGNTCFMNSVLQ 74

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 37/79 (46%), Gaps = 10/79 (12%)

Query: 1188 YSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFT--EGNTAT 1244
            Y L  V IH G    +GHY    ++  K G W  Y+DET+  + E  V  FT   G+  T
Sbjct: 601  YELSGVVIHMGSGPQHGHYVCICRN-EKFG-WLLYDDETVESIKEETVLQFTGHPGDQTT 658

Query: 1245 PYFLVYV-----KQENLNE 1258
             Y L Y      K EN NE
Sbjct: 659  AYVLFYKETQADKTENQNE 677

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAV 764
           G  N GNTCY NS+LQ  + I   R  V  Y + + AV
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERVAAV 172

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 26/116 (22%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINKV 785
            GL N+GNTCY+NS LQ    I   R Y              L  G++K         ++
Sbjct: 321 TGLVNLGNTCYMNSALQCITHIPVFREYF-------------LYSGYEK---------EL 358

Query: 786 EVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQSG 841
             +  + +   + + F+E+I    RC+   K + + A+AP++ +      N + SG
Sbjct: 359 NTDNPLGYQGHVAEAFSELI----RCLFGDKLVQFSAYAPNHFKATIGHFNSMFSG 410

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 725 PAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           P G  N+GNTCYLN+ LQ  + +  +R+ + +Y
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1188 YSLFAVFIHRGEAS-YGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +T V + ++ +   G  +   
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVTAVEKEKIESLAGGGESDSA 490

Query: 1247 FLVYVK 1252
             ++  K
Sbjct: 491  LILMYK 496

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1188 YSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPY 1246
            Y L  V +H G + S GHY V+ K     G W  Y+DE I  + E +V    E N    Y
Sbjct: 587  YQLITVVVHEGRSLSSGHYIVHCKQ--PEGHWATYDDEYINNINEKDVLR--EPNA---Y 639

Query: 1247 FLVYVK 1252
            +LVY +
Sbjct: 640  YLVYTR 645

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 41/91 (45%), Gaps = 6/91 (6%)

Query: 1164 KLYNDIV-NIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKY 1221
            KL+N I    E  +   FD+  +  Y L  + IH G    +GHY    K  T+   W  Y
Sbjct: 571  KLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGAGPQHGHYVAMCK--TEKFGWLLY 628

Query: 1222 NDETITEVPEAEVFNFT--EGNTATPYFLVY 1250
            +DET+  V E +V        + AT Y L Y
Sbjct: 629  DDETVEAVLEKDVLRHVGDSNDLATAYILFY 659

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           G  N GNTCY NS+LQ  +  S LR+ +  Y
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILY 158

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I ++ E ++          
Sbjct: 625  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKITEKQML-----KEPG 677

Query: 1245 PYFLVYVK 1252
             Y+L+Y +
Sbjct: 678  AYYLIYTR 685

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 52/119 (43%), Gaps = 17/119 (14%)

Query: 1130 SSDALEKQGIETENKQMLIDR------LTGALKDIDDEL-------TKLYNDIVNIEAKI 1176
            + DA+++ GI      +++        L G+ + +DD +        K Y  I   E  I
Sbjct: 342  TQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHI 401

Query: 1177 DRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
              +  K  +I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 402  GNK--KVPDIIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 456

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 1185 NIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            +I Y L  +  H G  + GHY  + K   +NG W K+ND  +T++ E +V          
Sbjct: 398  SILYELIGIISHTGSVNEGHYVAFCK--IENGEWFKFNDSMVTKILEKDVLK------EQ 449

Query: 1245 PYFLVYV 1251
             Y L Y+
Sbjct: 450  AYLLFYI 456

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
           +GL N+GNTCY+NS+LQ  F  +  RN
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRN 472

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 39.7 bits (91), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 24/90 (26%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF------------ 1235
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +  V + +VF            
Sbjct: 448  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 506

Query: 1236 -----------NFTEGNTATPYFLVYVKQE 1254
                       N+      + Y LVY++Q+
Sbjct: 507  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQD 536

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 82/188 (43%), Gaps = 26/188 (13%)

Query: 915  RVAKISFDQLENALELG-------RQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIK 967
            +V+ I  D LE     G        Q DV E    ++ +LE+      +E        + 
Sbjct: 259  QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGK------LN 312

Query: 968  KLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYL------ 1021
            ++F G+ K S I   N +   +++E F  L +NV +  K++ ++ D Y   E +      
Sbjct: 313  EIFVGRMK-SYIKCINVDYESSRVEDFWDLQMNVKNF-KNLQESFDNYIEMELMNGENQY 370

Query: 1022 TMDEYG--EVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTET 1079
               +YG  + +K +    FP +L +Q++R  YD       K  +   F ETI +  +   
Sbjct: 371  AAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPF--- 427

Query: 1080 TDADLLKK 1087
             D D+LKK
Sbjct: 428  VDKDVLKK 435

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVEN----CLEDGWDKRRIGGRE 781
            G  N G TCYLNSLLQ YF     R  V +     E+  N     L+  + + ++    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQVSDIP 264

Query: 782 INKVEVERS 790
           ++ +E+ RS
Sbjct: 265 LDTLELTRS 273

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 39.7 bits (91), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 1179 QFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            Q D   N  Y+L  V +H G+ S GHY+  IK   ++  W +++D+ +  V + +VF
Sbjct: 418  QEDSPANAKYNLHGVLVHTGDISTGHYYAMIKPGLEDA-WYRFDDDKVWRVTKKQVF 473

 Score = 35.8 bits (81), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV 754
            GL N G TCYLNSLLQ Y+     R  V
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 218

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 1174 AKIDRQFDKFQNIGYSLFAVFIHRGEASY-GHYWVYIKDFTKNGIWRKYNDETITEV 1229
            A   R+F       Y L+ +  H+G ++  GHY  YI+   ++G W  YNDE I  V
Sbjct: 693  ANAARKFGHPGGSIYKLYGIVCHKGNSTQSGHYVAYIRQ--RDGQWTLYNDEKIVCV 747

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 720 PADNWPAGLNNIGNTCYLNSLLQYYF 745
           P+     GL N+GN+CYLNS+LQ  F
Sbjct: 314 PSKEVGCGLINMGNSCYLNSVLQCLF 339

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            YSL +V +H G  +YGHY  + +     G W + +DET+  V E EV +
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAFRR---YRGYWWRISDETVYIVDETEVLS 699

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 39.3 bits (90), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + +    +G W  Y+DE I ++ E  V    E N   
Sbjct: 605  VKYQLISVVVHEGRSLSSGHYIAHCRQ--PDGSWAIYDDEYINKISERNVLK--EPNA-- 658

Query: 1245 PYFLVYVK 1252
             Y+L+Y +
Sbjct: 659  -YYLIYTR 665

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 39.3 bits (90), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            Y L  V +H G+ S GHY+  IK  T    W +++DE + +V + +VF+
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKP-TLEDQWYRFDDEKVWKVDKKQVFD 488

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV 754
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 232

 Score = 32.3 bits (72), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 82/188 (43%), Gaps = 26/188 (13%)

