Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1051.45.348ON42642620680.0
TDEL0E027905.348ON4114254997e-58
Skud_4.5835.348ON4154184762e-54
Suva_2.4865.348ON4154224762e-54
ZYRO0F00550g5.348ON4154264728e-54
YDR317W (HIM1)5.348ON4144264455e-50
Smik_4.5765.348ON4154264272e-47
CAGL0H07161g5.348ON4244264247e-47
TPHA0D020605.348ON4962864252e-46
TBLA0A031005.348ON3723533175e-32
Kwal_34.159895.348ON5064262864e-27
SAKL0G08910g5.348ON5053342769e-26
KAFR0C018805.348ON3452862646e-25
KLTH0H14784g5.348ON5143422573e-23
AGR348W5.348ON5422212157e-18
Ecym_81855.348ON4713242112e-17
KLLA0B10120g5.348ON3482371576e-11
KNAG0L00930singletonON229158970.001
TBLA0A105007.148ON237114940.003
TDEL0H031107.148ON224122920.005
KLTH0H00264g7.148ON222160870.021
YER004W (FMP52)7.148ON23176860.034
Suva_5.917.148ON22976850.036
Smik_5.1187.148ON23176850.045
ZYRO0D09548g7.148ON22589780.27
Skud_5.1037.148ON227121770.44
KAFR0G027507.148ON225124740.83
KLTH0G08052g2.189ON27537712.8
TPHA0G014708.700ON29154677.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1051.4
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   801   0.0  
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   196   7e-58
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   187   2e-54
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   187   2e-54
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   186   8e-54
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   176   5e-50
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   169   2e-47
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   167   7e-47
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...   168   2e-46
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...   126   5e-32
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   114   4e-27
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   110   9e-26
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...   106   6e-25
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   103   3e-23
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...    87   7e-18
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...    86   2e-17
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    65   6e-11
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               42   0.001
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    41   0.003
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    40   0.005
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    38   0.021
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    38   0.034
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    37   0.036
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    37   0.045
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    35   0.27 
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    34   0.44 
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    33   0.83 
KLTH0G08052g Chr7 (650856..651683) [828 bp, 275 aa] {ON} highly ...    32   2.8  
TPHA0G01470 Chr7 complement(303017..303892) [876 bp, 291 aa] {ON...    30   7.2  

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/426 (93%), Positives = 397/426 (93%)

Query: 1   MITYKLPTSCPEKNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIE 60
           MITYKLPTSCPEKNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIE
Sbjct: 1   MITYKLPTSCPEKNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIE 60

Query: 61  IPSNHQKMNTIKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETS 120
           IPSNHQKMNTIKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETS
Sbjct: 61  IPSNHQKMNTIKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETS 120

Query: 121 YESSYLTNEIESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIII 180
           YESSYLTNEIESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIII
Sbjct: 121 YESSYLTNEIESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIII 180

Query: 181 PTSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREK 240
           PTSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREK
Sbjct: 181 PTSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREK 240

Query: 241 SYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPK 300
           SYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPK
Sbjct: 241 SYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPK 300

Query: 301 LSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRST 360
           LSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSI                 RST
Sbjct: 301 LSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKYRST 360

Query: 361 GIAPRLTDILAKTMYRKPGTSVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQIITSR 420
           GIAPRLTDILAKTMYRKPGTSVLGYCIP            IEPTIASTYSKPDVQIITSR
Sbjct: 361 GIAPRLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKAIEPTIASTYSKPDVQIITSR 420

Query: 421 QIDELV 426
           QIDELV
Sbjct: 421 QIDELV 426

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  196 bits (499), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 129/425 (30%), Positives = 208/425 (48%), Gaps = 31/425 (7%)

Query: 13  KNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIK 72
           + +++     GS+GL     L  LL  + YL N   I+++LN          H  ++  +
Sbjct: 5   QQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNT-------CEHLNLSNFR 57

Query: 73  IVKNIFCINRR--SQTLDLFNKDALESVKVGRIKFKDLEYRLDK----TPGETSYESSYL 126
             K I+CINR+   + + L N+  L++ K+  I F   +YR +K     P    + +  L
Sbjct: 58  FNKLIYCINRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSL 117

Query: 127 TNEI--ESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSN 184
            N +  ESG +        + L +    +  Q+ YK++    L I F   +  I  P S+
Sbjct: 118 VNNVSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSS 177

Query: 185 QWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRA 244
           +W  LLP IF+    +    + + +     LP L  IPTMI +LG   RQ   +      
Sbjct: 178 KWCELLPDIFSGCVALRSEAEPDGTT--NKLPPLDEIPTMICTLGAGSRQSKAKR---HY 232

Query: 245 IDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQL 304
           +D++LT KL Q+F N   K+LV++TTFNN ++  +  YF  K K+E  LQ++L P+L +L
Sbjct: 233 VDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKL 292

Query: 305 VILRPGPIV---GVPMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRSTG 361
           V+LRPGP+V   G P+T ++       +  S N+++Q +                 R  G
Sbjct: 293 VVLRPGPLVGEHGRPLTKSLT------IGHSTNMLKQILYYKEYCFQCKLALFKEFRRIG 346

