Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1048.212.152ON59759726440.0
TDEL0B051402.152ON59952619470.0
ZYRO0G06512g2.152ON60452419070.0
SAKL0E10956g2.152ON60052418970.0
YNL121C (TOM70)2.152ON61754618720.0
Smik_14.2072.152ON61754618620.0
Skud_14.2112.152ON61754618530.0
TBLA0C055302.152ON61052518300.0
Suva_14.2192.152ON61754618250.0
KLTH0B05170g2.152ON59352618200.0
TPHA0I015102.152ON60352518170.0
Kwal_33.147672.152ON59452618060.0
Ecym_82042.152ON59752417420.0
ABR131W2.152ON59452417300.0
NCAS0G024802.152ON59652216880.0
CAGL0L12936g2.152ON60052616820.0
NCAS0B070102.152ON62552916600.0
KLLA0F24046g2.152ON60452516360.0
KNAG0H035302.152ON61453616140.0
NDAI0F028102.152ON60952416100.0
KAFR0F007202.152ON60852615780.0
Skud_8.1782.152ON63853915110.0
Suva_15.3142.152ON64453915110.0
YHR117W (TOM71)2.152ON63953815030.0
Smik_8.1952.152ON63553314820.0
NDAI0B043402.152ON66453713950.0
CAGL0L04048g2.152ON58751813481e-180
NDAI0B057903.481ON523951449e-09
KLTH0F14542g3.481ON5131011341e-07
KLTH0E02178g5.617ON593931305e-07
CAGL0D05060g3.481ON5101421296e-07
NDAI0I022406.21ON350711276e-07
Kpol_505.413.481ON513971287e-07
ACR005W6.21ON327991251e-06
NCAS0G008105.617ON584861261e-06
AEL224W5.617ON580851261e-06
KAFR0B066103.481ON511971233e-06
CAGL0H08195g5.617ON583851233e-06
TBLA0E033005.617ON582851215e-06
Kwal_55.211753.481ON511951215e-06
KNAG0A079003.481ON512951216e-06
NCAS0F034903.481ON512971206e-06
TDEL0A048405.617ON576851206e-06
SAKL0G07084g5.617ON585851198e-06
Ecym_44133.481ON510911181e-05
TPHA0D028805.617ON585851171e-05
Ecym_30256.21ON318981152e-05
YOR027W (STI1)5.617ON589851162e-05
Skud_15.1925.617ON5891221162e-05
Kpol_1018.695.617ON590851153e-05
AAR083C3.481ON5381471153e-05
Kpol_513.28.506ON374961143e-05
Kwal_55.199355.617ON593861153e-05
TBLA0H033808.506ON375971143e-05
Smik_15.2055.617ON589851153e-05
TPHA0J003406.21ON338811133e-05
KLLA0A07062g5.617ON581861134e-05
Kwal_27.118908.506ON3341411125e-05
Suva_8.805.617ON586851136e-05
KLLA0D01155g6.21ON335831116e-05
KLLA0B10912g3.481ON512971126e-05
TDEL0D055003.481ON5121061117e-05
SAKL0E01210g6.21ON323981108e-05
Suva_7.4083.481ON513911118e-05
Kpol_1037.266.21ON342861109e-05
KAFR0C058905.617ON575851101e-04
NCAS0A00490singletonON620891101e-04
KNAG0M011706.21ON3391131091e-04
TPHA0D038606.328ON12071992e-04
YGR123C (PPT1)3.481ON5131411073e-04
AGL268C8.506ON379971053e-04
ZYRO0A05676g5.617ON572861064e-04
TBLA0C039503.481ON512951054e-04
CAGL0H07425g8.506ON380981054e-04
YBR155W (CNS1)8.506ON3851791054e-04
Smik_6.2153.481ON513911054e-04
Suva_3.956.328ON11170974e-04
SAKL0F03102g3.481ON513951054e-04
NDAI0F009105.617ON583851055e-04
KNAG0B032005.617ON5791181055e-04
Skud_2.2828.506ON385901045e-04
Ecym_55825.617ON584851046e-04
ZYRO0C16522g3.367ON974991046e-04
Ecym_20906.328ON17259996e-04
NCAS0A112003.367ON907991046e-04
TBLA0A072706.21ON373871037e-04
Suva_15.1826.21ON346861028e-04
Kpol_1032.86.21ON3431071019e-04
TDEL0E027505.352ON5641281020.001
TPHA0D032203.481ON513921020.001
TPHA0M016303.367ON10431291020.001
TDEL0B013108.506ON3801261010.001
Skud_7.4323.481ON513911010.001
KLTH0E11748g8.506ON378871000.001
KAFR0H008703.367ON8871291010.002
Suva_4.3613.367ON9631291010.002
KAFR0L004106.21ON331108990.002
YBR112C (CYC8)3.367ON966991000.002
Smik_2.2543.367ON1020991000.002
KAFR0C018505.352ON6461041000.002
KLLA0B09966g8.506ON37098990.002
KNAG0H006103.367ON973991000.002
Skud_2.2403.367ON98499990.002
TDEL0C050903.367ON75999990.003
Smik_2.2958.506ON385186970.003
NCAS0H008306.21ON338120960.004
CAGL0E02739g6.21ON34372950.006
ZYRO0B04224g3.481ON51391960.006
SAKL0A01672g6.328ON12862890.007
SAKL0H10934g8.506ON380127940.007
CAGL0D01364g3.367ON114899950.008
Kwal_56.224336.21ON32286930.009
NDAI0D008106.21ON349138920.012
KAFR0E029808.506ON38097920.012
ZYRO0F08624g8.506ON379125920.012
Ecym_25598.506ON370111920.014
AAR054C6.328ON13361860.018
NDAI0C052908.506ON37998910.020
TPHA0E011105.352ON693125910.020
TBLA0H015203.367ON689258910.022
Suva_4.4058.506ON38589900.023
NCAS0F028705.352ON700111910.024
TDEL0A074306.328ON12486850.024
Skud_15.1686.21ON34886890.027
NCAS0B024008.506ON38097890.027
Smik_4.5795.352ON667111900.028
YDR320C (SWA2)5.352ON668111900.028
ZYRO0C07788g6.21ON33472890.030
KNAG0C055005.352ON585125900.031
NCAS0D026706.21ON351129890.033
NDAI0I004406.328ON12860840.034
TBLA0G010506.21ON35083880.034
NDAI0C043205.352ON706125890.037
NDAI0A051003.367ON100799890.042
YOR007C (SGT2)6.21ON34686880.043
Smik_15.1766.21ON34586870.050
Kpol_172.23.367ON41877870.056
YCR060W (TAH1)6.328ON11158800.067
TDEL0G044806.21ON34386860.069
TBLA0I023106.328ON11661800.083
KLTH0F10428g3.367ON795104850.10
Kwal_23.36703.367ON802103840.16
KLLA0B09262g3.367ON94199840.16
Skud_3.1356.328ON11859780.16
Smik_3.1596.328ON11583780.16
SAKL0B07986g3.367ON88099840.17
Kpol_1006.43.367ON732134830.20
KAFR0J025706.328ON12195770.20
Ecym_34593.367ON111599830.21
Suva_2.4895.352ON659112830.22
KNAG0A039508.506ON38697820.25
TPHA0L014208.506ON374146810.29
KLTH0C11220g6.21ON32772800.35
KNAG0I025206.328ON11790750.39
Kpol_1028.516.328ON11778750.41
TBLA0H019705.352ON840103800.48
KLTH0H02068g7.313ON370111790.53
SAKL0H19272g8.177ON562167790.53
KLTH0H14872g5.352ON623126790.66
KLTH0E10934g8.470ON56892780.83
TBLA0F012303.367ON118989780.87
TBLA0I032503.515ON165869781.0
Suva_8.1295.689ON74149751.8
Kpol_339.135.352ON686111742.3
TBLA0B049907.546ON141082733.2
CAGL0K09240g6.328ON14292693.2
ABR206W5.72ON614173723.5
Skud_4.5865.352ON642111723.7
Kwal_27.117378.470ON57592723.8
NDAI0G037103.5ON112198724.0
KLLA0C08910g6.328ON11559674.2
Skud_15.2455.689ON75049714.9
SAKL0G19712g2.665ON72171715.4
KLLA0C15455g8.470ON56692706.3
TDEL0B016608.470ON549104707.0
KAFR0C038202.665ON70464707.8
KLLA0B10197g5.352ON621152707.8
TPHA0A052905.72ON66676698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1048.21
         (597 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...  1023   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   754   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   739   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   735   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   725   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   721   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   718   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   709   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   707   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   705   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   704   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   700   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   675   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   671   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   654   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   652   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   644   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   634   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   626   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   624   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   612   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   586   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   586   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   583   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   575   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   541   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   523   e-180
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    60   9e-09
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    56   1e-07
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    55   5e-07
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    54   6e-07
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    54   6e-07
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    54   7e-07
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    53   1e-06
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    53   1e-06
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    53   1e-06
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    52   3e-06
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    52   3e-06
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    51   5e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    51   5e-06
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    51   6e-06
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    51   6e-06
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    51   6e-06
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    50   8e-06
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    50   1e-05
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    50   1e-05
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    49   2e-05
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    49   2e-05
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    49   2e-05
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    49   3e-05
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    49   3e-05
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    49   3e-05
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    49   3e-05
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    49   3e-05
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    49   3e-05
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    48   3e-05
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    48   4e-05
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    48   5e-05
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    48   6e-05
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    47   6e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    48   6e-05
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    47   7e-05
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    47   8e-05
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    47   8e-05
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    47   9e-05
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    47   1e-04
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       47   1e-04
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    47   1e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    43   2e-04
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    46   3e-04
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    45   3e-04
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    45   4e-04
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    45   4e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    45   4e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    45   4e-04
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    45   4e-04
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    42   4e-04
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    45   4e-04
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     45   5e-04
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    45   5e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    45   5e-04
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    45   6e-04
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    45   6e-04
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    43   6e-04
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    45   6e-04
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    44   7e-04
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    44   8e-04
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    44   9e-04
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    44   0.001
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    44   0.001
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    44   0.001
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    44   0.001
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    44   0.001
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    43   0.001
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    44   0.002
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    44   0.002
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    43   0.002
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    43   0.002
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    43   0.002
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    43   0.002
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    43   0.002
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    43   0.002
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    43   0.002
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    43   0.003
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.003
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    42   0.004
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    41   0.006
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    42   0.006
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    39   0.007
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    41   0.007
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    41   0.008
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    40   0.009
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    40   0.012
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    40   0.012
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    40   0.012
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    40   0.014
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    38   0.018
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    40   0.020
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    40   0.020
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    40   0.022
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.023
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    40   0.024
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    37   0.024
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    39   0.027
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    39   0.027
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    39   0.028
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    39   0.028
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    39   0.030
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    39   0.031
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    39   0.033
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    37   0.034
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    39   0.034
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    39   0.037
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    39   0.042
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    39   0.043
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    38   0.050
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    38   0.056
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    35   0.067
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    38   0.069
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    35   0.083
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    37   0.10 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    37   0.16 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    37   0.16 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    35   0.16 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    35   0.16 
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    37   0.17 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    37   0.20 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    34   0.20 
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    37   0.21 
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    37   0.22 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    36   0.25 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    36   0.29 
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    35   0.35 
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    33   0.39 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    33   0.41 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    35   0.48 
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    35   0.53 
SAKL0H19272g Chr8 complement(1701420..1703108) [1689 bp, 562 aa]...    35   0.53 
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    35   0.66 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    35   0.83 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    35   0.87 
TBLA0I03250 Chr9 (784716..789692) [4977 bp, 1658 aa] {ON} Anc_3....    35   1.0  
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    33   1.8  
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    33   2.3  
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    33   3.2  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    31   3.2  
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    32   3.5  
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...    32   3.7  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    32   3.8  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    32   4.0  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    30   4.2  
Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080...    32   4.9  
SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} simi...    32   5.4  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    32   6.3  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    32   7.0  
KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {O...    32   7.8  
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...    32   7.8  
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    31   8.1  