Query: 915  RVAKISFDQLENALELG-------RQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIK 967
            +V+K   D LE     G        Q DV E    ++ +LE+     ++E        + 
Sbjct: 258  QVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRMKGTNVEGK------LN 311

Query: 968  KLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMD--- 1024
            ++F GK K S I  KN +   +++E F  + +NV +  K + ++ + Y   E +  +   
Sbjct: 312  EIFVGKMK-SYIRCKNVDYESSRVEDFWDIQLNVKNF-KSLQESFENYIEVELMNGENQY 369

Query: 1025 ---EYG--EVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTET 1079
               ++G  +  K +    FP +L +Q++R  YD       K  +   F + I +  Y   
Sbjct: 370  AAPDFGLQDAYKGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPY--- 426

Query: 1080 TDADLLKK 1087
             D +LLKK
Sbjct: 427  MDKELLKK 434

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + + GHY  + K    +G W  Y+DE I ++ E ++          
Sbjct: 646  VKYQLISVVVHEGRSLTSGHYIAHCKQ--PDGSWSTYDDEYINKISERQML-----KEPG 698

Query: 1245 PYFLVYVK 1252
             Y+LVY +
Sbjct: 699  AYYLVYTR 706

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            + Y L +V +H G + S GHY  + K    +G W  Y+DE I  + E +V    E N   
Sbjct: 672  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINIISERDV--LKEPNA-- 725

Query: 1245 PYFLVYVK 1252
             Y+L+Y +
Sbjct: 726  -YYLLYTR 732

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 38.9 bits (89), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 8/71 (11%)

Query: 1181 DKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEG 1240
            D   +I + L  +  HRG  + GHY  + K     G W K+ND  ++ + E E+      
Sbjct: 398  DDVPDIIFELIGIIAHRGTVNEGHYIAFTK--VTTGHWFKFNDSMVSSITEEELLQ---- 451

Query: 1241 NTATPYFLVYV 1251
                 Y L YV
Sbjct: 452  --EQAYLLFYV 460

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 38.9 bits (89), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            Y L  V +H G+ S GHY+  I+    +G W +++D+ + +  + +VF    G    P
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQP-DAHGSWYRFDDDRVIKATDKQVFEENFGKAKLP 487

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 68/155 (43%), Gaps = 15/155 (9%)

Query: 933  QQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIE 992
            Q DV E    ++ +LE      S+E        I +LF GK K S I   N +   +++E
Sbjct: 276  QHDVQELNRILMDRLEHRMKGTSVEGK------INELFVGKMK-SCIKCINVDYESSRVE 328

Query: 993  RFVSLLVNVSDHPKDVYDALDLYFS-------DEYLTMDEYGEVKKSLAVTEFPTILQIQ 1045
             F  + +NV D  K++ ++ + Y         ++Y   D   +  + +    FP +L +Q
Sbjct: 329  DFWDIQLNVKDM-KNLQESFEQYIEVELMNGENQYAAQDHGLQDAQKVVFESFPPVLHLQ 387

Query: 1046 IQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETT 1080
            ++R  YD       K  +   F E+I +  Y ++ 
Sbjct: 388  LKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSA 422

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 74/163 (45%), Gaps = 19/163 (11%)

Query: 933  QQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIE 992
            Q DV E    ++ +LE+      +E        + +LF GK K S I   N +   +++E
Sbjct: 281  QHDVQELNRILMDRLETRMKGTEVE------GALNELFVGKMK-SYIRCINVDYESSRVE 333

Query: 993  RFVSLLVNVSDHPKDVYDALDLYFSDEYL------TMDEYG--EVKKSLAVTEFPTILQI 1044
             F  + +NV +  K V ++ D Y   E +         +YG  + KK +    FP++L +
Sbjct: 334  DFWDIQLNVKN-LKGVQESFDNYVEVEIMDGENQYAAQDYGLQDAKKGVVFESFPSVLHL 392

Query: 1045 QIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKK 1087
            Q++R  YD       K  +   F ETI +  Y    D D+LKK
Sbjct: 393  QLKRFEYDFNYDQLVKINDRYEFPETIDLSPY---LDPDVLKK 432

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            Y+L  V +H GE S GHY+  IK    +  W +++D+ +  V + + F+   G+   P
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDVGDQ-WFRFDDDKVWRVTKEQAFDENFGHEPLP 495

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 17/28 (60%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYV 754
           GL N G TCYLNSLLQ YF     R  V
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV 230

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV----ADYQKTLEAVENCLEDGWDKRRIGGRE 781
            G  N G TCYLNSLLQ YF     R  V     D +K  ++V   L+  + + ++    
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTDEEKPNDSVPLALQRAFYQLQVSNLP 268

Query: 782 INKVEVERSVQFVYQLRDLFNE 803
           ++ +E+ RS  F +   D F +
Sbjct: 269 LDTLELTRS--FGWDSADAFTQ 288

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 39/95 (41%), Gaps = 24/95 (25%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP-- 1245
            Y L  V +H G+ S GHY+  IK    +  W +++DE + +V   +VF+   G    P  
Sbjct: 448  YKLHGVLVHTGDISTGHYYTMIKPDLGDQ-WYRFDDERVWKVDRKQVFDENFGLDKLPDS 506

Query: 1246 ---------------------YFLVYVKQENLNEI 1259
                                 Y LVYVK E   EI
Sbjct: 507  ELRGMTKEEYQSYLITRHTSAYMLVYVKDEVEEEI 541

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 82/195 (42%), Gaps = 32/195 (16%)

Query: 915  RVAKISFDQLENALELG-------RQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIK 967
            +V+ +  D LE     G        Q DV E    ++ +LE+      +E        + 
Sbjct: 263  QVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMKGTKVEGK------LS 316

Query: 968  KLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPK-----------DVYDALDLYF 1016
            +LF GK K S I  KN +   +++E F  + +NV D              ++ D  + Y 
Sbjct: 317  ELFVGKMK-SYIKCKNVDYESSRVEEFWDIQLNVKDLKNLQQSFENYIEVELMDGENQYA 375

Query: 1017 SDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRY 1076
            + ++   D Y    K +    FP +L +Q++R  YD       K  +   F ++I +  Y
Sbjct: 376  APDFGLQDAY----KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPY 431

Query: 1077 TETTDADLLKKKDET 1091
                D D+LK ++ET
Sbjct: 432  ---LDKDVLKNENET 443

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+GNTCY+NS+LQ  F  +  RN
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRN 779

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 1184 QNIG---YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            QN G   Y L  V +H G+ S GHY+  IK  TK+  W +++D+ +    + ++F+
Sbjct: 433  QNPGPKIYKLHGVLVHTGDISTGHYYTLIKPSTKDE-WYRFDDDRVWRATKKQIFD 487

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 32/70 (45%), Gaps = 5/70 (7%)

Query: 1186 IGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFT--EGNT 1242
            I Y L  + IH G+    GHY    K  T+   W  Y+DET+  V E  V  F   E   
Sbjct: 563  IKYELSGIVIHVGDGPQMGHYVALCK--TEKYGWLFYDDETVESVSEETVLKFIGDEKTQ 620