Query: 362 IAPRLTDILAKTMYRKPGTSVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQIITSRQ 421
              R ++++A+TMYRKPG+ +LGYCIP             +   AS  +   V+IITS Q
Sbjct: 347 FRTRASELIARTMYRKPGSWMLGYCIPATKAAYVAASKATDE--ASDEASDPVEIITSEQ 404

Query: 422 IDELV 426
           +D + 
Sbjct: 405 MDHIA 409

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  187 bits (476), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/418 (30%), Positives = 208/418 (49%), Gaps = 22/418 (5%)

Query: 15  FSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIKIV 74
           F++ I + GS+GL  +  L +LLDINFY+ N ++++ KL+   +I+          + + 
Sbjct: 8   FTDYILLFGSSGLAGRGTLENLLDINFYIKNVSDLQDKLDSLKEIK--------EDVVLN 59

Query: 75  KNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPG-----ETSYESSYLTNE 129
           K++FCINRR+ T        ++ V +  I +K   Y L          ETS   ++  + 
Sbjct: 60  KHVFCINRRNVTEQKSFLKTIDYVNMKSITWKGGRYYLRSRTANDNGRETSSTDTFFYDN 119

Query: 130 IESGKINFDC-EHPFSPLSFELQKKR--AQLTYKAKEGNMLQIQFEISVYHIIIPTSNQW 186
            E G I     E      SF   +K+    L Y  ++     I++  +V  +IIP S  W
Sbjct: 120 FEEGFIRGAAYEGQKGNFSFAYNQKQFSYSLHYACRKEESFGIKYNFTVTQLIIPPSESW 179

Query: 187 PTLLPRIFNPATVIEKVE-DKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAI 245
           P LL RIF+    +EK + D +  +    LP L++I TM+ +LG    +    +     +
Sbjct: 180 PRLLSRIFSKEQKLEKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNSFV 239

Query: 246 DFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLV 305
           D+ L   L Q FAN  NK+LVV+T+FNN ++ + F YF  K K+E  L+  L  KL +LV
Sbjct: 240 DYHLVFSLAQEFANTTNKRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKELV 299

Query: 306 ILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRSTGIAPR 365
           ILRPGP+ G    D +N + +  ++++    E+ +                 R  G+  +
Sbjct: 300 ILRPGPMCG-QHGDPVNVKLD--VQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTK 356

Query: 366 LTDILAKTMYRKPGTSVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQIITSRQID 423
           L++++A ++YR PG+++LGY +P            IE    S  + P V++I S QID
Sbjct: 357 LSELIASSIYRMPGSALLGYSVPVSKVSYVTSLKAIEKR--SKEAGPKVEMINSYQID 412

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  187 bits (476), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/422 (30%), Positives = 211/422 (50%), Gaps = 30/422 (7%)

Query: 15  FSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIKIV 74
           F++ I + GS+GL  K  L +LLDINFY+ N ++++ KL+  ++I           + + 
Sbjct: 8   FTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEIN--------ENVVLN 59

Query: 75  KNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRL-----DKTPGETSYESSYLTNE 129
           K+IFCINR+S T        ++ V +  I +K   Y L     ++T  ET   +++  ++
Sbjct: 60  KHIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDD 119

Query: 130 IESG----KINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSNQ 185
            E G     ++ D +  FS  ++  ++    L Y   +     I++   V  ++IP S  
Sbjct: 120 FEEGIIRNSMDKDKKGTFS-FAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTS 178

Query: 186 WPTLLPRIFNPATVIEKVE-DKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRA 244
           WP LLP +F+    +E+ + D  + +    LP L +I TM+ +LG +  +    +     
Sbjct: 179 WPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSF 238

Query: 245 IDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQL 304
           +D+ L+  L Q F N  +KKLVVIT+FNN  +S+ F YF  K K+E  L+  L  KL +L
Sbjct: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298

Query: 305 VILRPGPIVGV---PMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRSTG 361
           +ILRPGP+ G    P+   ++ + NP L       E+                   R  G
Sbjct: 299 IILRPGPMCGQHGNPVHVEMDIQQNPTLS------ERFFYYPRYILKYKQQCISEVRKVG 352

Query: 362 IAPRLTDILAKTMYRKPGTSVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQIITSRQ 421
           +  RL++++A ++YR PG+++LGY +P            IE    S  + P V++I S Q
Sbjct: 353 LRTRLSEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEK--KSKEAGPKVEVINSYQ 410

Query: 422 ID 423
           ID
Sbjct: 411 ID 412

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  186 bits (472), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 133/426 (31%), Positives = 211/426 (49%), Gaps = 33/426 (7%)

Query: 12  EKNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTI 71
            ++F + I + GSTGL     L  LL +  YL   N+++ KL    + +I  NH  +N  
Sbjct: 10  HQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDI--NHFTLN-- 65

Query: 72  KIVKNIFCINRR--SQTLDLFNKDALESVKVGRIKFKDLEYRL----DKTPGETSYESSY 125
              K  +C+NR+  ++     N+  +E  K   + F+  +Y L      TP  +   +  
Sbjct: 66  ---KFFYCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPS 122