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/597 (86%), Positives = 515/597 (86%)

Query: 1   MSSDNSIGAFVARNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSSDNSIGAFVARNK                                             
Sbjct: 1   MSSDNSIGAFVARNKTAIIATVAAGTTAVAAYYYYSQLQQQQQQQQKGSDDSVSKKKKKN 60

Query: 61  XXXXXXXXXXXPCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALK 120
                      PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALK
Sbjct: 61  KKKKNSSSSAKPCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALK 120

Query: 121 YYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLE 180
           YYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLE
Sbjct: 121 YYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLE 180

Query: 181 NFAEAMFDLSVLSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASF 240
           NFAEAMFDLSVLSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASF
Sbjct: 181 NFAEAMFDLSVLSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASF 240

Query: 241 FGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANP 300
           FGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANP
Sbjct: 241 FGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANP 300

Query: 301 DDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESK 360
           DDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESK
Sbjct: 301 DDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESK 360

Query: 361 NYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACL 420
           NYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQY            SDSSNIFPYIQLACL
Sbjct: 361 NYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACL 420

Query: 421 TYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDA 480
           TYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDA
Sbjct: 421 TYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDA 480

Query: 481 IHVGVSPLVGKATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDE 540
           IHVGVSPLVGKATLLARQP              ACKMDSRSEQAKIGLAQLKLQQEEIDE
Sbjct: 481 IHVGVSPLVGKATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDE 540

Query: 541 AITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           AITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI
Sbjct: 541 AITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/526 (68%), Positives = 436/526 (82%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YP+  NGEP L++    ++E +ETY+ ALKD+GN+FFK++ Y++ALKYYNYAL +K+D
Sbjct: 74  PVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKKD 133

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PVFYSNISACYVSLG L+KVVE+STKALELKPDYSKALLRRASANE+LEN+A+AMFDLSV
Sbjct: 134 PVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSV 193

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLK 251
           LSLNGDFN +SIEPMLERNLNKQAM VLKDK+ ++  QQLPSNT LASFFGIF PETT  
Sbjct: 194 LSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNNVSQQLPSNTALASFFGIFPPETTFA 253

Query: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311
           N++E++EADV L N L +LYKR SE Y +ADE+F K+A  +  +L   PDD VLKEKTA 
Sbjct: 254 NYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVLKEKTAI 313

Query: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371
           ALE+NGIFKFLKNDPL +H+DI+++I+LHPR+N+YIY ALIMADKG+++ Y+ +FDKA+ 
Sbjct: 314 ALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQYFDKAIA 373

Query: 372 VDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCE 431
           +DPN  P YYHRGQM++++ QY             D +NIFPYIQLACL Y E KFDDCE
Sbjct: 374 LDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDKFDDCE 433

Query: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491
           TLFSEAKRKFPTAPEVPNFYAE+L DKGD +AA KQY+IAKRLEE+LD IHVGV+PLVGK
Sbjct: 434 TLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALDGIHVGVAPLVGK 493

Query: 492 ATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDL 551
           ATLLARQP              AC+ D  SEQAK+GLAQLKLQQEE+DEAI LFEEA++L
Sbjct: 494 ATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDEAINLFEEAANL 553

Query: 552 ARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           AR ++EKLQATTFAEA+KVQK+I+ADPVV+AKI+ TLAAYR QG++
Sbjct: 554 ARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/524 (68%), Positives = 424/524 (80%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133
           YP+D  GEP L + A  +EEQKE++S ALKDKGN+FFK++ Y++ALKYY+YAL LK+DPV
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140

Query: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193
           FYSNISACYVS+  L+KVVE+STKALELKPDYSKALLRRASANE+LEN+ +AMFDLSVLS
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNF 253
           LNGDF  +SIEPMLERNLNKQAM VLKDK+     Q LPS+T LASFFGIFTPET   N+
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANY 260

Query: 254 DESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATAL 313
           DE++EAD +L   L NLYKR SE Y  ADE FS+A ++Y K  E N DD  LKEK A AL
Sbjct: 261 DETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIAL 320

Query: 314 EYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVD 373
           E+ GIF+FLKNDPLG+HED+Q++I+LHPRVN+YIY ALIMADKG+++ Y++FFDKA+ +D
Sbjct: 321 EHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLD 380

Query: 374 PNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCETL 433
           P +A VYYHRGQM+F++ QY             +  NIFPYIQLACL Y E KFDDCETL
Sbjct: 381 PKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETL 440

Query: 434 FSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKAT 493
           FSEAKRKF TAPEVPNF+AE+L DKGD + A KQYDIAKRLEE++D IHVG+SPLVGKAT
Sbjct: 441 FSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKAT 500

Query: 494 LLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLAR 553
           LLARQP              AC  D RSEQ K+GLAQLKLQQE+ID+AI LFEEA+ LAR
Sbjct: 501 LLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLAR 560

Query: 554 NMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
            ++EKLQATTFAEA+KVQK+IRADP+V+AKI+ TLAAY+ QG+I
Sbjct: 561 TVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/524 (67%), Positives = 427/524 (81%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133
           YP+D NGEP L D    T+EQKE Y++ LKDKGN+FFKE+K++DA+KYYN AL+LK+DPV
Sbjct: 77  YPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALELKKDPV 136

Query: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193
           FYSN SACYVS+G LEKVVE +T AL+LK DYSK LLRRASANE+L N+A+AMFDLS LS
Sbjct: 137 FYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSALS 196

Query: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNF 253
           L GDFN ASIEPMLERN+NKQAM VLK+K+      +LPSNT LASFFGIF PET+ +N+
Sbjct: 197 LYGDFNGASIEPMLERNMNKQAMLVLKEKLEEKKDHRLPSNTSLASFFGIFEPETSFENY 256

Query: 254 DESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATAL 313
           DES EAD  LL  L NLYKR SE Y  ADESF+KAA +Y   LE +P++E+LK+K A AL
Sbjct: 257 DESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEILKQKAAIAL 316

Query: 314 EYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVD 373
           E+ GIFKFLKNDPL +H+D+++++E HPRVN+YIY ALIMADKG++  YF+ FDKAL++D
Sbjct: 317 EHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFENFDKALELD 376

Query: 374 PNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCETL 433
           PN A VYYHRGQM+F++QQY             + +NIFPYIQLACL Y E KF+DCETL
Sbjct: 377 PNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDCETL 436

Query: 434 FSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKAT 493
           FSEA+RKFPTAPEVPNFYAE+L+DKGD   A KQY+IA++LE++LD IHVG++PLVGKAT
Sbjct: 437 FSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGIAPLVGKAT 496

Query: 494 LLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLAR 553
           LLAR+P              AC+ D RSEQAKIGLAQLKLQQEE+DEAITLFEEA+DLAR
Sbjct: 497 LLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAITLFEEAADLAR 556

Query: 554 NMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           + +EKLQATTFAEA+K+QKKIRADP+++AKI+ TLAAYR QG+I
Sbjct: 557 SFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/546 (65%), Positives = 422/546 (77%), Gaps = 20/546 (3%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YP+ SNGEPD  + ANFT E+K+ Y++ALKDKGNQFF+ +KY+DA+KYYN+AL+LK+D
Sbjct: 72  PIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKED 131

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PVFYSN+SACYVS+G+L+KVVE STKALELKPDYSK LLRRASANE L  FA+AMFDLSV
Sbjct: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSV 191

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS--------------------SDAKQQL 231
           LSLNGDFN+ASIEPMLERNLNKQAM  LK+K                       D ++ L
Sbjct: 192 LSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENL 251

Query: 232 PSNTFLASFFGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAES 291
           PS T +ASFFGIF PE T  N+DESNEAD EL+N L NLYKR  ESY  ADESF+KAA  
Sbjct: 252 PSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARL 311

Query: 292 YVKQLEANPDDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSAL 351
           + +QL+ N +DE LKEK A +LE+ GIFKFLKNDPLG+HEDI+++IEL PRVN+YIY AL
Sbjct: 312 FEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371

Query: 352 IMADKGESKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNI 411
           IMAD+ +S  Y+++FDKAL +D N++ VYYHRGQM+F+ Q Y             D  NI
Sbjct: 372 IMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431

Query: 412 FPYIQLACLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIA 471
           FPYIQLACL Y E KFDDCETLFSEAKRKFP APEVPNF+AE+LTDK DFD A KQYD+A
Sbjct: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491

Query: 472 KRLEESLDAIHVGVSPLVGKATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQL 531
             LE  LD I+VG++PLVGKATLL R P              A K+D RSEQAKIGLAQ+
Sbjct: 492 IELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQM 551

Query: 532 KLQQEEIDEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAY 591
           KLQQE+IDEAITLFEE++DLAR MEEKLQA TFAEA+KVQ++IR+DPV+  KIQ TLA  
Sbjct: 552 KLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKL 611