Query: 1243 ATPYFLVYVK 1252
            +T Y L Y K
Sbjct: 621  STAYVLFYKK 630

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 1182 KFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            K  +I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 407  KVPDIIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 458

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            Y L ++  H+G  + GHY V +K    +G W K+ND  ++ + E E  
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVK--VNDGQWFKFNDSMVSAITEEEAL 478

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 1182 KFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            K  +I Y L  +  H+G  + GHY  + K     G W K+ND  ++ + + EV 
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 456

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            Y L  V +H G+ S GHY+  IK   ++  W +++D+ +  V + +VF    G+   P
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIEDQ-WYRFDDDKVWRVTKNQVFEENFGHVRLP 499

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV 754
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV 234

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 24/99 (24%)

Query: 1184 QNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTA 1243
            ++  Y+L  V +H G+ S GHY+  IK   ++  W +++DE + +V + +VF    G   
Sbjct: 440  ESCKYTLHGVLVHTGDISTGHYYAMIKPDLQDQ-WYRFDDEKVWKVTKKQVFEENFGMNK 498

Query: 1244 TP-----------------------YFLVYVKQENLNEI 1259
             P                       Y LVY++++   E+
Sbjct: 499  LPEEEIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEV 537

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV 754
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 235

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 29/125 (23%)

Query: 1149 DRLTGALKDIDDELT----------------KLYNDI-----VNIEAKIDRQFDKFQNIG 1187
            +RL G LK + D LT                KL+N+I     +N+ + I+ +  +     
Sbjct: 547  ERLVG-LKQLPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVCSSINSKVCQ----K 601

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFT--EGNTATP 1245
            Y L  + +H G      ++V +    K G W  ++DET+  V E  V  FT    N AT 
Sbjct: 602  YELAGIVVHMGGGPQHGHYVSLCKHEKFG-WLLFDDETVEAVKEETVLEFTGESPNMATA 660

Query: 1246 YFLVY 1250
            Y L Y
Sbjct: 661  YVLFY 665

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADYQK 759
           G  N GNTCY NS+LQ  + +S LR  +  + K
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPK 173

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE + +V + +VF
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLEDQ-WYRFDDEKVWKVTKKQVF 484

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 675 WTSDSVIDADEILSLKSVLTKIAFERNSKL-ISSYLE-----TGVVNPGCLPADNWPA-- 726
           W   +++D +  L   S  +K  + ++ KL IS+Y+      TGV+    +  D+     
Sbjct: 141 WGFANLLDLNH-LKYPSRNSKSGYLKDGKLHISAYVRILKDTTGVLWHNFMNYDSKKVTG 199

Query: 727 --GLNNIGNTCYLNSLLQYYFCISPLRNYV 754
             G  N G TCYLNSLLQ YF     R  V
Sbjct: 200 YVGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 24/94 (25%)

Query: 1184 QNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF-------- 1235
            +++ Y+L  V +H G+ S GHY+  IK    +  W +++D+ + +V + +VF        
Sbjct: 432  ESMMYNLHGVLVHTGDISTGHYYAMIKPGLDDK-WYRFDDDKVWQVTKKQVFEQNFGFDR 490

Query: 1236 ---------------NFTEGNTATPYFLVYVKQE 1254
                           N+      + Y LVY+K++
Sbjct: 491  LPEYELRSLSKEQYQNYLIARQTSAYMLVYIKED 524

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV----ADYQKTLEAVENCLEDGWDKRRIGGRE 781
            GL N G TCYLNSLLQ Y+     R  V     D +    +V   L+  + K +     
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLVYHIPTDGETPSNSVPLALQRAFYKLQRSSEP 258

Query: 782 INKVEVERSVQFVYQLRDLFNE 803
           ++  E+ RS  F +   D F +
Sbjct: 259 LDTFELTRS--FGWDTGDAFTQ 278

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 11/87 (12%)

Query: 667 ILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPA 726
           I ++F+ R    +   +D ++ +K +      E N    S+Y     + P      +   
Sbjct: 316 IPDMFENRLDKITSNPSDLVIEIKPI------EGNHHWPSNYFAYNKLEPA-----SGTT 364

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL N+GNTCY+NS LQ    I  LR+Y
Sbjct: 365 GLVNLGNTCYMNSALQCLVHIPQLRDY 391

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITE-VPEAEVFNFTEGNTATPY 1246
            Y L+AV  H G    GHY  Y+K+F  N  W  ++D  +TE  PE  +         + Y
Sbjct: 1052 YDLYAVDNHYGGLGGGHYTAYVKNFADNK-WYYFDDSRVTETAPENSI-------AGSAY 1103

Query: 1247 FLVYVKQ 1253
             L Y+++
Sbjct: 1104 LLFYIRR 1110

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 701 NSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNY 753
           N    S+Y     + PG     +   GL N+GNTCY+NS LQ    I  LR+Y
Sbjct: 344 NCHWASNYFAYNKLEPG-----SGTTGLVNLGNTCYMNSALQCLVHIPQLRDY 391

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 9/67 (13%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITE-VPEAEVFNFTEGNTATPY 1246
            Y L+AV  H G    GHY  Y+K+F  +  W  ++D  +TE VPE  +       + + Y
Sbjct: 1054 YDLYAVDNHYGGLGGGHYTAYVKNFA-DSKWYYFDDSRVTETVPENSI-------SGSAY 1105

Query: 1247 FLVYVKQ 1253
             L Y+++
Sbjct: 1106 LLFYIRR 1112

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           GL N GNTCY NS+LQ  F +S LR  +  Y
Sbjct: 134 GLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 44/100 (44%), Gaps = 8/100 (8%)

Query: 1164 KLYNDIV-NIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKY 1221
            KL+N I   ++ K+  + D      Y L  + IH G    +GHY    K       W  Y
Sbjct: 612  KLFNKIYYPLKLKVCTKSDTIVCKNYELNGIVIHMGGGPQHGHYVAICKHDMFG--WLLY 669

Query: 1222 NDETITEVPEAEVFNFT--EGNTATPYFLVY--VKQENLN 1257
            +DET+  + E  VF F   E +  T Y L +  V   N+N
Sbjct: 670  DDETVESIDEETVFKFVGDEKDMTTAYVLFFKEVDPNNIN 709

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 20/92 (21%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV--ADYQKTLEAVENCLEDGWDKRRIGGREIN 783
            GL N+GNTCY+NS++Q  F     R     A+Y+  L+  +            G R  +
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK------------GSRSAH 648

Query: 784 KVEVERSVQFVYQLRDLFNEMIHSSSRCVTPT 815
             ++  S+        LFN+M  +    V PT
Sbjct: 649 SSKLSNSLNM------LFNKMYLNGGCSVVPT 674

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL+N+GNTCY+NS LQ    I  LR+Y
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDY 350

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 14/95 (14%)

Query: 1164 KLYNDI-----VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGI 1217
            KL+N+I     +N+ + I+ +  +     Y L  + +H G    +GHY V +    K G 
Sbjct: 580  KLFNNIRYPLTLNVCSSINSEVCQ----KYQLAGIVVHMGGGPQHGHY-VSLCKHEKFG- 633