Query: 126 LTNEI--ESGKINFD--CEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIP 181
           L N +  E G I      ++    L F   +K  QL Y +K+   L I F  ++  ++  
Sbjct: 123 LGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFE 182

Query: 182 TSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKS 241
            S +W  LLP IF+    +E V ++ N   P  LP L  + TMI +LG N          
Sbjct: 183 DSTRWADLLPSIFSGE--VELVPEESNHTSPR-LPHLDQVKTMICTLGPNSSSTKHSHYD 239

Query: 242 YRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKL 301
              +++ LT ++ Q FA+  +K+LV++T+FNN +VS +F YF  K+++E  LQN++ P L
Sbjct: 240 RYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPAL 299

Query: 302 SQLVILRPGPIVG--VPMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRS 359
           +QLV+LRPGPIVG  V + D      +  L+ S +L EQ                   R 
Sbjct: 300 AQLVVLRPGPIVGNHVNLNDR-----DLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRK 354

Query: 360 TGIAPRLTDILAKTMYRKPGTSVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQIITS 419
            G   + ++++AK MYRKPG+SVLGYC+P              PT+       +++I+TS
Sbjct: 355 IGFKTKASELVAKAMYRKPGSSVLGYCVPASKAAYATAYMATNPTLG------ELRIVTS 408

Query: 420 RQIDEL 425
           ++ID L
Sbjct: 409 KEIDHL 414

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  176 bits (445), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 137/426 (32%), Positives = 213/426 (50%), Gaps = 33/426 (7%)

Query: 15  FSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIKIV 74
           F++ + + GS+ L  K  L +LLDIN Y+ N ++++ KL+  S+I+          + + 
Sbjct: 8   FTDYVLLFGSSSLVGKGILENLLDINLYIKNVSDLQGKLDSLSEIK--------GNVVLN 59

Query: 75  KNIFCINRRS--------QTLDLFNKDALESVKVGRIKFKDL-EYRLDKTPGETSYESSY 125
           K++FC+NRR         +T+D  N  ++ + + GR   +   E   +K P   S  +++
Sbjct: 60  KHVFCVNRRCINEEKSFMKTIDYINMRSV-TWQGGRYYLRSRKEKDTEKVP---SSPNTF 115

Query: 126 LTNEIESGKI-NFDCEHPFSPLSFELQKKRAQLT--YKAKEGNMLQIQFEISVYHIIIPT 182
             +  E G I N   E      SF   +K+   T  Y   +   ++I    +V  +IIP 
Sbjct: 116 CYDNFEEGFIKNTPEERGKDGYSFVYNQKQFSYTLHYACGKEKGIEIICNFTVTQLIIPR 175

Query: 183 SNQWPTLLPRIFNPATVIEKVE-DKENSILPTGLPDLKNIPTMISSLG-LNHRQQITREK 240
           S  WP LLPRIF+    +EK + D +N +    LP L +I TM+ SLG  + R + T+  
Sbjct: 176 SETWPKLLPRIFSGTQKLEKFDIDNKNYVPGRSLPSLCDISTMVCSLGSTSARVRRTQVP 235

Query: 241 SYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPK 300
           S  A D+ L   L Q F N  NK+LVV T FNN  +SK F YF  K K+E  L   L  K
Sbjct: 236 SSFA-DYYLPFNLAQEFTNTTNKRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNK 294

Query: 301 LSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRST 360
           L +LVILRPGP+ G    + IN E     K++   +E+                   R  
Sbjct: 295 LKELVILRPGPMCG-QHGNPINVELG---KENSTFLEKIFYYPHYLLVYKKKYISEARRI 350

Query: 361 GIAPRLTDILAKTMYRKPGTSVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQIITSR 420
           G+  +L++I+A ++YR PG+++LGY +P            IE    S  + P +++I+S 
Sbjct: 351 GLRTKLSEIIASSIYRMPGSALLGYAVPVSKVSYVASLMAIER--KSKEAGPKLEVISSY 408

Query: 421 QIDELV 426
           QID +V
Sbjct: 409 QIDMIV 414

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  169 bits (427), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 125/426 (29%), Positives = 210/426 (49%), Gaps = 38/426 (8%)

Query: 15  FSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIKIV 74
           F++ I + GS+GL  K  L ++LDINFY+ N ++++ KLN  ++I+          + + 
Sbjct: 8   FTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIK--------GDVVLN 59

Query: 75  KNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRL-DKTPGET-------------S 120
           K++FCINRRS T +     +++ + +  I +K   Y L  +   ET             +
Sbjct: 60  KHVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDA 119

Query: 121 YESSYLTNEI-ESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHII 179
           +E  ++     E+GK NF   +     S+ L     +     KEG   +I ++ +V  +I
Sbjct: 120 FEEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGK-----KEG--FEIIYKFTVTQLI 172

Query: 180 IPTSNQWPTLLPRIFNPATVIEKVEDKENSILPTG--LPDLKNIPTMISSLGLNHRQQIT 237
           IP S  W  LL  IF+    +EK  D  N     G  LP+L++I TM+ +LG    +   
Sbjct: 173 IPRSENWSRLLSYIFSGTQKLEKF-DANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRR 231