Query: 592 REQGLI 597
           REQGL+
Sbjct: 612 REQGLM 617

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/546 (65%), Positives = 421/546 (77%), Gaps = 20/546 (3%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YP+ SNG+PD  + ANFT E+K+ Y++ALKDKGNQFF+ +KY+DA+KYYN+AL+LK D
Sbjct: 72  PVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDD 131

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PVFYSN+SACYVS+G+L+KVVE STKALELKPDYSK LLRRASANE L NFA+AMFDLSV
Sbjct: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS--------------------SDAKQQL 231
           LSLNGDFN+ASIEPMLERNLNKQAM  LK+K                       D  + L
Sbjct: 192 LSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENL 251

Query: 232 PSNTFLASFFGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAES 291
           PS T +ASFFGIF PE T  N+DESNEAD +L+N L NLYKR  ESY  ADESF+KA + 
Sbjct: 252 PSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKL 311

Query: 292 YVKQLEANPDDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSAL 351
           + +QL+ N +DE  KEK A +LE+ GIFKFLKNDPLG+HEDI+++IEL PRVN+YIY AL
Sbjct: 312 FDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371

Query: 352 IMADKGESKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNI 411
           IMAD+ +S  Y+++FDKAL +D N++ VYYHRGQM+F+ Q Y             D  NI
Sbjct: 372 IMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431

Query: 412 FPYIQLACLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIA 471
           FPYIQLACL Y E KFDDCETLFSEAKRKFP APEVPNF+AE+LTDK DF+ A KQYD+A
Sbjct: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLA 491

Query: 472 KRLEESLDAIHVGVSPLVGKATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQL 531
             LE  LD I+VG++PLVGKATLL R P              A K+D RSEQAKIGLAQ+
Sbjct: 492 IELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQM 551

Query: 532 KLQQEEIDEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAY 591
           KLQQE+IDEAITLFEE++DLAR MEEKLQA TFAEA+KVQK+IR+DP++ AKIQ TLA  
Sbjct: 552 KLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKL 611

Query: 592 REQGLI 597
           REQGL+
Sbjct: 612 REQGLM 617

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/546 (64%), Positives = 423/546 (77%), Gaps = 20/546 (3%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YP+ SNGEPD    ANFT E+K+ Y++ALKDKGNQ+F+ +KY+DA+KYYN+AL+LK+D
Sbjct: 72  PVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PVFYSN+SACYVS+G+L+KVVE STKALE+KPDYSK LLRRASANE L NFA+AMFDLSV
Sbjct: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSV 191

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS--------------------SDAKQQL 231
           LSLNGDFN+ASIEPMLERNLNKQAM  LK+K                       D ++ L
Sbjct: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENL 251

Query: 232 PSNTFLASFFGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAES 291
           PS T +ASFFGIF PE T  N+DE N+AD EL++ L NLYKR  ESY  ADESF+KAA+ 
Sbjct: 252 PSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKL 311

Query: 292 YVKQLEANPDDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSAL 351
           + +QL+ + +DE LKEK A +LE+ GIFKFLKNDPLG+HEDI+++IEL PRVN+YIY AL
Sbjct: 312 FEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMAL 371

Query: 352 IMADKGESKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNI 411
           IMAD+ +S  Y+++FDKAL ++PN++ VYYHRGQM+F+ Q Y             D  NI
Sbjct: 372 IMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431

Query: 412 FPYIQLACLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIA 471
           FPYIQLACL Y E KFDDCETLFSEAKRKFP APEVPNF+AE+LTDK DFD A KQYD+A
Sbjct: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491

Query: 472 KRLEESLDAIHVGVSPLVGKATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQL 531
             LE  LD I+VG++PLVGKATLL R P              A K+D RSEQAKIGLAQ+
Sbjct: 492 IELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQM 551

Query: 532 KLQQEEIDEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAY 591
           KLQQE+IDEAI LFEE++DLAR MEEKLQA TFAEA+KVQ+KIR+DP++ AKIQ TLA  
Sbjct: 552 KLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKL 611

Query: 592 REQGLI 597
           REQGL+
Sbjct: 612 REQGLM 617

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/525 (65%), Positives = 418/525 (79%), Gaps = 1/525 (0%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YP+  NGEP+L +   FTEE+KE YS+ALKDKGN  FK  K+E+A+KYYN+A++LK++
Sbjct: 84  PIYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKEN 143

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           P+FYSN+SACYVSL  LE++++   KALELKPDYSK LLRRA+ANE LEN+A+AMFDLSV
Sbjct: 144 PIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSV 203

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLK 251
           LSLNGD+N ASIEP+LERNLNKQAM VLKDK+ +    QLPS+T L++FFGIF PE + +
Sbjct: 204 LSLNGDYNGASIEPILERNLNKQAMSVLKDKLKNSKDDQLPSDTSLSAFFGIFKPELSFE 263

Query: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311
           N+DE+N+AD ELLN L +L+KR+SESYLIAD+SF  A E Y+KQLE  PDD  LK K + 
Sbjct: 264 NYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKVKASI 323

Query: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371
           A EY GIF FLKND  G+ E+I +SI+L+PR+N+YIY ALI+ADKGES++Y D+FDKAL 
Sbjct: 324 AYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFDKALK 383

Query: 372 VDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCE 431
           +D  S  VYYHR Q++F++Q +             D +NIFPYIQLACLTY E KFDDCE
Sbjct: 384 LDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCE 443

Query: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEE-SLDAIHVGVSPLVG 490
           TLFSEAKRKFPT PEVPNFYAEVLTDKGDFD A K Y+ A+RLEE S D IHVGV+PL+G
Sbjct: 444 TLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVAPLIG 503

Query: 491 KATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASD 550
           KATLLAR+P              A ++D RSEQAKIGLAQLKLQ+EEIDE+I LFEE++D
Sbjct: 504 KATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEESAD 563

Query: 551 LARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQG 595
           LAR MEEKLQATTFAEA+KVQK IRADP+++ KI+ TLAAYR Q 
Sbjct: 564 LARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/546 (63%), Positives = 418/546 (76%), Gaps = 20/546 (3%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YP+ +NGEPD    A+FT E+K+ Y++ALKDKGNQ+F+ +KY+DA+KYYN+AL+LK+D
Sbjct: 72  PIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKED 131

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PVFYSN+SACYVS+G+L+KVVE STKALELKPDYSK LLRRASANE L NFA+AMFDLSV
Sbjct: 132 PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSV 191

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS--------------------SDAKQQL 231
           LSLNGDFN+ASIEPMLERNLNKQAM  LK+K                       D ++ L
Sbjct: 192 LSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESL 251

Query: 232 PSNTFLASFFGIFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAES 291
           PS T +ASFFGIF PE T  N DESNEAD EL+N L NLYKR  +SY  ADESF+KA + 
Sbjct: 252 PSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKL 311

Query: 292 YVKQLEANPDDEVLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSAL 351
           +  QL+ + +DE +KEK A +LE+ GIFKFLKNDPLG+HEDI ++I+L PRVN+YIY AL
Sbjct: 312 FEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMAL 371

Query: 352 IMADKGESKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNI 411
           IMAD+ +S  Y+++FDKAL +D N++ VYYHRGQM+F+ Q Y             D  NI
Sbjct: 372 IMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENI 431

Query: 412 FPYIQLACLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIA 471
           FPYIQLACL Y E KFDDCETLFSEAKRKFP APEVPNF+AE+LTDK DFD A KQYD+A
Sbjct: 432 FPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLA 491

Query: 472 KRLEESLDAIHVGVSPLVGKATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQL 531
             LE  L+ I+VG++PLVGKATLL R P              A K+D RSEQAKIGLAQ+
Sbjct: 492 IELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQM 551

Query: 532 KLQQEEIDEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAY 591
           KLQQE+IDEAI LFEE++DLAR MEEKLQA TFAEA+KVQ++IR+DPV+  KIQ TLA  
Sbjct: 552 KLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKL 611

Query: 592 REQGLI 597
           REQGL+
Sbjct: 612 REQGLM 617

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/526 (64%), Positives = 420/526 (79%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YP++  GEPDL + A  ++EQK+ Y++ LKDKGN+FFK +KY++A++YY++A+++K+D
Sbjct: 68  PSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKED 127

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PVFYSN SACYVSLG  EKVVE +T AL+LKPDYSK LLRRASANE+L NFA+AMFDLS 
Sbjct: 128 PVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSA 187

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLK 251
           +SL GDF+ ASIEP+LERN+NKQ+M VLK+K+    + +LPSNT LASFFGIF PETT +
Sbjct: 188 VSLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQEYKLPSNTSLASFFGIFQPETTFE 247

Query: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311
           N+D+++EAD  LL  L NLYKR ++ Y  AD SF+KA +++   LE NP+D  LK K A 
Sbjct: 248 NYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAAI 307

Query: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371
           ALE+ GIFKFLKNDP+ +HED+++++E  PR N YIY ALIMADKG++  YFD F+KAL 
Sbjct: 308 ALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALK 367

Query: 372 VDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCE 431
           +DP+ A VYYHRGQM+F++QQ+               SNIFPYIQLACLTY EGKFDD E
Sbjct: 368 LDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSE 427

Query: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491
           TLFSEA+RKFPTAPEVPNFYAE L+DKGD   A KQYDIA +LE++LD IHVGVSPL+GK
Sbjct: 428 TLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIGK 487

Query: 492 ATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDL 551
           ATLL+R+P              AC+ D RSEQAKIGLAQLKLQQE+IDEAI LFEEA+DL
Sbjct: 488 ATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADL 547

Query: 552 ARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           AR+ +EKLQATTFAEA+K+QKKIRADPVV+AKI+ TLAAYR QG+I
Sbjct: 548 ARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/525 (65%), Positives = 423/525 (80%)

Query: 73  CYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDP 132
            YP+ SNGEPDL    +F++E KE Y++ALKDKGN +FK+Q +E+ALKYYNYAL LKQDP
Sbjct: 79  IYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTLKQDP 138

Query: 133 VFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           VFYSNISACYVSLG LEKVVESST+AL+LK DYSKALLRRASA E+L N+ +AM DLSVL
Sbjct: 139 VFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVL 198