Query: 1218 WRKYNDETITEVPEAEVFNFT--EGNTATPYFLVY 1250
            W  ++DET+  V E  V  FT    N AT Y L Y
Sbjct: 634  WLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 668

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY-QKTLEA 763
           G  N GNTCY NS+LQ  + +S LR  +  + +K +E+
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPEKPIES 179

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 43/95 (45%), Gaps = 14/95 (14%)

Query: 1164 KLYNDI-----VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGI 1217
            KL+NDI     +N+ + I+ +  +     Y L  + +H G    +GHY    K       
Sbjct: 579  KLFNDIHYPLTLNVCSSINSEVCQ----KYELSGIVVHMGGGPQHGHYVSLCKHEIFG-- 632

Query: 1218 WRKYNDETITEVPEAEVFNFT--EGNTATPYFLVY 1250
            W  ++DET+  V E  V  FT    N AT Y L Y
Sbjct: 633  WLLFDDETVEAVKEEAVLEFTGESPNMATAYVLFY 667

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           G  N GNTCY NS+LQ  + +S +R  +  +
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQF 172

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%)

Query: 719 LPADN-WPAGLNNIGNTCYLNSLLQYYF 745
           LPA   +  GLNN+GN+CY+NS+LQ  F
Sbjct: 305 LPASKEYGCGLNNLGNSCYMNSVLQVLF 332

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 1163 TKLYNDI-VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRK 1220
            +KL+N I   +   +   FD      Y L  V +H G + ++GHY V I    K G W  
Sbjct: 557  SKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVLHVGASPTHGHY-VSICKHEKYG-WLM 614

Query: 1221 YNDETITEVPEAEVFNFT--EGNTATPYFLVY 1250
            Y+DETI  +PE  V +      N  T Y L Y
Sbjct: 615  YDDETIESIPEEAVTSHVGEPNNPITAYVLFY 646

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+GNTCY+NS++Q  F     RN
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFRN 717

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNY 753
            GL N+GNTCY+NS LQ    I  LR+Y
Sbjct: 302 TGLTNLGNTCYMNSALQCLVHIPELRDY 329

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 13/82 (15%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEV-PEAEVFNFTEGNTATPY 1246
            Y L AV  H G    GHY  Y+K    N  W  ++D  +TE  PE+ +         + Y
Sbjct: 959  YDLIAVDNHFGGLGGGHYTAYVK---TNDKWFYFDDSRVTETKPESSI-------AGSAY 1008

Query: 1247 FLVYVKQENLNEI--EPLKRIV 1266
             L Y+++    +I  E L+ I+
Sbjct: 1009 LLFYLRRTESGKIGSERLQSII 1030

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245
            Y+L  V +H G+ S GHY+  IK    +  W +++D+ + +V + + F+   G+   P
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNVTDQ-WFRFDDDKVWKVTKTQAFDENFGHDNLP 495

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 16/28 (57%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYV 754
           G  N G TCYLNSLLQ YF     R  V
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV 230

 Score = 33.1 bits (74), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 16/128 (12%)

Query: 933  QQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIE 992
            Q DV E    ++ +LE+      +E        +  LF GK K S I   N +    ++E
Sbjct: 281  QHDVQELNRILMDRLETRMKGTEVE------GTLNDLFVGKMK-SYIRCVNVDYESFRVE 333

Query: 993  RFVSLLVNVSDHPKDVYDALDLYFSDEYL------TMDEYG--EVKKSLAVTEFPTILQI 1044
             F  + +NV +  KDV ++ + Y   E +         +YG  + KK +    FP +L +
Sbjct: 334  DFWDIQLNVKN-LKDVKESFENYVEVEMMDGENQYAAQDYGLQDAKKGVVFESFPPVLHL 392

Query: 1045 QIQRVYYD 1052
            Q++R  YD
Sbjct: 393  QLKRFEYD 400

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 726  AGLNNIGNTCYLNSLLQYYFCISPLRN 752
             GL N+ NTCY+NS+LQ  F  S  RN
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRN 1131

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+GNTCY+NS+LQ  F  +  R+
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFRD 634

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP-- 1245
            Y L  V +H G+ S GHY+  IK   ++  W +++DE + +V + + F+   G    P  
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLEDQ-WYRFDDERVWKVSKKQAFDENFGFDRLPDD 498

Query: 1246 ---------------------YFLVYVKQENLNEI 1259
                                 Y LVY++++  +EI
Sbjct: 499  KIRTMTREQYQEYFIARHTSAYMLVYIQEDKKDEI 533

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV 754
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 18/100 (18%)

Query: 609 IDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNENAADDTIL 668
           IDC   ++ +   KR+M L        P +   + P+ Y         QV   + D TI 
Sbjct: 329 IDCKGLVWDIRSGKRAMSLSG---HTKPIYSLDWSPNGY---------QVATGSGDGTI- 375

Query: 669 EIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSK-LISS 707
               R W      +   IL+ KS++TK+AFE+N   L+SS
Sbjct: 376 ----RIWDLRKPEEYQTILAHKSIVTKVAFEKNGNCLVSS 411

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 1164 KLYNDIV-NIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKY 1221
            KL+N I   +  ++  +FD   +  Y L  V +H G    +GHY    K  T N  W  +
Sbjct: 570  KLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGGPQHGHYVSVCK--TDNFGWLFF 627

Query: 1222 NDETITEVPEAEVFNF 1237
            +DET+  + E +V NF
Sbjct: 628  DDETVETLDEPQVLNF 643

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           G  N GNTCY NS+LQ  F ++  RN +  +
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQF 145

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+GNTCY+NS+LQ  F  S  R+
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRD 614

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 720 PADNWPAGLNNIGNTCYLNSLLQYYF 745
           P  N+  GL N+GN+CYLNS+LQ  F
Sbjct: 313 PNGNFGCGLINLGNSCYLNSILQALF 338

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVEN----CLEDGWDKRRIGGRE 781
            G  N G TCYLNSLLQ YF     R  V +    +++  N     L+  + + ++    
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYEIPTDMDSPNNSVPLALQRAFYQLQVSNEP 262

Query: 782 INKVEVERS 790
           ++ +E+ RS
Sbjct: 263 LDTLELTRS 271

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            Y+L  V +H G+ S GHY+  I+    +  W +++D+ +  V + + F+
Sbjct: 441  YNLHGVLVHAGDISTGHYYTMIRPGVSDE-WYRFDDDKVWRVTKKQAFD 488

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 59/140 (42%), Gaps = 8/140 (5%)

Query: 966  IKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVS-----DHPKDVYDALDLYFSDEY 1020
            + +LF GK K S I   N +   +++E F  L +NV      +     Y  ++L   +  
Sbjct: 309  LNELFVGKMK-SYIKCINVDYESSRVEDFWDLQLNVKNLKGLEESFSNYIEIELMNGENQ 367

Query: 1021 LTMDEYG--EVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTE 1078
                +YG  + +K +    FP +L +Q++R  YD       K  +   F ETI +  Y E
Sbjct: 368  YAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIE 427

Query: 1079 TTDADLLKKKDETFELKKQL 1098
                 L  K+   + L   L
Sbjct: 428  KGSEQLSNKEACIYNLHGVL 447

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            I Y L  +  H+G  + GHY    K     G W K+ND  +T V E +V 
Sbjct: 392  IVYELIGLISHQGSVNQGHYTSICK--IPGGQWFKFNDSMVTAVAEIDVL 439