Query: 238 REKSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNEL 297
            +     +D+ L   L Q F N  +K+LV+IT+FNNK +S  F YF  K K+E  L+  L
Sbjct: 232 TQVPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVL 291

Query: 298 NPKLSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXX 357
             K  +L+ILRPGP+ G    ++I  E +  ++++    ++ +                 
Sbjct: 292 PNKPKELIILRPGPMCG-QHGNSIKVELD--VQENLTFSDKILYYPRYLLMYKKQYISEV 348

Query: 358 RSTGIAPRLTDILAKTMYRKPGTSVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQII 417
           R  G+  +L++++A + YR PG+++LGY +P            IE    S  + P +++I
Sbjct: 349 RKIGLRTKLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIER--KSKEAGPKMEVI 406

Query: 418 TSRQID 423
            S QID
Sbjct: 407 NSYQID 412

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  167 bits (424), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 120/426 (28%), Positives = 211/426 (49%), Gaps = 30/426 (7%)

Query: 12  EKNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTI 71
           EK F + I + GSTGL        LLD  FYL ++ E+++ L       + +  + +  +
Sbjct: 16  EKTFEKNILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELL-------LEAIEEGLENV 68

Query: 72  KIVKNIFCINRR-SQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPG---------ETSY 121
            I   ++C NR+  + LD + K    +   G   F   +Y  +K            ETS 
Sbjct: 69  TIKTCLYCFNRKIGEPLDKYLKSP-SANSFGPFCFNGSQYHYNKGTCVPLDIDQDIETSN 127

Query: 122 ESSY--LTNEIESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHII 179
           ++++       + GK N   ++P S   +  ++    L Y + EGN+L++ F  +   +I
Sbjct: 128 DATFDGFLYYKDKGK-NVTGKNPISG-EYYGKEYMYYLEYMSAEGNLLKLNFIFNHIQLI 185

Query: 180 IPTSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITRE 239
           I  S  WP+++P IF+    +E +  +E   L    P L +I TMIS++G    +     
Sbjct: 186 IKNSFSWPSVIPIIFSDE--VEAISFREKMPLKRYFPLLSDIKTMISTIGTTTNRNKISN 243

Query: 240 KSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNP 299
            +Y  ID+ L + L + F+N ++K ++++T+FNN ++S +  YF  K K+E  L N + P
Sbjct: 244 TTYNDIDYQLNVDLVKAFSNTDDKSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITP 303

Query: 300 KLSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRS 359
            L  L ILRPGP+VG      I P  + ILK S +L E+++                 R+
Sbjct: 304 PLKTLTILRPGPLVG--RHSDIYPTNDSILKNS-SLFERALLHKKAFLQNMECFVDDIRT 360

Query: 360 TGIAPRLTDILAKTMYRKPGTSVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQIITS 419
            G++ + ++I+A+T YR PG+ +LGYCIP            ++  +   + +P  +++TS
Sbjct: 361 GGMSIKASEIVARTFYRIPGSKLLGYCIPAQKVAYAISIAAVDKYL---HEEPLTRVVTS 417

Query: 420 RQIDEL 425
            ++D +
Sbjct: 418 EEMDNM 423

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score =  168 bits (425), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 157/286 (54%), Gaps = 14/286 (4%)

Query: 148 FELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSNQWPTLLPRIFNPAT-------VI 200
           F LQ+  + L + +  G++L+I F++ +YH+    S  WP+LLP +F+  T       +I
Sbjct: 217 FNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLI 276

Query: 201 EKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANN 260
           E ++     +    LP L  +  M++SLG   R    + ++++ ID+ L L L  +F N 
Sbjct: 277 ENID-----LTNEKLPLLSEVKVMLNSLG--SRSHSPKNETFKNIDYKLNLSLINSFNNT 329

Query: 261 NNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVGVPMTDA 320
           ++KK+++IT+ N K+ +   RY ++K  +EE L+  L+ K+++LVILRPGP+VG PMT  
Sbjct: 330 SDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTK 389

Query: 321 INPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRSTGIAPRLTDILAKTMYRKPGT 380
           + P     LK++D+ ++Q I                 + TG  P  T+ILAKT YR+PGT
Sbjct: 390 LIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGT 449

Query: 381 SVLGYCIPXXXXXXXXXXXXIEPTIASTYSKPDVQIITSRQIDELV 426
           S+LGY IP            +   + + +    V+I+ S+ ID L+
Sbjct: 450 SLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTIDLLL 495

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (52%), Gaps = 14/116 (12%)

Query: 6   LPTSCPEKNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNH 65
           +P       FS+ I +VGSTGL  +  L S  D + Y+ +S E+K +L   S+ +  +  
Sbjct: 22  VPIESSIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELK-RLIASSEYDSTT-- 78

Query: 66  QKMNTIKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETSY 121
            ++  + I K  + + R+ Q+++LF    +    VG+ K K++E  LD   G+T Y
Sbjct: 79  -RIKEVTIKKTAYSLTRKRQSVELFKNKTI----VGQ-KLKEVE--LD---GKTFY 123