Query: 193 SLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKN 252
           SLNGDFN ASIEPMLERNLNKQAM+VLK+K++ +  Q LPSNT LASFFG+F PE +L N
Sbjct: 199 SLNGDFNGASIEPMLERNLNKQAMQVLKEKIAENKPQLLPSNTSLASFFGVFKPEVSLNN 258

Query: 253 FDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATA 312
           F+E++E++ ELLN L NLY R ++ YL+ADESF KA +   K+ E N ++  +KEK A A
Sbjct: 259 FNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIKEKYAIA 318

Query: 313 LEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDV 372
           LEYNGI KFLKNDPL +H DIQ++I + PRVN+YIY++LI+ADKGE++     FD A+++
Sbjct: 319 LEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNFDAAINL 378

Query: 373 DPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCET 432
           D  +A  YYHRGQ++FL+QQY             D SNI PYIQLACL Y E KF+DCET
Sbjct: 379 DATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDCET 438

Query: 433 LFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKA 492
           LFSEA+RKFPTAPEVPNFYA+VL ++ +FD A KQYDI+K+LEE+++ IHVG++P++GKA
Sbjct: 439 LFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGIAPMIGKA 498

Query: 493 TLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLA 552
           TLLAR P              ACK+D RSEQAKIGLAQLKLQQEE+DEAI LFEEA+ LA
Sbjct: 499 TLLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEEAAFLA 558

Query: 553 RNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           RNM+EKLQATTFAEASKVQKK+R+DPV+N KIQ TLAAY++QGL+
Sbjct: 559 RNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM 603

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/526 (64%), Positives = 414/526 (78%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P +P+D  GEPDL      + E+K+ +++ LKDKGN+FFK +++EDALKYY+ A+++K+D
Sbjct: 69  PSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEVKED 128

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PVFYSN SACYVSLG  EKVVE +T AL+LKPDYSK LLRRASANE+L  FA+AMFDLS 
Sbjct: 129 PVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSA 188

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLK 251
           +SL GDFN +SIEP+LERN+NKQAM VLK+K+    + +LPSNT LASFFGIF PET+ +
Sbjct: 189 VSLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYKLPSNTSLASFFGIFQPETSFE 248

Query: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311
           N+DE++EAD  LL+ L NLYKR S  Y  AD +FSKA + Y   LE N +D  LK+K A 
Sbjct: 249 NYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAAI 308

Query: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371
           ALE+ GIFKFLKNDP+ +HED+++++E  PR N YIY ALIMADKG++  YFD F+KAL+
Sbjct: 309 ALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALE 368

Query: 372 VDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCE 431
           +DPN A VYYHRGQMHF++QQ+             + SNIFPYIQLACLTY EGKF D E
Sbjct: 369 LDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSE 428

Query: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491
           TLFSEA+RKFPT+PEVPNFYAE L+DKGD   A K+YDIA +LE +LD IHVGVSPL+GK
Sbjct: 429 TLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIGK 488

Query: 492 ATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDL 551
           ATLL+R+P              AC+ D RSEQAKIGLAQLKLQQE+IDEAI LFEEA+DL
Sbjct: 489 ATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADL 548

Query: 552 ARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           AR+ +EKLQATTFAEA+K+QKKIRADP+V+AKI+ TLAAYR QG+I
Sbjct: 549 ARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/524 (62%), Positives = 413/524 (78%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133
           YP+DSNGEPDL    +FTEEQKE YS+A+KDKGN+ FKE+KYE+A+KYY+ AL LK+DPV
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPV 132

Query: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193
           FYSN SAC+V L  LEKVVE +T ALELKPDYSK LLRRA+ANE+L NFA+AM DLS +S
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192

Query: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNF 253
           L G +N  SIEP+LERN+NKQAM+VLK K++  +K QLPSNT LASFFGIF  ET+  N+
Sbjct: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252

Query: 254 DESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATAL 313
           DE +EAD  LL  L  L +RK+ SY ++DE F+KAA+      +A+ +D  L+ K A AL
Sbjct: 253 DEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIAL 312

Query: 314 EYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVD 373
           E+ GIFKFLKN+PL +++ +Q++++LHPR N+YIY ALIMADKG++  Y  +FDKAL++ 
Sbjct: 313 EHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELA 372

Query: 374 PNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCETL 433
           PNS+ VYYHRGQM+F++QQ+             +  NIFPYIQLACL Y E KF+DCETL
Sbjct: 373 PNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETL 432

Query: 434 FSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKAT 493
           FSEA+RKFPTAPEVPNFYAE+L+DKGD ++A K+Y+ A++LE++ + IHVGV+PLVGKAT
Sbjct: 433 FSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKAT 492

Query: 494 LLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLAR 553
           +LARQ               ACK D RSEQAKIGLAQLKLQQE++DEAI LFEEA+DLAR
Sbjct: 493 VLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLAR 552

Query: 554 NMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
             EEKLQATTFAEA+K+QK+IRADP+++AKIQ TL AYR QG++
Sbjct: 553 AFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/524 (62%), Positives = 406/524 (77%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133
           YP+D NGEPDL   A FTEEQKE Y++ALKDKGN+ FK+Q+YE+A+K+Y+ AL LK+DPV
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193
           FYSN SACYV L  LEKVVE +T AL+LKPDYSK LLRRA+ANE+L N+A+AM DLS +S
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNF 253
           L G ++  +IEP+LERN+NKQAM+VLK K+S   K +LPSNT LASFF IF  ET+L+N+
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENY 249

Query: 254 DESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATAL 313
           DE++EAD  LL  L  L+ R++ SY IADE+F+ A E +    EANPD+  LK+K A AL
Sbjct: 250 DETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIAL 309

Query: 314 EYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVD 373
           E+ GI KFLKN+PL +H  +Q++I+L PR N+YIY  LIMADKG++  Y   F+KAL++D
Sbjct: 310 EHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELD 369

Query: 374 PNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCETL 433
           P S+  YYHR QM+F+ QQ+             D S ++PYIQLACL Y E KFDDCETL
Sbjct: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429

Query: 434 FSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKAT 493
           FSEA+R+FPTAPEVPNFYAE+L+DKGDF+ A K+YD A++LE++ + IHVGV+PLVGKA 
Sbjct: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAA 489

Query: 494 LLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLAR 553
           LLARQP              AC+ D RSEQAKIGLAQLKLQQEE+DEAI LFE A+DL+R
Sbjct: 490 LLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSR 549

Query: 554 NMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
             EEKLQATTFAEA+K+QK+IRADPV++AKIQ TL AYR QG++
Sbjct: 550 AFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/522 (61%), Positives = 397/522 (76%), Gaps = 1/522 (0%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YPID+NGEP L D     ++ KE ++ ALK+KGN  FK++ +E+A+KYY +AL LK+D
Sbjct: 68  PIYPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKED 127

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PV+YSNISACY SL N EKV+E +TKAL L+PDYSK L+RRA+A E L NF +AMFDLSV
Sbjct: 128 PVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSV 187

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS-SDAKQQLPSNTFLASFFGIFTPETTL 250
            SLN D ++ASIEP+LERNLN+QAM VL  K+  +D K QLPSNT L SFFGIF PE + 
Sbjct: 188 CSLNTDMSDASIEPILERNLNQQAMFVLNTKLGVTDKKSQLPSNTALTSFFGIFKPELSF 247

Query: 251 KNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTA 310
            N+D++ E D ELLN L NLY+  +E Y  AD SF+KA E ++KQL   PDDE +KEKTA
Sbjct: 248 ANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTA 307

Query: 311 TALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKAL 370
            ALE+ GIFKFLKN+PL +HEDI++++ELHPR+N+YIY ALI+ADKG++ NYF  ++KA+
Sbjct: 308 IALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAM 367

Query: 371 DVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDC 430
            +D  +A +YYHRGQM+F++QQY             D  NIFPYIQLACL+Y E KFDDC
Sbjct: 368 KLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDC 427

Query: 431 ETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVG 490
           ETLFSEA+RKFP + EVPNFYAE+L DKGDFDAA K+Y+ A  LE+  DA+HVG++PLVG
Sbjct: 428 ETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPLVG 487

Query: 491 KATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASD 550
           KATLL R P              A K D RSEQAKI L QLKLQQE+IDEAI LFE A+ 
Sbjct: 488 KATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESAAT 547

Query: 551 LARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYR 592
           LAR  EEKLQATTFAEA+K+QK+IRADP ++AKIQ T+AA R
Sbjct: 548 LARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALR 589

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/526 (61%), Positives = 401/526 (76%), Gaps = 11/526 (2%)

Query: 81  EPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISA 140
           +PD+      +E+QK+ Y+ ALKDKGN  FKE+++EDA+++YN+A+ L +DPVF+SNISA
Sbjct: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134

Query: 141 CYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNE 200
           CYVSLG+L+KVVESST+ALELKPDYSKALLRRASA EN+  + +AMFD+SVLSLNGDFN 
Sbjct: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194

Query: 201 ASIEPMLERNLNKQAMRVLKDKMSSDA----------KQQLPSNTFLASFFGIFTPETTL 250
           +SIEPMLERNLNKQA+RVLK+ M  DA          +Q+LPSNT L+SFFGIF PET +
Sbjct: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEI 254

Query: 251 KNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTA 310
             +DESNEADV L+  L  LY   S+ Y +ADE F+KAA+ Y +QL AN +D   KEK A
Sbjct: 255 PAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNNDAAFKEKAA 313

Query: 311 TALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKAL 370
           TALEY GIF FLKND   S ++++ ++ LHPRVN YIY AL MAD+G+S++YF +F+KA+
Sbjct: 314 TALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAI 373

Query: 371 DVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDC 430
            +DPN+A VYYHRGQM+F++Q Y            SD  NIFPYIQLACL Y E K  +C
Sbjct: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433

Query: 431 ETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVG 490
           E LF EA++ FPTAPEVPNFYAE+L DKGD D A KQY+IA RLE     IHVG++PLVG
Sbjct: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493

Query: 491 KATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASD 550
           KAT+LARQP              ACK D RSEQAK+GLAQL+LQQE++DEAI LFEEA+ 
Sbjct: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553

Query: 551 LARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGL 596
           +AR ++EKLQA TFAEA+KVQK+IRADPVV+ K++ TLAAY+ Q +
Sbjct: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/529 (58%), Positives = 404/529 (76%), Gaps = 5/529 (0%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133
           YP + + +PD+    +   E+++  S+ LKDKGN++FK + Y +A+KYYN ALDL +DP+
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156