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL+N+GN+CY+NS LQ    I  LR+Y
Sbjct: 299 GLSNLGNSCYMNSALQCLVHIPELRDY 325

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 1181 DKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEG 1240
            D  QN  Y L AV  H G    GHY  Y+K+F  +G W  ++D  ++E  EAE       
Sbjct: 955  DPNQNSMYDLIAVDNHYGGLGGGHYTAYVKNFM-DGKWYYFDDSRVSET-EAE-----RA 1007

Query: 1241 NTATPYFLVYVKQ 1253
             +   Y L Y ++
Sbjct: 1008 ISGAAYLLFYRRR 1020

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNY 753
            GL+N+GNTCY+NS LQ    I  LR+Y
Sbjct: 289 VGLSNLGNTCYMNSGLQCLVHIPKLRDY 316

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+GNTCY+N +LQ  F  + L+N
Sbjct: 648 TGLRNLGNTCYINCMLQSLFATNELKN 674

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
            YBR058C (REAL)
          Length = 782

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 8/62 (12%)

Query: 1173 EAKIDRQFDKFQNIGYS------LFAVFIHRGEASY-GHYWVYIKDFTKNGI-WRKYNDE 1224
            E    RQ  K +++GYS      L AV  H+G +++ GHY V+I+        W  YNDE
Sbjct: 700  EGPTGRQQRKQKDLGYSTSRPYALTAVVCHKGNSAHSGHYVVFIRKLVAGEWKWVLYNDE 759

Query: 1225 TI 1226
             +
Sbjct: 760  KL 761

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%)

Query: 719 LPADNWPAGLNNIGNTCYLNSLLQ 742
           LP  ++  GL N+GN+CYLNS+LQ
Sbjct: 316 LPNKDYGCGLINLGNSCYLNSVLQ 339

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNY 753
            GL N+GNTCY+NS LQ    I  LR+Y
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDY 391

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 9/67 (13%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITE-VPEAEVFNFTEGNTATPY 1246
            Y L+AV  H G    GHY  Y+K+F  N  W  ++D  +TE VPE  +         + Y
Sbjct: 1048 YDLYAVDNHYGGLGGGHYTAYVKNFANNK-WYYFDDSRVTETVPENSI-------AGSAY 1099

Query: 1247 FLVYVKQ 1253
             L Y+++
Sbjct: 1100 LLFYIRR 1106

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 81/188 (43%), Gaps = 41/188 (21%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINKV 785
            GL N+G+TCY+NS+LQ  F     R+             + +  G+         I++ 
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-----PKYHDYISKGY---------IHRA 658

Query: 786 EVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPNELQSGNGED 845
           ++ RS         LF +M  +    V P+  L     A +++  +F  PN+ Q     D
Sbjct: 659 QISRSFHM------LFKKMYMNGGCSVVPSGFLK----ACNSMRPDFKIPNDQQ-----D 703

Query: 846 VDGDIVF----IDEDISEPKGKS------LVLDEENSKVENSPENQLIEIDDSSDSSGHK 895
               ++F    + +++S+P+  +      L+ D++N +V+    ++  E  DS   +G  
Sbjct: 704 TQEFLLFLLDQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFE--DSISKNGLS 761

Query: 896 KVEEISQN 903
            ++ I Q 
Sbjct: 762 PIDSIFQG 769

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+GNTCY++S+LQ  F  + LR+
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLRD 651

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (53%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVE 765
           GL N GNTCY NS+LQ  + +  LR  V  Y    E  E
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKYPTRAEPTE 138

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 6/91 (6%)

Query: 1164 KLYNDI-VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKY 1221
            KL+N I   +  ++   FD      Y L  + IH G    +GHY    K       W  Y
Sbjct: 567  KLFNVIHYPLNLRVCSTFDHAVCKDYELNGIVIHMGGGPQHGHYVAICKHELFG--WLLY 624

Query: 1222 NDETITEVPEAEVFNFTE--GNTATPYFLVY 1250
            +DET+  V E  V  F     +  T Y L Y
Sbjct: 625  DDETVESVGEDAVLRFIGDVNDMTTAYVLFY 655

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 11/87 (12%)

Query: 667 ILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADNWPA 726
           I ++F+ R    +   +D ++ +K V      E N   +S++     + P      +   
Sbjct: 313 IPDMFENRLDMITSNPSDLVIEVKPV------EGNHHWVSNHFVYNKLEPA-----SGTT 361

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL N+GNTCY+NS LQ    +  LR+Y
Sbjct: 362 GLVNLGNTCYMNSALQCLVHLPQLRDY 388

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 9/67 (13%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITE-VPEAEVFNFTEGNTATPY 1246
            Y L+AV  H G    GHY  Y+K+F  N  W  ++D  +TE VPE  V         + Y
Sbjct: 1051 YDLYAVDNHYGGLGGGHYTAYVKNFMDNK-WYYFDDSRVTETVPENSV-------AGSAY 1102

Query: 1247 FLVYVKQ 1253
             L Y+++
Sbjct: 1103 LLFYIRR 1109

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRN 752
           GL N+GNTCY+NS+LQ  F     R+
Sbjct: 557 GLRNMGNTCYINSMLQCLFATRKFRD 582

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 15/48 (31%)

Query: 721 ADNWPA---------------GLNNIGNTCYLNSLLQYYFCISPLRNY 753
            D+WP+               GL+N+GN+CY+NS LQ    I  L++Y
Sbjct: 314 GDHWPSNHFYYNKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDY 361

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV--ADYQKTLEAV 764
            GL N+GNTCY+NS++Q  F     R     ++Y+  LE +
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPL 638

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
            Anc_3.270 YBR058C
          Length = 785

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 1180 FDKFQNIGYSLFAVFIHRGEASY-GHYWVYIKDFTKNGI-WRKYNDETI 1226
            +    ++ Y L AV  H+G++++ GHY  +I+      + W  YNDE I
Sbjct: 713  YGNLNHVPYKLTAVVCHKGQSAHSGHYVAFIRKIVDGKLSWVLYNDEKI 761

 Score = 35.8 bits (81), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%)

Query: 721 ADNWPAGLNNIGNTCYLNSLLQYYF 745
            D++  GL N+GN+CYLNS+LQ ++
Sbjct: 321 GDDFGVGLINLGNSCYLNSILQCFY 345

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL+N+GNTCY+NS LQ    I  +R+Y
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDY 348

 Score = 32.7 bits (73), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 11/82 (13%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEV-PEAEVFNFTEGNTATPY 1246
            Y L AV  H G    GHY  Y+K+ T    W  ++D  +++  PE  +         + Y
Sbjct: 983  YDLIAVDNHYGGMGGGHYTAYVKNLTDQN-WYYFDDSRVSKTSPEKSI-------AGSAY 1034

Query: 1247 FLVYVKQENLNEIEP--LKRIV 1266
             L Y+++ +LN I+   LK I+
Sbjct: 1035 LLFYLRRGSLNNIDSKRLKDII 1056

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 10/68 (14%)