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score =  126 bits (317), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 177/353 (50%), Gaps = 73/353 (20%)

Query: 23  GSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIE-IPSNHQKMNT-----IKIVKN 76
           GSTG+     L +LL+IN YL       Q  +P+S I+ +P + Q         + +VKN
Sbjct: 11  GSTGMTGFTTLTNLLNINSYL-------QAKDPQSAIDNLPQDFQWQACDDSLDLYLVKN 63

Query: 77  IFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETSYESSYLT--NEIESGK 134
           IFCINRR     ++  + + S  +  I +KD  + L +    T+  S+ +T  NE++   
Sbjct: 64  IFCINRRFFDSPIYLDEKIISSNIS-INYKDKTFEL-QFQSNTNSVSNNITEQNELKLPL 121

Query: 135 INFDCEHPF---------------------SPLSFELQKKRAQLTYK------------A 161
           ++ DC   F                       + +   ++  QL +K             
Sbjct: 122 VSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQINLNENENDNDN 181

Query: 162 KEGNMLQIQFEISVYHIIIPTSNQWPTLLPRIFNPATV-----------IEKVEDKENSI 210
            +   +++ + I++Y  ++P S+ W  +LP IF P T+           I++  +++++I
Sbjct: 182 VQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNI 241

Query: 211 LPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNNNKKLVVITT 270
           +   LP L++I  MI +LG N           + IDFDLT +L+  F+N   KKLV++T 
Sbjct: 242 V---LPKLEDIQVMICTLGTNLL------CDQKKIDFDLTFQLSNWFSNRLGKKLVIVTA 292

Query: 271 FNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVGVPMTDAINP 323
           FNN ++SK F YF+ K ++E++L+ +L+  L +LVILRPGP++G   T  +NP
Sbjct: 293 FNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLG---THVLNP 342

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  114 bits (286), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 114/426 (26%), Positives = 185/426 (43%), Gaps = 92/426 (21%)

Query: 21  IVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLN---PRSDIEIPSNHQKMN-------- 69
           I G TGL       +L     YL  +N++++K++   P SD ++  +H  M         
Sbjct: 81  IFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFSD-QLEKHHHFMRRTRSPLCN 139

Query: 70  ------TIKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETSYES 123
                 ++++ KN+FC  RRS TL+    D L++           E+ +D          
Sbjct: 140 LLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDA---------SWEHSID---------- 180

Query: 124 SYLTNEIESGKINFDCEHPF--------------SP---LSFELQKKRAQLTYKAKEG-- 164
            Y  +++   K N  CE PF              +P   L+ +LQK    L Y       
Sbjct: 181 -YKGSKMVCSKENLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVH 239

Query: 165 -----NMLQIQFEISVYHIIIPTSNQWPTLLPRIFNPATVIEK--VEDKENSILPTGLPD 217
                + L IQ  +++  I+   S +WP LL RIF          V+D E  IL T  P 
Sbjct: 240 GETCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTA-PP 298

Query: 218 LKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNNN----KKLVVITTFNN 273
           L  I TM+SSLG    ++   + S    D++L + L   F  +      KK+V+IT+FNN
Sbjct: 299 LTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNN 358

Query: 274 KVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVG-----VPMTDAIN-PEFNP 327
             +S    YF  K  +E+ L  ++   L +LV+LRPGP+VG     +     I+ P F P
Sbjct: 359 LFLSSTSDYFQSKLMLEQDLVTKVQA-LDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIP 417

Query: 328 -----ILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRSTGIAPRLTDILAKTMYRKPGTSV 382
                +LK   N +E+ +                    GI  +L++++A+  Y++  + +
Sbjct: 418 TAMFKVLKFKKNCIERKLQLLREIS-----------QVGIRTKLSELMARLAYQRSCSPL 466

Query: 383 LGYCIP 388
           LG+ +P
Sbjct: 467 LGHVVP 472

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  110 bits (276), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 93/334 (27%), Positives = 151/334 (45%), Gaps = 29/334 (8%)

Query: 70  TIKIVKNIFCINRRSQTLDL-----FNKDALESVKVGRIKFKDLEYRLDK---TPGETSY 121
           +I+I KN+FC NR+   L++     +  D  E      I +K  +Y   K   + G  + 
Sbjct: 141 SIEITKNLFCFNRKLALLEIPSTPEYINDYWEY----SIDYKGTKYHSKKNNISFGVPTL 196

Query: 122 ESSYLTNEIESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIP 181
           +   L N  E+   N  C+       FE Q++   +         L I  +I+V  I+ P
Sbjct: 197 KFGKLVNSNENSITN-QCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEP 255

Query: 182 TSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKS 241
            S  WP LL   F        +  +     P   P L  + T++S+LG    +Q     S
Sbjct: 256 NSKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVS 315

Query: 242 YRAIDFDLTLKLTQTFANNNN-----KKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNE 296
              +D+DL  K+ + F  N++     KK+VVIT+FNN  +S    YFH K K+E+ L   
Sbjct: 316 RDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATR 375