Query: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193
           FYSNISACYVSLG L+KV+ESSTKALEL P+YSKALLRRASANE+LEN+++A+FDLSVLS
Sbjct: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216

Query: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKM-----SSDAKQQLPSNTFLASFFGIFTPET 248
           LNGD++ ASIEP+LERNLNKQA++VL ++M     S+  +Q LPS T L SFFGIF PE 
Sbjct: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276

Query: 249 TLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEK 308
           T +N++E+++ADVELL  L NL+KR  + YL AD++F KA+  ++++L  NP D+ L EK
Sbjct: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336

Query: 309 TATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDK 368
           TA ALEYNGIF+FLKND LG+  DI+++I   PRVN+Y+Y ALI ADK  S+ Y  +FDK
Sbjct: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396

Query: 369 ALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFD 428
           AL+++P+S  VYYHRGQ++F++Q Y             D +NIFPYIQLACL Y E  FD
Sbjct: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456

Query: 429 DCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPL 488
            C+ LF E ++KFPT PEVP FYAE+L DKGDF  A KQYDIA RLE++   IHVG++PL
Sbjct: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516

Query: 489 VGKATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEA 548
           VGKAT+LARQP              AC++D RSEQA +GLAQLKLQ EE+D AI LFE+A
Sbjct: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576

Query: 549 SDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           +DL+R M+EK+QA TFAEA+K+QK+IRADPV++AK+   LA+YR QG+I
Sbjct: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/525 (59%), Positives = 394/525 (75%), Gaps = 2/525 (0%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133
           YP+D+NG+PDL     FT EQ + Y++ALKDKGN+FFK + +E A++YY  A+ LK+DPV
Sbjct: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138

Query: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193
           FYSN SA YVS+ N EKVVE +T AL+LKPDYSK  LRRASA ENL  F++AMFDLS +S
Sbjct: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198

Query: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQ--LPSNTFLASFFGIFTPETTLK 251
           L G+++  S+E +LERN+NKQA +VL +K+  +  ++  LPSNT LASFFGIF PET+  
Sbjct: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258

Query: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311
           ++D  NEADVEL   L NLYK ++  Y +ADE F+KAAE Y K+LE++PD+E LK+K A 
Sbjct: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318

Query: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371
           A E+ GIFKF KNDP+ +H +++ S+ L+PR + YIY ALIMADKGE+  Y ++FDKAL+
Sbjct: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378

Query: 372 VDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCE 431
           +DPN + VYYHRGQMHF+ + +             +  NIF YIQ ACL + + +FDDCE
Sbjct: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438

Query: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491
           TLFSEA+RKFPTAPEVPNFYAE+L  K   DAA KQYDIA +LE++L  IHVG++P++GK
Sbjct: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498

Query: 492 ATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDL 551
           AT L R P              ACK+D RSEQAKIGLAQLKLQQEEID+AI LFE+A+DL
Sbjct: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558

Query: 552 ARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGL 596
           +R+ +EKLQATTFAEA+KVQKKIRADP +  KI   +AAYR QGL
Sbjct: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/536 (58%), Positives = 391/536 (72%), Gaps = 10/536 (1%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P YPI ++GEPDL    ++T EQ+ETY++ALKDKGN+ FKE+  E+A+KYY +AL+ K+D
Sbjct: 79  PVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKD 138

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           PVFY+NISACYVSL + EKV+E+  KALELKPDYSK LLRRA+  EN+ENFA+AMFDLSV
Sbjct: 139 PVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV 198

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDA---KQQLPSNTFLASFFGIFTPET 248
           LSLN DF+ ASIEPMLERNLNKQAM++LK+++ +     +Q LPS+T +ASFFGIF PET
Sbjct: 199 LSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPET 258

Query: 249 TLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEV---- 304
             K +DE+ EAD  L   L+ L+      ++ AD  F++A   Y +      D+E     
Sbjct: 259 EFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQN 318

Query: 305 LKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFD 364
           L EK A ALEY+GIFKFLKND +G+   +  +I+L PRVN+YIY AL  AD GES  Y  
Sbjct: 319 LNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVT 378

Query: 365 FFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHE 424
            FDKAL+++PNS+  YYHRGQ++F++Q Y             D+ NIF YIQLACL Y E
Sbjct: 379 NFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYRE 438

Query: 425 GKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDA---I 481
           G  D+C+ LF EA+ KFP APEVP FYAE+L DKGDF  A+KQYD+AKRLEE++ A   I
Sbjct: 439 GDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGI 498

Query: 482 HVGVSPLVGKATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEA 541
            VGV+PLVGKAT+LARQP              ACK D RSEQAK+GLAQL LQQE++D A
Sbjct: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558

Query: 542 ITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           I +FEEA+DLAR  +EKLQA TFAEA+KVQKKIRADP++ AK++  LA YR QG+I
Sbjct: 559 IKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/524 (58%), Positives = 394/524 (75%), Gaps = 1/524 (0%)

Query: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131
           P Y +DSNGEP+L D  + TEE K  +++ALKDKGN+ FK  K+EDA+KYY+YAL LK D
Sbjct: 83  PIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDD 142

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           P++YSNISACY SL   EKV+E +TKAL+L+P +SK L+RRA A E + NF +AMFD+S 
Sbjct: 143 PIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202

Query: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLK 251
            SLNGD N+ASIEP+LER LNKQA  VLK+K+S++ +Q LPS+T LASFF +F PET+  
Sbjct: 203 CSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFA 262

Query: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311
           N++ESNEAD EL+N L NLYK   E + IAD+SF KAAE +  QL  N D+E +KEKTA 
Sbjct: 263 NYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAI 322

Query: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371
           ALEY+GI  ++KN+ L +H+ I+ +IELHPRVN+YIY +LI +D   +  Y   FDKAL+
Sbjct: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382

Query: 372 VDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCE 431
           ++PN+  +YYHRGQ +F++QQY             D +NIF YIQLACL Y E KFDDCE
Sbjct: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442

Query: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLE-ESLDAIHVGVSPLVG 490
           TLFSEA+RKFPTAPEVPNF+AEVL D+G+ + A K++D A  LE ++ + IHVG++PL+G
Sbjct: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502

Query: 491 KATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASD 550
           KATLL  +P              AC  D RSEQA++GLAQLKLQQE+IDEAI LFEEA++
Sbjct: 503 KATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAE 562

Query: 551 LARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQ 594
           LA++ EEKLQATTFAEA+K+QK+IRADP ++AKI+ T+   R Q
Sbjct: 563 LAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/526 (57%), Positives = 386/526 (73%), Gaps = 2/526 (0%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133
           +P   NGEPD     N T +QK+ +++ LKDKGN++FKE+ YE+ALK+Y++AL LK+DPV
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142

Query: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193
           FYSN+SACYVSL  L+KV+E STKALELKPDYSKALLRRA+ANE LEN+++AMFDLSVLS
Sbjct: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202

Query: 194 LNGDFNEASIEPMLERNLNKQAMRVL--KDKMSSDAKQQLPSNTFLASFFGIFTPETTLK 251
           LN DFN A+IEPMLERNLNKQA++VL  K K  S  + +LPSNT +ASFF IFTPE +  
Sbjct: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262

Query: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311
           ++DE ++AD ELLN L  LY  K+  Y IA+ SF+K+ E Y   LE+  D E + +K A 
Sbjct: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322

Query: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371
           ALEY GIF FL+ND + + +   +SI   PRVN+YIY ALI ADK E      +FD+AL 
Sbjct: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382

Query: 372 VDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCE 431
           +DPN +P+YYHRGQ++F++Q Y             D +NIFPYIQLACL+Y EG F+DC+
Sbjct: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442

Query: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491
             F  A++KFP APE+P F  E+L DKGD D A+KQY+   RLE +  +IHVG++PL+GK
Sbjct: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502

Query: 492 ATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDL 551
           AT LARQP              A + D RSEQA +GLAQLKLQ+E++D AI LFE+ASD 
Sbjct: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562

Query: 552 ARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           +R+M+EKLQATTFAEA+KVQK+IRADPV+ AK++ TLA Y  QG +
Sbjct: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/539 (54%), Positives = 378/539 (70%), Gaps = 15/539 (2%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDP 132
           YP+ S+GEPD+         Q++ Y+V LKDKGN FF  + ++DA+KYY +A++L   DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 133 VFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           VFYSN+SACY+S G+L KVVE +TKALE+KPD+SKALLRRASANE+L NF +AMFDLSVL
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 193 SLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQ----LPSNTFLASFFGIFTPET 248
           SLNGDF+ ASIEPMLERNLNKQAM+VL   +S ++  +    LPSNT LASFFGIF P+ 
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279

Query: 249 TLKNFDESNEADVE---LLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVL 305
            +      +  D     LL AL  LY   SE YLIA+  F+KA ++Y   L A+  D  +
Sbjct: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339

Query: 306 KEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDF 365
           +   A A  Y GIF+FLKND L +   +Q SI LHP  N+YI+ AL +ADK  S+ +F F
Sbjct: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399

Query: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEG 425
           F KA+D+DP  +P YYHRGQM+F+ Q Y             +  NI+PYIQLACL Y +G
Sbjct: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459

Query: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGV 485
           KF + E LF+E K KFPT PEVP F+AE+LTDKGD++ A KQYDIAKRL+E    IHVG+
Sbjct: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519

Query: 486 SPLVGKATLLARQPXXXXXX-------XXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEI 538
            PL+GKAT+LARQ                      AC +D RSEQAKIGLAQLKLQ E+I
Sbjct: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579

Query: 539 DEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           D+AI LF++++ LAR M+EKLQATTFAEA+K+QK++RADP+++AK++ TLA+YR  G+I
Sbjct: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/539 (55%), Positives = 377/539 (69%), Gaps = 15/539 (2%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDP 132
           YP+  +GEPD+      +  Q++ ++V LKDKGN FF  + + DA+KYY YA++L   DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 133 VFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           VFYSNISACY+S G+L+KVVE +TKALE+KPD+SKALLRRASANE+L NF +AMFDLSVL
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 193 SLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSD----AKQQLPSNTFLASFFGIFTPET 248
           SLNGDF+  SIEPMLERNLNKQAM+VL + +  +    + Q LPSNT LASFFGIF P+ 
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285

Query: 249 TLKNFDES---NEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVL 305
                +     + A   L  AL +LY   SE YLIAD+  +KA + Y   L AN +D V+
Sbjct: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345