Query: 1185 NIGYSLFAVFIHRGEASYGHYWVYIKDFTKNG-IWRKYNDETITEVPEAEVFNFTEGNTA 1243
            N+ Y L A+  H G    GHY    +    NG IW K+ND  +T + E ++         
Sbjct: 406  NMMYKLSAIISHHGTVHQGHYTTICR---INGDIWAKFNDSMVTVISEEDMLK------E 456

Query: 1244 TPYFLVYV 1251
              Y L YV
Sbjct: 457  QAYLLYYV 464

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 8/67 (11%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYF 1247
            Y L AV  H G  + GHY    K     G W ++ND  I  + E E            Y 
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCK--IPGGQWFRFNDSMIVSISEEEALR------QQAYL 445

Query: 1248 LVYVKQE 1254
            L YV ++
Sbjct: 446  LFYVIRQ 452

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 36.2 bits (82), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+GNTCY+NS+LQ  F     R+
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRD 634

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 36.2 bits (82), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL+N+GNTCY+NS LQ    I   ++Y
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDY 373

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 721 ADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           + N   G  N GNTCY NS+LQ  + I  LR+ V  Y
Sbjct: 107 SSNKVFGYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YDR069C (DOA4) and YER144C
            (UBP5)
          Length = 848

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 85/215 (39%), Gaps = 33/215 (15%)

Query: 1043 QIQIQRVYYDRERFMPFKSIE-PLPFSETIYM-DRYTETTDADLLKKKDETFELKKQLS- 1099
            Q+Q +        + PF  +  P+P + T  + D +TE T       K ET E ++Q S 
Sbjct: 660  QLQCKVCQRTSTTYQPFSVLSVPVPSTRTCTLTDCFTEFT-------KIETLEQEEQWSC 712

Query: 1100 -EMRKRQKELLSRNELGLSR--KEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALK 1156
               +KRQ    S  ++ ++R  +   +  ++F   + L K  +      +L D       
Sbjct: 713  PSCKKRQP---STKKITITRLPRNLIIHLKRF--DNMLNKNNVFVSYPSVL-DLTAFWAN 766

Query: 1157 DIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNG 1216
            D D ++T       N+E     Q   F    Y L+ +  H G    GHY  Y+      G
Sbjct: 767  DYDKKVTN-----NNVELPSRGQVPPF---NYQLYGIACHDGTLRAGHYTAYVNKGAVLG 818

Query: 1217 IWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYV 1251
             W  Y+D    ++  A  +    G     Y L+Y+
Sbjct: 819  -WCYYDDTNWRQIRSAREYIIQNG-----YVLLYI 847

>KLLA0D08030g Chr4 (685876..687540) [1665 bp, 554 aa] {ON} weakly
            similar to uniprot|Q02100 Saccharomyces cerevisiae
            YNL167C SKO1
          Length = 554

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 43/93 (46%), Gaps = 7/93 (7%)

Query: 1067 FSETIY-MDRYTETTDADLLKKKDETFELKK-QLSEMRKRQKELLSRNELGLSRKEAFME 1124
             SET Y +D Y   TDAD  +K+ E  E  +   S  RKR+KE + R E  +S    F E
Sbjct: 416  HSETPYDIDSYPGDTDADRARKRKEFLERNRIAASRFRKRKKEYIKRIEADVS----FYE 471

Query: 1125 TR-KFLSSDALEKQGIETENKQMLIDRLTGALK 1156
            +    LS+      GI   N  M    L  +LK
Sbjct: 472  SEYNDLSACLASLTGISPHNNSMGNPSLINSLK 504

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            Y L +V +H G  +YGHY +  + F   G W + +DE++  V E EV +
Sbjct: 681  YVLRSVIVHYGTHNYGHY-IAFRRF--RGCWWRISDESVYIVDEQEVLS 726

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLR 751
            GL N+GNTCY+NS++Q  F     R
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFR 634

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+ NTCY+NS+LQ  F  +  RN
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRN 772

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 723 NWPAGLNNIGNTCYLNSLLQYYFCISPLRNY 753
           N   GL N+GNTCY+NS LQ    I   ++Y
Sbjct: 346 NGTVGLGNLGNTCYMNSALQCLVHIPEFKDY 376

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+GNTCY+NS+LQ  F     R+
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFRD 704

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
            YDR069C
          Length = 1144

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 77/177 (43%), Gaps = 30/177 (16%)

Query: 1064 PLPFSETIYM-DRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSR--KE 1120
            P+P +++I++ D + E T  + L K DE +      +E +K+Q    S   L ++R  K 
Sbjct: 930  PVPKNKSIHLLDCFNEFTKTEFLGK-DELWSC----TECKKKQP---STKTLTITRLPKN 981

Query: 1121 AFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQF 1180
              +  ++F   + L K  +  +   +++D       D D +L       V  E     Q 
Sbjct: 982  LIIHLKRF--DNMLHKNNVFVK-YPLILDLTNYWANDFDGKLPPG----VTEELPARGQI 1034

Query: 1181 DKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNG-------IWR--KYNDETITE 1228
              F+   Y L  V +H G    GHY  Y+    KNG       ++R  KY+ E IT+
Sbjct: 1035 PPFK---YELSGVALHMGSLYGGHYTAYVNKGLKNGWYYFDDTVYRSIKYSSEMITQ 1088

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL N+GNTCY+NS LQ    I   R+Y
Sbjct: 331 GLTNLGNTCYMNSALQCITHIPIFRDY 357

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLR 751
            GL N+GNTCY+NS++Q  F     R
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
            Anc_8.188 YDR069C
          Length = 671

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 7/70 (10%)

Query: 1185 NIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            ++ Y L AV  H G    GHY  Y    ++NG W  ++D     V   E        + +
Sbjct: 609  DVPYKLVAVACHTGTLFSGHYTAYCFKNSENG-WYHFDDTQCKPVSNGECI------SQS 661

Query: 1245 PYFLVYVKQE 1254
             Y L Y KQ+
Sbjct: 662  AYLLFYQKQQ 671

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            I Y L  V  H G  + GHY   +K  + N  W K+ND  +T + E EV 
Sbjct: 378  IIYELNGVISHIGTVNEGHYIATLKLDSNN--WFKFNDSMVTSISEEEVL 425

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 1185 NIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVF 1235
            +I Y L  +  H G  + GHY V +K    +G W K+ND  I+ + E E  
Sbjct: 403  DIIYELTGILSHIGSINEGHYVVVLK--INDGRWFKFNDSMISVIKEDEAL 451

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 81/190 (42%), Gaps = 36/190 (18%)

Query: 933  QQDVTECIGNVLFQL------ESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNE 986
            QQD  E +   L QL      +S+ N    E+++    +   +F G+ K SI+  +  N+
Sbjct: 241  QQDAHEFLQYFLNQLHQDYKRDSSHN----EQENNCPCVAHSIFQGELKSSIVCPECQND 296

Query: 987  IRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVK--------KSLAVTEF 1038
             +  I+ F+ L +++ D   D+Y  LD +   E L    Y   +        K   + + 
Sbjct: 297  SKTIIDPFMDLSLDIKD-KTDLYQCLDSFHKKEKLHDFNYHCSRCNTSLDPIKQFTINKL 355