Query: 297 LNPKLSQLVILRPGPIVGVPMTDAINPEFNPIL--KKSDNLVEQSIXXXXXXXXXXXXXX 354
           + P+L +LVILRPGP++G     +  PEF P    K ++ L++                 
Sbjct: 376 I-PELDELVILRPGPLIG-----SHTPEFIPGDPPKSTNGLLKPLSTVCYYKKACYDHKR 429

Query: 355 XXXRS---TGIAPRLTDILAKTMYRKPGTSVLGY 385
              +S    G+  ++T++ A+ +YR   + + GY
Sbjct: 430 HFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGY 463

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score =  106 bits (264), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 133/286 (46%), Gaps = 23/286 (8%)

Query: 35  SLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIKIVKNIFCINRRSQTLDLFNKDA 94
           +LL+ NF L N      K N   D+   S    +  I   K I+C NR  Q +       
Sbjct: 25  NLLNPNFLLCN------KQNNFYDVIESSIVSGVYDIAFDKIIYCFNRTPQNIRYKYHSD 78

Query: 95  LESVKVGRIKFKDLEYRLDKTPG-ETSYESSYLTNEIESGKINF---DCEHPFSPLSFEL 150
            E  K  +  F   +Y L   P    S+ES         G++ F   D E     + +++
Sbjct: 79  FE--KNSQFDFGGTKYTLSNNPEPNNSFESK--------GQLQFAINDVEERIK-IKYQV 127

Query: 151 QKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSNQWPTLLPRIFNPATVIEKVEDKENSI 210
                +  + A+E   L + + +    I+   S +WP LLP +F     I+    +++ +
Sbjct: 128 MPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRL 187

Query: 211 LPT--GLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNNNKKLVVI 268
            P    L ++ +I T++ +LG +      +  +   ID+DLT  L + F    NKK++++
Sbjct: 188 FPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIV 247

Query: 269 TTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVG 314
           T+FNN ++S +F YF  K ++E  L+  L P + +L ILRPGPI G
Sbjct: 248 TSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKG 293

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  103 bits (257), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 157/342 (45%), Gaps = 53/342 (15%)

Query: 13  KNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPR--SDIEIPSNHQ---- 66
           +  ++ + I+G+TGL     L +L     YL  +N+++ K++    +D+E  + H     
Sbjct: 77  QRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVK 136

Query: 67  -----------KMNTIKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKT 115
                      +  +I++ KN++C+ RR   ++    D L++     ++ K  +    K 
Sbjct: 137 KPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGKG 196

Query: 116 --PGETSYESSYLTNEIESGKINFDCEHPFSPLSFELQKKRAQLTYKAKE-------GNM 166
               + + E +    E+ S     +C  P   +  +LQ    +L Y+          G+ 
Sbjct: 197 GISRDCTLERNAAMYELAS---THNC--PGREIILQLQSFSFKLVYENSRDPHGDTCGHA 251

Query: 167 LQIQFEISVYHIIIPTSNQWPTLLPRIFNPATVIEKVEDKENSILPTG----------LP 216
           L ++  I+V  +I   S +WP LL  +F         +  +  ++P G           P
Sbjct: 252 LMVKLNINVICVIDTDSQRWPALLTDVFGE-------QPMKRGLIPQGQGLEGISHWEFP 304

Query: 217 DLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTF----ANNNNKKLVVITTFN 272
            L ++ T++S+LG    Q+         +D++L L L Q F    A    KK+VV+T+FN
Sbjct: 305 SLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFN 364

Query: 273 NKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVG 314
           + ++S +  YF  K K+E+ L  +++  +  LV+LRPGP+VG
Sbjct: 365 SSLLSTVSNYFQTKLKLEQDLYTKVH-GMDNLVLLRPGPLVG 405

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 107/221 (48%), Gaps = 16/221 (7%)

Query: 173 ISVYHIIIPTSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNH 232
           I+V  ++ P S +WP L  ++F             N+     +P +  I T+IS+LG + 
Sbjct: 284 INVVQVVQPDSRRWPDLFNKMFTGGV------RTFNAYSEIYMPAVTEIETLISTLG-ST 336

Query: 233 RQQITREKSYRA-IDFDLTLKLTQTFA----NNNNKKLVVITTFNNKVVSKMFRYFHFKF 287
             +  + K+ RA +D+ L +++ +TFA        K +V++T+FN+  +  + +YF  K 
Sbjct: 337 SWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQ 396

Query: 288 KIEEALQNELNPKLSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSIXXXXXXX 347
           ++E  L  ++ P L+ L ILRPGP++G        P  +P    + N++ +         
Sbjct: 397 RLENDLTYDV-PGLTHLTILRPGPLLG---EHGSKPVISPTNPDTGNMLTRCYTYKKNVM 452

Query: 348 XXXXXXXXXXRSTGIAPRLTDILAKTMYRKPGTSVLGYCIP 388
                     +  G   ++T+++AK  Y  PG  ++GY IP
Sbjct: 453 RTQFNWLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIP 493

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 140/324 (43%), Gaps = 37/324 (11%)

Query: 71  IKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETSYESSYLTNEI 130
           +K+ KNI+C NRR +T+D F+   L       + +    + + K      Y+     +  
Sbjct: 131 LKLTKNIWCFNRRLKTVD-FSISKLPPTWTAVVNYGGEPHIIRK------YDLKIKQHIT 183