Query: 306 KEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDF 365
           +E  A A  Y GIF+FLKND L +   +Q SI LHP  N+Y++ AL +ADK  S+ +F F
Sbjct: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405

Query: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEG 425
           F  A+D+DP   P YYHRGQM+F+ Q Y             +  N++PYIQLACL Y + 
Sbjct: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465

Query: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGV 485
           KF + E+LF+EAK KFP  PEVP FYAE+LTDKGDF+ A KQYDIAKRLEE    IHVG+
Sbjct: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525

Query: 486 SPLVGKATLLARQPXXXXXX-------XXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEI 538
            PL+GKAT+LARQ                      AC++D RSEQAKIGLAQL+LQ E+I
Sbjct: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585

Query: 539 DEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           D AI LF+E++ LAR M+EKLQATTFAEA+K+QK++RADP+++AK++ TLA YR QG+I
Sbjct: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/538 (54%), Positives = 378/538 (70%), Gaps = 14/538 (2%)

Query: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDP 132
           YP   NGEPD+      +  Q++ Y+V LK++GN FF  + + +A+KYY YA++L   +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 133 VFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           VFYSNISACY+S G+LEKV+E +TKALE+KPD+SKALLRRASANE+L NF +AMFDLSVL
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 193 SLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSD---AKQQLPSNTFLASFFGIFTPETT 249
           SLNGDF+ ASIEPMLERNLNKQAM+VL + +S D     Q LPSNT LASFFGIF     
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281

Query: 250 LKNFDESNEADVE---LLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLK 306
           + + + S+  D     L +AL  LY    E YL+A++  +K+ + Y   L AN  D+ L+
Sbjct: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341

Query: 307 EKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFF 366
           E  A AL Y GIF FLKN+ L +   +Q SI LHP  N+YI+ AL +ADK  S+ +F FF
Sbjct: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401

Query: 367 DKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGK 426
            KA+D++P   P YYHRGQM+F+ Q Y             +  N++PYIQLACL Y +GK
Sbjct: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461

Query: 427 FDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVS 486
           F + E  F+E K KFPT PEVP F+AE+LTD+GDFD A KQYDIAKRLEE  + IHVG+ 
Sbjct: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521

Query: 487 PLVGKATLLARQPXXXXXX-------XXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEID 539
           PL+GKAT+LARQ                      AC++D RSEQAKIGLAQLKLQ E+ID
Sbjct: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581

Query: 540 EAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           EAI LFE+++ LAR M+EKLQATTFAEA+K+QK++RADP+++AK++ TLA YR +G++
Sbjct: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/533 (55%), Positives = 373/533 (69%), Gaps = 15/533 (2%)

Query: 79  NGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSN 137
           NGEPD+      T  QK+TY+V LK+KGN FF  + + +A+KYY  A++L   DPVFYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 138 ISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGD 197
           ISACY+S G+L KV+E +TKALE+KPD+SKALLRRASANE+L NF +AMFDLSVLSLNGD
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 198 FNEASIEPMLERNLNKQAMRVLKDKMS---SDAKQQLPSNTFLASFFGIFTPETTLKNFD 254
           F+ ASIEPMLERNLNKQAM+VL + +S       Q LPSNT L SFFGIF P+  +   +
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283

Query: 255 ESNEADVE---LLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311
            S+  D     L +AL  LY   +E YL AD+ F+ A ++Y   L A+  D  LKE  A 
Sbjct: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAY-HSLLASQVDGPLKENAAL 342

Query: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371
           A  Y GIF FLKN+ LG+   +Q SI LHP  N+YI+ AL +ADK  S+ +F +F KA+D
Sbjct: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402

Query: 372 VDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCE 431
           +D    P YYHRGQM+F+ Q Y                NI+PYIQLACL Y +GKF + E
Sbjct: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462

Query: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491
            LF+E K KFPT PEVP F+AE+LTDKGDF  A KQYDIAKRLEE  + IHVG+ PL+GK
Sbjct: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522

Query: 492 ATLLARQPXXXXXX-------XXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITL 544
           AT+LARQ                      AC++D RSEQAKIGLAQLKLQ E+ID+AI L
Sbjct: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582

Query: 545 FEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           F++++ LAR M+EKLQATTFAEA+K+QK++RADP+++AK++ TLA+YR +G+I
Sbjct: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/537 (52%), Positives = 370/537 (68%), Gaps = 11/537 (2%)

Query: 72  PCYPIDSNGEPDLKDSANF---TEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL 128
           P YP+DS  +PD  +        E  K  ++  LK+KGNQ+FK +  E+A+KYY YAL L
Sbjct: 128 PSYPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRL 187

Query: 129 KQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFD 188
            QDPVFYSNISACY ++  L+KV+ESS KALELKPDYSKALLRRA+A E L N  EA++D
Sbjct: 188 DQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYD 247

Query: 189 LSVLSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQ--LPSNTFLASFFGIFTP 246
            S+LSL G+++   +EP+L R L+K +  VL+ K+ +       L S++ L SFFGIF P
Sbjct: 248 FSILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILLSDSALVSFFGIFPP 307

Query: 247 ETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQL---EANPDDE 303
           ETT+ N++  +EAD EL+  L  L K+ SE +L AD+ F KA E ++++L   E N ++ 
Sbjct: 308 ETTITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENS 367

Query: 304 VLKEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKN-- 361
            L EK A ALEY+G+FKFLK D LGS  D+Q++I+L+PR N+YIY A+++ADK   KN  
Sbjct: 368 GLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDL 427

Query: 362 -YFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACL 420
            YF +FDKA  ++PN AP YYHRGQ+  ++Q++             D SN++PYIQLAC+
Sbjct: 428 DYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACV 487

Query: 421 TYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDA 480
            Y+   F  C+ LF EA+ KFPT PEVP FYAE+L DKG+ +AA KQYDIA RLE +   
Sbjct: 488 AYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKY 547

Query: 481 IHVGVSPLVGKATLLARQPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDE 540
           IHVG++PL+GKA  LAR P              AC++D RSEQAKI LAQLKLQ E+ID 
Sbjct: 548 IHVGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDT 607

Query: 541 AITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597
           AI LFEE +DLAR  ++KLQATTFAEA+K+QK+I+ +P+  AKI+ TLA YR  G+I
Sbjct: 608 AIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII 664

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  523 bits (1348), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 262/518 (50%), Positives = 352/518 (67%), Gaps = 1/518 (0%)

Query: 79  NGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNI 138
           N EPD++        +K  Y+  LK +GN +FK + YE+A+ YY +AL LK DPVFYSN+
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125

Query: 139 SACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDF 198
           +ACY+SL + ++ +E+ +KALEL PDYSK LL+RA+  EN+  FA+A+ DL+ +SLNGD+
Sbjct: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185

Query: 199 NEASIEPMLERNLNKQAMRVLKDKMSSDAKQQ-LPSNTFLASFFGIFTPETTLKNFDESN 257
           N+A+I+P++ER LNKQAM  LKD + +  K + LPS T +A+FFG+F  ET +   D + 
Sbjct: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245

Query: 258 EADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATALEYNG 317
           E+D  L +AL +LY +  E Y   D  F+KA E Y  +LE +  + V  EK A A E+  
Sbjct: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305

Query: 318 IFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVDPNSA 377
           I  FLKNDPL + E +  +I+LHPR  +YIY  L+MADKG  + Y+  F KA+D+DPN A
Sbjct: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365

Query: 378 PVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCETLFSEA 437
            +YYHRGQM+F+ Q+Y             D +NIFPYIQLAC++Y EG FDDCETLFSEA
Sbjct: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425

Query: 438 KRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKATLLAR 497
           +RKFP APEVPNF+AE+L+DKG+ + A+ +YD A  LE   + IHVG++PLVGKAT L +
Sbjct: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLK 485

Query: 498 QPXXXXXXXXXXXXXXACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLARNMEE 557
            P              A   D RSE+AK+GLAQ KLQQE++D+AI LFEEA+ L R ++E
Sbjct: 486 YPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDE 545

Query: 558 KLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQG 595
           KLQATTFAEA+KVQ ++RAD  + AK    L   R  G
Sbjct: 546 KLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTK 157
           ++ LK++GN++ KE+KY  A++YY  A++L     +F+SN +   + L N +  ++    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 158 ALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           ALEL P   KA  RR  +   L +F +A  DLS++
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 93  EQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKV 151
           E+    ++  K++GN F KE+KY +A++YY+ A++L     +F+SN +   + L N    
Sbjct: 6   EEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTA 65

Query: 152 VESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           +E   K++EL P   KA+ RR  +   L  F++A  DL  +
Sbjct: 66  LEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 59/93 (63%), Gaps = 7/93 (7%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL- 159
           A K +GN+F+K +K+++A+++YN A DL +D  + +N SA     G+ E+ +++ T+A+ 
Sbjct: 269 AEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVE 328

Query: 160 ---ELKPDY---SKALLRRASANENLENFAEAM 186
              E++ DY   SK+  R  +A   LE+F +A+
Sbjct: 329 QGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKAL 159
            K +GN  F  + YE A + +  A++  + P  V YSN SAC+ SL    + +  + + +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 160 ELKPDYSKALLRRASANENLENFAEA 185
           ++ P +SK   R  +A   L    EA
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 105 KGNQFFKEQKYEDALKYYN-YALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163
           +G ++F +  + +A+K Y        +D   YSN +A    L +  + ++    A+   P
Sbjct: 407 QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDP 466

Query: 164 DYSKALLRRASANENLENFAEAMFDL 189
           ++ +A +R+A+A   +  FA A+  L
Sbjct: 467 NFIRAYIRKATAQIAVREFASAIETL 492

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 73/142 (51%), Gaps = 5/142 (3%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQ-DPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K++GN   K Q Y  A++ Y+ A++L     V++SN + C++ L N +   +   KAL L
Sbjct: 13  KNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALAL 72

Query: 162 KPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEASIEPML---ERNLNKQAMRV 218
            P   KA  RR  A   L  F +A  DL+V+ L    ++A+ +  L   E+ + ++  R 
Sbjct: 73  DPKNVKAYHRRGLACVGLLEFKKARADLTVV-LKAKPSDAAAKRALDICEKVIREERFRK 131