Query: 1039 PTILQIQIQRVYYDRERFMPFKSIE-------PLPFSETIYMDRYTETTDADLLKKKDET 1091
            P +L +Q++R     E F+   +++       PL  +   Y DR T     D++      
Sbjct: 356  PPMLVLQLKRF----EHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDII------ 405

Query: 1092 FELKKQLSEM 1101
            +EL   LS +
Sbjct: 406  YELTGILSHI 415

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL+N+GNTCY+NS LQ    I  L  Y
Sbjct: 340 GLSNLGNTCYMNSALQCLLHIPELNEY 366

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           G  N GNTCY NS+LQ  + +  LR ++ +Y
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
            YDR069C
          Length = 986

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 6/63 (9%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYF 1247
            Y L+ V  H G    GHY  Y+    KNG W  ++D +   +      N  E  T++ Y 
Sbjct: 922  YKLYGVACHFGSLYGGHYTAYVDKGIKNG-WYYFDDTSCRPIK-----NSMEPITSSAYV 975

Query: 1248 LVY 1250
            L Y
Sbjct: 976  LFY 978

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEA 763
           GL N GNTCY NS+LQ  + ++  R  +     +++A
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILGLTPSIDA 168

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRN 752
           G+ N+GNTCY+NS+LQ  F  +  R+
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRD 239

>TBLA0A03320 Chr1 (793330..797115) [3786 bp, 1261 aa] {ON} Anc_5.386
            YDR335W
          Length = 1261

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 9/105 (8%)

Query: 952  NPISLEEDDEQYDLIKKL--FYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVY 1009
            NPI +E D+ +Y ++KK           +  +KNNN   N+IE++++L++  + +P  + 
Sbjct: 325  NPI-VEIDEIKYPIVKKFVDMISCLYVCVFKIKNNN---NQIEKYLNLILRATKNPSLIV 380

Query: 1010 DALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRE 1054
              L L      L  DE+    K+L +   P +LQ     + Y  E
Sbjct: 381  SGLTLDLWCSCLRTDEFLPYLKNLVI---PELLQFSADSLIYYEE 422

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL NIG TCY+NS+LQ  F     R+
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRD 582

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY 753
           GL N+G+TC++NS+LQ    I+ LR+Y
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDY 378

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 1172 IEAKIDRQFDKFQNIGYSLFAVFIHRGEA-SYGHYWVYIKDFTKNGIWRKYNDETITEVP 1230
            ++ K+   F+   +  Y L  + +H G    +GHY    K+  K G W  ++DET+  + 
Sbjct: 597  LDLKVSSTFNPSISKNYELSGIVVHMGGGPQHGHYISLCKN-EKFG-WLLFDDETVEAIS 654

Query: 1231 EAEVFNFT--EGNTATPYFLVY 1250
            E  V  +T  +    T Y L Y
Sbjct: 655  EQAVLQYTGDKDTMTTAYVLFY 676

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADY 757
           G  N GNTCY NS+LQ  + +   RN +  Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 8/116 (6%)

Query: 1142 ENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEAS 1201
            +N  +  +   G ++ I  ++   +  I+ IE+       K +N  Y L  V  H G +S
Sbjct: 713  DNSMVNYNAYNGRIEKIRKKINYEHELIIPIESISSANAYKDENRRYHLTGVIYHHGVSS 772

Query: 1202 -YGHYW--VYIKDFTKNGIWRKYNDETITEVPEAEVFNFTE--GNTATPYFLVYVK 1252
              GHY   VY ++  K   W + +D +I E+ + +V    E  G++ T Y L+Y K
Sbjct: 773  DGGHYTADVYHRESDK---WYRIDDVSIIELEKEDVLKGGEESGDSRTAYILMYQK 825

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 5/37 (13%)

Query: 721 ADNWP-----AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            DN P      GL N GNTCY+NS++Q  F    LR+
Sbjct: 228 TDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRD 264

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFN 1236
            Y L  V  H+G  + GHY    K   +   W K+ND  ++ V + E  N
Sbjct: 403  YELIGVVAHKGTVNEGHYVATTKVAGRQ--WFKFNDSMVSSVTQEEALN 449

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 65/151 (43%), Gaps = 16/151 (10%)

Query: 945  FQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDH 1004
            FQ+ S         DD    +    F G  K SI+     N+ +  I+ F+ L +++ D 
Sbjct: 251  FQVCSGKGVNDAISDDLCTCIAHSTFQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDIKD- 309

Query: 1005 PKDVYDALDLYFSDEYLTMDEYG--------EVKKSLAVTEFPTILQIQIQRVYYDRERF 1056
              ++Y+ LD +   E L    Y         +  K L++ + P++L +Q++R     E  
Sbjct: 310  KSNLYNCLDSFHKKERLHDFNYHCPNCNTSQDAIKRLSIYKLPSVLVLQLKRF----EHL 365

Query: 1057 MPFKSIEPLPFSE---TIYMDRYTETTDADL 1084
            +   S++   F E    + M  Y  + D+D+
Sbjct: 366  LNGNSLKLNDFIEYPPYLNMRDYCSSGDSDV 396

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752
            GL N+G TCY+NS+LQ  F  +  R+
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFRD 625

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 681 IDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPADN-WPAGLNNIGNTCYLNS 739
           I+  E ++ +  L ++  E+N       +++       LPA N +  GL N+GN+CYLNS
Sbjct: 277 INIQEKIADEKTLVQLQIEQNENWQFKMVDSSGKELKKLPASNEYGCGLINLGNSCYLNS 336

Query: 740 LLQ 742
           ++Q
Sbjct: 337 VMQ 339

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 27/67 (40%), Gaps = 8/67 (11%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYF 1247
            Y L AV    G  + GHY    K     G W ++ND  I  + E +V           Y 
Sbjct: 393  YELVAVISQEGSVNQGHYTCMCK--VPGGQWFRFNDTMIVSITEEDVLR------QQAYL 444

Query: 1248 LVYVKQE 1254
            L YV ++
Sbjct: 445  LFYVIRQ 451

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 28/70 (40%), Gaps = 8/70 (11%)

Query: 1185 NIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTAT 1244
            +I Y L  V  H G  + GHY    K    N  W K+ND  IT V    V          
Sbjct: 400  DIIYELIGVICHTGTVNEGHYICSCK--LANNQWVKFNDSMITIVDNETVLK------EQ 451

Query: 1245 PYFLVYVKQE 1254
             Y L+Y  ++
Sbjct: 452  AYLLIYSTKQ 461

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 682 DADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLP------ADNWPAGLNNIGNTC 735
           DA + +S K+  +  A      L S Y    ++ P   P        N   G  N GNTC
Sbjct: 93  DASDPVSEKAYHSSSAISDFEDLESEYDYFPLIKPSVTPLLPYGDGSNKVFGYENFGNTC 152

Query: 736 YLNSLLQYYFCISPLR 751
           Y NS+LQ  + +  LR
Sbjct: 153 YCNSVLQVIYNLPELR 168

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 19/23 (82%)