Query: 131 ESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSNQWPTLL 190
           E GK++   E  +    +EL+    ++               ++V+ II   S +W    
Sbjct: 184 EIGKLD-GLEFQWDQFDWELKLPTDEVK-----------NVTVNVFQIIQNDSKKWDKTF 231

Query: 191 PRIF--NPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFD 248
             +F  N   + +++E          LP +  + T+IS+LG +  +    +     +D+ 
Sbjct: 232 SELFTGNRKPLNDRIE--------VYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYT 283

Query: 249 LTLKLTQTFANNNNKKL----VVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQL 304
           L + + + FA +  K L    V++T+FNN  +  +  YF  K K+E  L  ++ P L+ L
Sbjct: 284 LNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHL 342

Query: 305 VILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSIXXXXXXXXXXXXXXXXXRSTGIAP 364
            ILRPGP++G      I     P L     ++ +                   +  G + 
Sbjct: 343 TILRPGPLIGQHGKQII---LAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSK 399

Query: 365 RLTDILAKTMYRKPGTSVLGYCIP 388
           ++T+++AK  Y  PG  ++GY IP
Sbjct: 400 KVTELIAKATYHLPGNWIVGYSIP 423

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 106/237 (44%), Gaps = 34/237 (14%)

Query: 157 LTYKAKEGNMLQIQFEISVYHIIIPTSNQWPTLLPR-IFNPATVIEKVEDKENSILPTGL 215
           ++Y     +++ I   + V  I  P S +W  ++P  IF        + D      P+  
Sbjct: 88  ISYSTTIHDLISICVNVEVTTIKEPDSTKWAQMIPHHIF--------IND------PSA- 132

Query: 216 PDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNN--NKKL---VVITT 270
            DL  I  + S+   + R  + R+     +D  L L + +   NN+  ++KL   +++T+
Sbjct: 133 -DLSVISCLGSTSARSKRTGVARD----WVDKILNLDILKAILNNDILSQKLSQYIIMTS 187

Query: 271 FNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVGVPMTDA--INPEFNPI 328
           FNN  +S+MF YF  K ++E   Q  L    + +VILRPGP++G   + +    PE +  
Sbjct: 188 FNNFAISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIGKHGSTSSFTVPELD-- 245

Query: 329 LKKSDNLVEQSIXXXXXXXXXXXXXXXXXRSTGIAPRLTDILAKTMYRKPGTSVLGY 385
               D L+   +                 +  GIA R ++++A+  Y  PG   +GY
Sbjct: 246 ----DRLLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQFSYNMPGAFFVGY 298

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 16/158 (10%)

Query: 182 TSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDL-KNIPTMISSLGLNHRQQITREK 240
           + + WPT      +P   + K+ + ++++    + D+  N+  +I +LG   R +   E+
Sbjct: 33  SRSDWPTGQ----DPQGKLVKLIEPDSTLWGRAMRDIPGNLDVLICALGTT-RARSNAEE 87

Query: 241 SYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPK 300
            Y A+D DLTL+L        +   VV+ +         F Y   K  +E  +  EL  +
Sbjct: 88  QY-AVDHDLTLELATVAKREKHAHTVVVVSSTGAHPESRFFYARMKGDVERDI-TEL--Q 143

Query: 301 LSQLVILRPGPIVG------VPMTDAINPEFNPILKKS 332
            +  V+LRPG ++G      V   D +   F  +  +S
Sbjct: 144 FNHTVLLRPGILLGERYKPHVGYRDFLGTRFGALFYRS 181

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 6/114 (5%)

Query: 201 EKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANN 260
           +++ +K+NS   +  P  K I  +++ L    +     ++ Y  ID DL +   +    N
Sbjct: 48  QQIVEKDNSKWISHFPTDK-IDILMTGLATTKKAAGGAQQQYY-IDHDLNIDFAKKAKEN 105

Query: 261 NNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVG 314
                VV+++      S+ F Y   K +IE  L+         L+ILRPGP++G
Sbjct: 106 GCSTFVVVSSAGASADSRFF-YLKMKGEIERDLKA---IDFDHLIILRPGPLLG 155

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 197 ATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQT 256
           +T ++KV DK+ +     +P+ +++  + + L          +K Y+ ID DL ++L + 
Sbjct: 41  STAVQKV-DKDTTKWGQYIPN-EHLEFVFTGLATTRGAAGGFDKQYK-IDHDLNIELAKV 97

Query: 257 FANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVGVP 316
                    V++++   K  S MF Y   K +IE   ++ L       +ILRPGP++G  
Sbjct: 98  AKEKGCSTFVLVSSGGAKEDS-MFAYMKMKGEIE---RDILALGFDHTIILRPGPLLGDR 153

Query: 317 MT 318
           +T
Sbjct: 154 LT 155

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 67/160 (41%), Gaps = 38/160 (23%)

Query: 155 AQLTYKAKEGNMLQIQFEISVYHIIIPTSNQWPTLLPRIFNPATVIEKVEDKENSILPTG 214
           A ++ KA  GN     ++  V  +I+  S+ W   +P  ++              IL +G
Sbjct: 32  ATISRKALNGN-----YDGKVRSLILEDSSNWSAAVPENYD--------------ILFSG 72