Query: 219 LKDKMSSDAKQQLPSNTFLASF 240
                 SD+K +L S   L+SF
Sbjct: 132 AIGGGDSDSKPKLCSTLNLSSF 153

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALE 160
           ALK +GN+   E +YE+A+K Y  A+   ++  +YSN S  Y  LG  E  V  +T A+ 
Sbjct: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAIN 143

Query: 161 LKPDYSKALLR 171
           + P +SKA  R
Sbjct: 144 IDPSFSKAYSR 154

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDLKQDP---VFYSNISACYVSLGNLEKVVESS 155
           +V  K++GN F KEQ Y  A++ Y  A++L  DP   +FYSN +   + L N +      
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDNFQSAYNDC 69

Query: 156 TKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
            +AL L     KA  RR  AN  L  F  A  DL+V+
Sbjct: 70  NEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (52%), Gaps = 2/99 (2%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           ALK +GN+    + YE A++ Y  A++ L  D V+Y+N +A Y SL   EK VE + KA 
Sbjct: 92  ALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKAT 151

Query: 160 ELKPDYSKALLRRASANENLENFAEAMFDLS-VLSLNGD 197
           ++   YSK   R   A   L    EA+     VL + GD
Sbjct: 152 KVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKAL 159
           LK KGN  F  + +  A++Y+  A+     P  V YSN SACY SL   ++ +  + + +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 160 ELKPDYSKALLRRASANENLENFAEA 185
           ++ PD+SK   R  +A+  L +  +A
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL----EL 161
           GN+ +K  K+++A+  YN A DL +D  + +N SA     G+ E  + +  +A+    EL
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGREL 322

Query: 162 KPDY---SKALLRRASANENLENFAEAM 186
           + DY   +K+  R  +A    +N  +A+
Sbjct: 323 RADYKLIAKSFARMGNAYSKQKNLKKAI 350

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  + +A+K Y   +    +D   YSN +A    L +  + ++   KA+E  P+
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 165 YSKALLRRASANENLENFAEAMFDL 189
           + +A LR+A+A   +++F +A+  L
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALETL 481

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + +E A++ +  A+++ + P  V YSN SACY S+    + +  + + + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           +KPD+SK   R  +A+  L +  EA
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 105 KGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163
           +G ++F    + +A+K Y   +    +D   YSN +A    L +    ++    A++  P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 164 DYSKALLRRASANENLENFAEAMFDL 189
           ++ +A +R+A+A   ++ +A A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDLKQDP---VFYSNISACYVSLGNLEKVVESS 155
           + + KD+GN+F K+Q ++ A + Y  A++   DP   +FYSN +   + L N    +   
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIE--TDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 156 TKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           T A+EL     KA  RR  AN  L NF  A  D +++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + YE A+  ++ A+++ + P  VFYSN SACY SL    + +  + + ++
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A+  L +  EA
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G  +F +  + +A+K Y   +    +D   YSN +A    L +  + +E   KA+E  P+
Sbjct: 397 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPN 456

Query: 165 YSKALLRRASANENLENFAEAMFDL 189
           + +A +R+A+A   ++ FA A+  L
Sbjct: 457 FIRAYIRKATAQIAVKEFAAAIETL 481

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 57/113 (50%), Gaps = 7/113 (6%)

Query: 81  EPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISA 140
           EP   DSA   E  K+  +   K  GN+ +K +++++A+ +Y+ A +L QD  + +N SA
Sbjct: 238 EPMEVDSAGNEETSKKEEAEKEKALGNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSA 297

Query: 141 CYVSLGNLEKVV----ESSTKALELKPDY---SKALLRRASANENLENFAEAM 186
                G+ E  +    E+  K  E++ DY   +K+  R  + +    N  +A+
Sbjct: 298 AEFEKGDAETALKTLDEAVEKGREMRTDYKLIAKSFARMGNVHHKTNNLKKAI 350

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           KD+GN  F  + Y++A++ +  A+++ + P  V YSN SACY S     K +E + + ++
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A+  + +  EA
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 64/119 (53%), Gaps = 7/119 (5%)

Query: 75  PIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVF 134
           P  S   P+ K+ A+  E++ +  + A K +GN+ +K  K+++A+++YN A +L  D  +
Sbjct: 231 PKKSETVPEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITY 290

Query: 135 YSNISACYVSLGN----LEKVVESSTKALELKPDY---SKALLRRASANENLENFAEAM 186
            +N SA     G+    +E + E+  K  E++ DY   +K+  R A++   L +   A+
Sbjct: 291 LNNRSAAEFEKGDYQTAIETLHEAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSAI 349

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLKQDPV---FYSNISACYVSLGNLEKVVESSTKALELK 162
           G ++F +  + +A+K Y   +   +DP     YSN +A    L +  + +     A+E  
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMI--ARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKD 453

Query: 163 PDYSKALLRRASANENLENFAEAMFDL 189
           P++ +A +R+A+A   +++F  A+  L
Sbjct: 454 PNFIRAYIRKATAQIAIKDFVPAIETL 480

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTK 157
           ++  K++GN + KE+KY++A++YY+ A++L     +++SN +   + L N     E   K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 158 ALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           A+ L P   KA+ RR  +   L  F +A  DL V+
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTK 157
           ++  KD+GN + K Q Y+ A++ Y  A++L     +FYSN +  ++ L N +  +     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 158 ALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           A++L  +  KA  RR  A   L  F +A  DL++L
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL 106

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDLKQDP---VFYSNISACYVSLGNLEKVVESS 155
           +VA K++GN + KEQ Y  A++ Y+ A++L  DP   +F+SN +   + L N +  +   
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 156 TKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
             AL L P   KA  RR  ++  L    +A  DL V+
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%)

Query: 127 DLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAM 186
           D K+  V + N    Y+   N  K +E  ++A+EL P  S     RA A   L+NF   M
Sbjct: 7   DAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCM 66

Query: 187 FDLSV 191
            D  V
Sbjct: 67  NDCDV 71

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + YE A + +  A+D+ + P  V YSN SACY SL    + ++ + + ++
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A   L N  +A
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 52/95 (54%), Gaps = 7/95 (7%)

Query: 75  PIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVF 134
           P+  N EP+        E+  +  +   K +GN+F+K +K+++A+++YN A +L +D  +
Sbjct: 227 PLKENNEPE---PMEVDEKGPQVAAEEEKAEGNKFYKARKFDEAIEHYNKAWELHKDITY 283

Query: 135 YSNISACYVSLGNLEKVVESSTKAL----ELKPDY 165
            +N +A     G+ E  + + T A+    E++ DY
Sbjct: 284 LNNRAAAEYEKGDYETAIATLTNAVDEGREMRADY 318

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  + +A+K Y   +    QD   YSN +A    L +  + +    +A+E  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 165 YSKALLRRASANENLENFAEAMFDLSVL 192
           + +A +R+ASA   ++ FA A+  L  +
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTV 476

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + +E A++ +  A+++ + P  V YSN SACY S     K +E + + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A+  L +  EA
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 7/119 (5%)

Query: 75  PIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVF 134
           P +S  EP   D     EE  +  + A K +GN+F+K +K+++A+++Y+ A +L +D  +
Sbjct: 235 PSESKPEPMEVDEPEQEEESSKAKADAEKAEGNKFYKARKFDEAIEHYSKAWELHKDITY 294

Query: 135 YSNISACYVSLGNLEKVVESSTKAL----ELKPDY---SKALLRRASANENLENFAEAM 186
            +N +A     G  E  +++ T+A+    EL+ DY   SK+  R  ++   L    +A+
Sbjct: 295 LNNRAAAEYEKGEYETAIKTLTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAI 353

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 105 KGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163
           +G ++F +  + +A+K Y   +    +D   YSN +A    L +  + ++    A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 164 DYSKALLRRASANENLENFAEAMFDL 189
           ++ +A +R+A+A   +  F   +  L
Sbjct: 459 NFIRAYIRKATAQIAVREFVSVIETL 484

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQ-DPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           KD+GN+F   + Y  A++ Y  A++L     +F+SN +   + L   +  +E S+KA+EL
Sbjct: 13  KDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIEL 72

Query: 162 KPDYSKALLRRASANENLENFAEAMFDLSVL 192
                K   RR  A   L++F  A  DL V+
Sbjct: 73  DSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  ++YE A+  ++ A+++  +P  V YSN SACY SL      +  + +  +
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A+  L +  EA
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL- 159
           A KD+GN+ +K  K+++A+++Y+ A +L  D  + +N +A     G+ E  +++   A+ 
Sbjct: 260 AEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDAIE 319

Query: 160 ---ELKPDY---SKALLRRASANENLENFAEA 185
              EL+ DY   +KA  R  +A E L +  +A
Sbjct: 320 KGRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 105 KGNQFFKEQKYEDALKYYNYAL-DLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163
           +G  FF + ++ DA+K Y   +     D   YSN +A    L +  + +    KALE  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 164 DYSKALLRRASANENLENFAEAMFDLSV 191
           ++ KA +R+A+A   ++ ++ A+  L +
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDI 485

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALE 160
           LK +GN+ F  + +E A+K Y  A++L   + VFY N +A Y S    E+ V  +  A+ 
Sbjct: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158

Query: 161 LKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGD 197
           + P YS+   R   A   L    EAM     VL + GD
Sbjct: 159 INPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGD 196

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + Y+ A++ +  A+++ + P  V YSN SACY SL      +  + + ++
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A+  L +  EA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 47/84 (55%), Gaps = 7/84 (8%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL--- 159
           K +GN+F+K +++++A+++YN A +L +D  + +N +A     G  E  + +   A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 160 -ELKPDY---SKALLRRASANENL 179
            E++ DY   SK+  R  +A   L
Sbjct: 326 REMRADYKVISKSFARIGNAYHKL 349

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  + +A+K Y   +    +D   YSN +A    L +  + +    KA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKALLRRASANENLENFAEAMFDL 189
           + +A +R+A+A   ++ +A A+  L
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETL 487

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 64/122 (52%), Gaps = 4/122 (3%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + Y+ A++ +  A+++ + P  V +SN SACY SL      +  + + ++
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 161 LKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGDFNEASIEPMLERNLNKQAMRVL 219
           + P +SK   R  +A+  L +  EA  D    L L+ + N+A+ + + + +  +QA +  
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDAN-NKAAKDGLEQVHRTQQARQAQ 127

Query: 220 KD 221
            D
Sbjct: 128 PD 129

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 48/84 (57%), Gaps = 7/84 (8%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALE-- 160
           K +GN+F+K  ++++A+++YN A +L +D  + +N +A     G+ E V+ +   A+E  
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKG 325