Query: 720 PADNWPAGLNNIGNTCYLNSLLQ 742
           P+ ++  GL N+GN+CYLNS++Q
Sbjct: 317 PSKDYGCGLINLGNSCYLNSVMQ 339

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%)

Query: 1185 NIGYSLFAVFIHRGEASYGHYWVYIKDFTKNG-IWRKYNDETITEVPEAEVFNFTEGNTA 1243
            N+ + L A+  H+G    GHY    +    NG +W K+ND  +T + E ++         
Sbjct: 409  NLTFKLSAIIPHQGTVDKGHYTTICR---INGDVWAKFNDSMVTLISEEDMLK------E 459

Query: 1244 TPYFLVYV 1251
              Y L YV
Sbjct: 460  QAYLLYYV 467

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 8/64 (12%)

Query: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYF 1247
            Y L  +  H G  + GHY    K     G W K+ND  +T + E  +           Y 
Sbjct: 406  YELIGIICHTGTVNEGHYTAICK--IPEGQWIKFNDSMVTIISEETMLK------EQAYL 457

Query: 1248 LVYV 1251
            L+Y 
Sbjct: 458  LIYT 461

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVE 765
           G  N GNTCY NS+LQ  + +   R  V +Y +  E  E
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEYPEKPEEQE 200

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 33.5 bits (75), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 1184 QNIGYSLFAVFIHRGEAS-YGHYW--VYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEG 1240
            +N  Y L  V  H G +S  GHY   +Y K+  K   W + +D T+TE+ + +V    E 
Sbjct: 948  ENRTYELTGVVYHHGLSSDGGHYTADIYHKEVDK---WYRIDDVTVTELEKDDVLKGGEN 1004

Query: 1241 NT--ATPYFLVYVK 1252
            +T   T Y L+Y K
Sbjct: 1005 STDSRTAYILMYQK 1018

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 726 AGLNNIGNTCYLNSLLQYYF 745
            GL N+GN+CYLNS+LQ  F
Sbjct: 323 CGLINLGNSCYLNSVLQCLF 342

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 9/50 (18%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRR 776
           G  N GNTCY NS+LQ  + ++  R  +  Y            DG  +RR
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKYPS---------RDGLLRRR 156

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 681 IDADEILSLKSVLTKIAFERNS----KLISSYLETGVVNPGCLPADNWPAGLNNIGNTCY 736
           ID    +  +  L ++  E+N     K++ S+    +  P   P+     G  N+GN+CY
Sbjct: 287 IDVSSKMGTEKSLIELQVEQNMNWNFKMVDSHGNELIQLP---PSKELGCGFINLGNSCY 343

Query: 737 LNSLLQYYF 745
           LNS+LQ  F
Sbjct: 344 LNSVLQCLF 352

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 1159 DDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRG-EASYGHYWVYIKDFTKNGI 1217
            D ELT     + ++ AK    +   ++  Y L  V  H G   S GHY   +   T++  
Sbjct: 697  DQELTIPKEALSSVNAKF---YLSGKDTTYRLTGVVYHHGLSPSGGHYTADVLHQTQDK- 752

Query: 1218 WRKYNDETITEVPEAEVFNFTE--GNTATPYFLVY 1250
            W + +D  +TE+ + +VF   +   ++ T Y L+Y
Sbjct: 753  WYRIDDNNVTEIRQEDVFKRGDEASDSKTAYILIY 787

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNY--VADYQKTLEAVENCLEDGWDKRRIGGREINK 784
           GL N+GNTCY+NS LQ    +     Y  +  YQK +  ++N +    +     G+ I+K
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEIN-LDNPIGYQGNVANAFGKLIHK 473

Query: 785 VEVERSV 791
           +  ER +
Sbjct: 474 LFEERII 480

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 32.7 bits (73), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 727 GLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVE 765
           G  N GNTCY NS+LQ  + ++  R  V  Y     +V+
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQYPARPASVQ 185

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 678 DSVIDADEILSLKSVLTKIAFERNSK--LISSYLETGVVNPGCLPADNWPAGLNNIGNTC 735
           D    +D + SL S     A + NS   L +   E+     G     N   G  N GNTC
Sbjct: 78  DGYTGSDTMQSLLSTSVDTAIDLNSSGLLFTKITESMPFGDG----SNKVFGYENFGNTC 133

Query: 736 YLNSLLQYYFCISPLR 751
           Y NS+LQ  + ++  R
Sbjct: 134 YCNSVLQCLYNLTEFR 149

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 1188 YSLFAVFIHRGEAS-YGHYW--VYIKDFTKNGIWRKYNDETITEVPEAEVFNFTE--GNT 1242
            Y L  V  H G +S  GHY   VY K+  K   W + +D  ITE+ + +V    E   ++
Sbjct: 841  YKLTGVIYHHGVSSDGGHYTADVYHKEHNK---WYRIDDVNITELEDDDVLKGGEEASDS 897

Query: 1243 ATPYFLVYVK 1252
             T Y L+Y K
Sbjct: 898  RTAYILMYQK 907

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 1188 YSLFAVFIHRGEAS-YGHYW--VYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEG--NT 1242
            YSL  V  H G +S  GHY   VY K+  K   W + +D  ITEV +  V    E   ++
Sbjct: 728  YSLSGVIYHHGLSSDGGHYTADVYHKETDK---WYRIDDINITEVQKDSVLKGGEDGVDS 784

Query: 1243 ATPYFLVYVKQ 1253
             T Y L+Y K+
Sbjct: 785  RTAYILMYQKK 795

>Suva_9.48 Chr9 (80060..82519) [2460 bp, 819 aa] {ON} YIL140W (REAL)
          Length = 819

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 55/126 (43%), Gaps = 19/126 (15%)

Query: 492 DKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNAL 551
           D  D+    + +   +TFS +P +  LSD N  +++     +V L G DPT  T+L N  
Sbjct: 66  DCYDLPDWLSFDTGSRTFSGEPSSNLLSDANTTLYI-----DVVLEGTDPTDSTSLNNT- 119

Query: 552 RILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDC 611
                       +F V   P  S+   FN+L + ++      + A  +  N+     +  
Sbjct: 120 -----------YQFVVTNRPTISLSSDFNLLALLKNYGYTNGKNALKLSPNEV--FNVTF 166

Query: 612 DRALYT 617
           DR+++T
Sbjct: 167 DRSMFT 172

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 32.3 bits (72), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1188 YSLFAVFIHRG-EASYGHYW--VYIKDFTKNGIWRKYNDETITEVPEAEVFNFTE--GNT 1242
            Y L  V  H G  +S GHY   V  +D  K   W + +D T+TE+ + EV    E   ++
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADVLHQDEEK---WYRIDDTTVTEINKEEVVTGGEEGSHS 823

Query: 1243 ATPYFLVY 1250
             T Y L+Y
Sbjct: 824  RTAYILIY 831

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 142,949,060
Number of extensions: 6903269
Number of successful extensions: 29133
Number of sequences better than 10.0: 429
Number of HSP's gapped: 30129
Number of HSP's successfully gapped: 550
Length of query: 1266
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1145
Effective length of database: 39,606,813
Effective search space: 45349800885
Effective search space used: 45349800885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)