Query: 215 LPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNK 274
           L                 R +  +E  Y+ +D D+ L+L ++         VV+++    
Sbjct: 73  LA--------------TTRGEAGKENFYK-VDHDMNLQLARSAKEKGYSTYVVVSSTGAD 117

Query: 275 VVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVG 314
             S MF Y   K ++E   ++ L     + +ILRPGP++G
Sbjct: 118 ENS-MFYYMKTKGELE---RDILALGFERTIILRPGPLLG 153

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 239 EKSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELN 298
           +K Y+ ID DL L+L Q       + +V++++      S+ F Y   K +IE   ++ + 
Sbjct: 84  DKQYK-IDHDLNLQLAQAAKEKGCETIVLVSSAGAHPDSR-FGYMKMKGEIE---RDVIA 138

Query: 299 PKLSQLVILRPGPIVG 314
                ++ILRPGP++G
Sbjct: 139 LDFKHIIILRPGPLLG 154

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 239 EKSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELN 298
           +K Y+ ID DL ++L +   +     +V++++    V S+ F Y   K +IE  +   + 
Sbjct: 84  DKQYK-IDHDLNMQLARAAKDRGCDTIVLVSSAGAHVDSR-FGYMKMKGEIERDI---IA 138

Query: 299 PKLSQLVILRPGPIVG 314
                 +ILRPGP++G
Sbjct: 139 LNFKHTIILRPGPLLG 154

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 239 EKSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELN 298
           +K Y+ ID DL L+L +   +   + +V++++      S+ F Y   K +IE   ++ + 
Sbjct: 84  DKQYK-IDHDLNLQLARAAKDKGCETIVLVSSAGAHADSR-FGYMKMKGEIE---RDVIA 138

Query: 299 PKLSQLVILRPGPIVG 314
                 +ILRPGP++G
Sbjct: 139 LNFKHTIILRPGPLLG 154

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 226 SSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHF 285
           S+ G       + E  Y+ ID DL ++L +         +V++++      S M  YF  
Sbjct: 69  SAFGTTRAAAGSAENFYK-IDHDLNVELAKAAKTKGCTTMVLVSSVGANENS-MLPYFKD 126

Query: 286 KFKIEEALQNELNPKLSQLVILRPGPIVG 314
           K +IE   ++ L       +ILRPGP++G
Sbjct: 127 KGEIE---RDILALDFDHTIILRPGPLLG 152

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 5/121 (4%)

Query: 194 FNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKL 253
           F+P   +  V +K+NS     + D+ +   + ++L          +  Y+ ID DL L+L
Sbjct: 39  FSPTEKVVTVVEKDNSQWSELVTDVMHPQVLFTALATTRAAAGGLDNQYK-IDHDLNLQL 97

Query: 254 TQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIV 313
            +       + +V++++      S+ F Y   K +IE   ++ +       +ILRPGP++
Sbjct: 98  ARAAKEKGCETIVLVSSAGAHPDSR-FGYMKMKGEIE---RDVIALNFKHTIILRPGPLL 153

Query: 314 G 314
           G
Sbjct: 154 G 154

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 16/124 (12%)

Query: 200 IEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRA---------IDFDLT 250
           I++ + K NSI+     D  N   +IS L  N     T   + RA         ID DL 
Sbjct: 38  IQESDSKLNSIVD---KDSSNWSNIISGLDENIDVLFTALATTRAVGGTGYQYKIDHDLN 94

Query: 251 LKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPG 310
           ++L +         +V++T       S+ F Y   K +IE  +    +   ++ +ILRPG
Sbjct: 95  VELAKAAREKGCSTIVIVTAHGAHADSRFF-YTKMKGEIERDIS---DLGFNRTIILRPG 150

Query: 311 PIVG 314
            ++G
Sbjct: 151 ILLG 154

>KLTH0G08052g Chr7 (650856..651683) [828 bp, 275 aa] {ON} highly
           similar to uniprot|Q12189 Saccharomyces cerevisiae
           YOR095C RKI1 Ribose-5-phosphate ketol- isomerase
          Length = 275

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 5/37 (13%)

Query: 213 TGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDL 249
           T +PD+KN+PT+ S+L     ++  R  +YRA+D +L
Sbjct: 21  TSIPDVKNLPTLHSTL-----EEAKRVAAYRAVDENL 52

>TPHA0G01470 Chr7 complement(303017..303892) [876 bp, 291 aa] {ON}
           Anc_8.700 YOR255W
          Length = 291

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 10/54 (18%)

Query: 28  EEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIKIVKNIFCIN 81
           + K+ L    ++  YL N N++KQK+N          H+  N+++I+KNI+  N
Sbjct: 116 KRKFRLSHFDNLETYLNNDNKLKQKMN----------HECANSVRIIKNIYMKN 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,292,989
Number of extensions: 1971845
Number of successful extensions: 6400
Number of sequences better than 10.0: 54
Number of HSP's gapped: 6582
Number of HSP's successfully gapped: 55
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)