Query: 161 --LKPDY---SKALLRRASANENL 179
             ++ DY   SK+  R  +A   L
Sbjct: 326 RDMRADYKVISKSFARIGNAYHKL 349

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  + +A+K Y   +    +D   YSN +A    L +  + +    KA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKALLRRASANENLENFAEAMFDLSV 191
           + +A +R A+A   ++ FA A+  L V
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALETLDV 489

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + Y+ A+  ++ A+D+ + P  V YSN SACY SL      ++ + + ++
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A+  + +  EA
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G  +F +  + +A+K Y   +    +D   YSN +A    L +  + ++   KA+E  P+
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 165 YSKALLRRASANENLENFAEAMFDL 189
           + +A +R+A+A   +  F+ A+  L
Sbjct: 464 FVRAYIRKATAQIAVREFSSALETL 488

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 7/119 (5%)

Query: 75  PIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVF 134
           P+    EP+  D  +  +E  +  + A K +GN+ +K +++++A+  YN A +   D  +
Sbjct: 239 PVVQADEPEQMDVDSNEDENAKKRAEAAKAEGNKLYKARQFDEAVAKYNEAWEAHNDITY 298

Query: 135 YSNISACYVSLGNLEKVV----ESSTKALELKPDY---SKALLRRASANENLENFAEAM 186
            +N SA     G+ E  +    E+  K  E++ DY   +K+  R  +    L +  +A+
Sbjct: 299 LNNRSAAEFEKGDYETSIKTLEEAVEKGREMRADYKVIAKSFARMGNCYTKLNDLKKAI 357

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 70/147 (47%), Gaps = 11/147 (7%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K++GN++ K + Y  A++ Y  A++      +F+SN +   + L   +  +E S +A+EL
Sbjct: 42  KNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIEL 101

Query: 162 KPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEA------SIEPMLERNLNKQA 215
                KA  RR  A+  L  +  A  DL V+      +EA        E ML R   ++A
Sbjct: 102 DAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRALEVCERMLRRERFERA 161

Query: 216 MRVLKDKMSSDAKQQLPSNTFLASFFG 242
           +R   D    + +++L     LASF G
Sbjct: 162 IRADGD----EEQRRLCKTLSLASFAG 184

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 94  QKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQD-----PVFYSNISACYVSLG 146
           + E + +A   K++GN  +K +++ DA + YN A+D+K D        Y+N +AC + L 
Sbjct: 67  EGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELK 126

Query: 147 NLEKVVESSTKALELKPDYSKALLRRASANENLENF 182
           N  + +     AL L P   K   R A A   +E F
Sbjct: 127 NYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKF 162

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKAL 159
            K +GN  F  + +E A + ++ A++  + P  V YSN SACY SL   ++ +E + + +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 160 ELKPDYSKALLRRASANENLENFAEA 185
           ++ P +SK   R  +A   L N  +A
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 58/93 (62%), Gaps = 7/93 (7%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL- 159
           A K +GN+++K +K+++A+++YN A DL +D  + +N SA     G+ E+ +++ T+A+ 
Sbjct: 269 AEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVD 328

Query: 160 ---ELKPDY---SKALLRRASANENLENFAEAM 186
              E++ DY   SK+  R  +A   +++  +A+
Sbjct: 329 QGREMRADYKLISKSFARIGNAYLKMDDLKKAI 361

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 105 KGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163
           +G +FF +  +  A+  Y   +    +D   YSN +A    L +    ++    A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 164 DYSKALLRRASANENLENFAEAMFDLSV-----LSLNGDFNEASIE 204
           ++ +A +R+ASA   +  FA AM  L       L +N   N   IE
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQD-----PVFYSNISACYVSLGNL 148
           E + +A   K++GN+F+K ++Y DA + Y   +D+K D        Y+N +AC + L N 
Sbjct: 69  EPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNF 128

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEA 185
            K +E   KAL       K   R   A  +++ F E+
Sbjct: 129 RKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + Y+ A++ +  A+++ + P  V YSN SACY SL      +  + + + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A+  L +  EA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL--- 159
           K +GN+F+K +++++A+++YN A +L +D  + +N +A     G  +  + +   A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQG 325

Query: 160 -ELKPDY 165
            E++ DY
Sbjct: 326 REMRADY 332

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 2/99 (2%)

Query: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G  +F +  + +A+K Y   +    +D   YSN +A    L +  + +    KA+E  P+
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKALLRRASANENLENFAEAMFDL-SVLSLNGDFNEAS 202
           + +A +R+A+A   ++ +A A+  L +  + + D N  +
Sbjct: 463 FVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGA 501

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 92  EEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEK 150
           EEQK T +  LK +GN+    + YE A+K Y+ A++ L  + V+Y+N +A Y SL   + 
Sbjct: 87  EEQKAT-AEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDD 145

Query: 151 VVESSTKALELKPDYSKALLR 171
            V  +  A+++ P YSK   R
Sbjct: 146 AVNDAESAIKVNPTYSKGYSR 166

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKAL 159
            K +GNQ F  + Y  A++ +  A+++ + P  V +SN SACY S  +  K ++ + + +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 160 ELKPDYSKALLRRASANENLENFAEA 185
           ++ P ++K   R  +A+  L +  EA
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 53/93 (56%), Gaps = 7/93 (7%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL- 159
           A K +GN+ +K++K+++A++ YN A +   D  + +N +A     G+ E  +E+ TKA+ 
Sbjct: 257 AAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKAVE 316

Query: 160 ---ELKPDY---SKALLRRASANENLENFAEAM 186
              EL+ DY   SK+  R  ++   L +  +A+
Sbjct: 317 QGRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 105 KGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163
           +G ++F +  +  A++ Y   +     D   YSN +A    L +    +    KA+E  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 164 DYSKALLRRASANENLENFAEAMFDL 189
           ++ +A +R+A+    ++++A A+  L
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETL 480

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 72/141 (51%), Gaps = 13/141 (9%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQDP-----VFYSNISACYVSLGNL 148
           E + VA   K++GN+ +K ++Y+DA + YN  +++K D        +SN +AC + L N 
Sbjct: 73  EPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNY 132

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEASIEPMLE 208
            + V    +AL+  P   K   R A A   L+   +A   +    L  D   A+++ +L+
Sbjct: 133 RRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQ 191

Query: 209 RNLNKQAMRVLKDKMSSDAKQ 229
           + + ++     +DK + +AK+
Sbjct: 192 KVIKRE-----EDKKAHEAKR 207

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + Y  A+  +  A+++ + P  V YSN SACY SL      +  +T+ ++
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A+  L +  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 49/84 (58%), Gaps = 7/84 (8%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL--- 159
           K +GN+F+K +++E+A+++YN A +L +D  + +N +A     G+ E  + + T A+   
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQG 322

Query: 160 -ELKPDY---SKALLRRASANENL 179
            E++ DY   SK+  R  +A   L
Sbjct: 323 REMRADYKVISKSFARIGNAYHKL 346

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  + +A+K Y   +    +D   YSN +A    L +  + +    KA+E  P+
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 165 YSKALLRRASANENLENFAEAMFDL 189
           + +A +R+A+A   ++ FA A+  L
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETL 484

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 105 KGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163
           +GN+    +K+++A++ Y  A+++   + V+YSN +A Y SL   E+ V+ + +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 164 DYSKALLRRASANENLENFAEAM 186
            YSK   R   A   L    EA+
Sbjct: 161 TYSKGFSRLGFAKYALNKPEEAL 183

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 55/97 (56%), Gaps = 5/97 (5%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDLKQDP---VFYSNISACYVSLGNLEKVVESS 155
           ++ LK++GN+F KE+ Y  A +YY  A++   DP   + YSN +   + L N +  ++ +
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIE--HDPENTILYSNRAFTNLKLDNFQSSLDDA 70

Query: 156 TKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
            +A+EL  +  KA  RRA +   L  F +A  DL ++
Sbjct: 71  KRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 2/106 (1%)

Query: 88  ANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLG 146
           +N T EQ    ++ LK++GN F K+Q +  A+  Y  A+ L     +++SN +  ++ L 
Sbjct: 2   SNPTSEQSAE-ALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLD 60

Query: 147 NLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           N +  +    +AL+L P  +KA  RR  +   L  F +A  DL ++
Sbjct: 61  NFQSSLNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALE 160
           LK +GN+    + +E A+K Y  A++ L  + V+Y+N +A Y SL   E+ V+ +  A++
Sbjct: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIK 159

Query: 161 LKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGD 197
           + P YSK   R   A   L    EA+    +VL + GD
Sbjct: 160 VNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K++GN F KE+ +  A++ Y  A+DL     +++SN +  +  + N +  +    +AL+L
Sbjct: 16  KNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKL 75

Query: 162 KPDYSKALLRRASANENLENFAEAMFDLSVL 192
            P   KA  RRA +   L  F +A  DL+VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYAL-DLKQDPVFYSNISACYVSL 145
           N TE+  E    A  LK +GN+    + YE A+K Y  A+  L  + V+++N +A Y SL
Sbjct: 88  NVTEDDTEASEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSL 147

Query: 146 GNLEKVVESSTKALELKPDYSKALLR 171
              ++ VE +  A+++ P YSK   R
Sbjct: 148 KKYDEAVEDANSAIKINPTYSKGYSR 173

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + Y+ A+  +  A+++ + P  V YSN SA Y S    E+ +  + + ++
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P ++K   R+ +A + L  + EA
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 53/91 (58%), Gaps = 7/91 (7%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL--- 159
           K +GN+ +K +++++A+ +YN A +  +D  + +N SA     G+ E  +++ T+A+   
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTEAVENA 314

Query: 160 -ELKPDY---SKALLRRASANENLENFAEAM 186
            EL+ DY   +K+  R  +A   L++  +A+
Sbjct: 315 RELRTDYKIVAKSFARMGNAYAKLDDLKKAI 345

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLKQDPV-FYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  + +A+K Y   +    D    YSN +A    L +    +    KA+E  P 
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 165 YSKALLRRASANENLENFAEAMFDLSV 191
           + +A LR+A+    ++ FA A+  L +
Sbjct: 452 FIRAYLRKATCQIAVKEFAGAIETLDL 478

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDL--KQDPVFYSNISACYVSLGNLEKVVESST 156
           S  LK+ GN+ +KE+ YE A+ Y+  AL        + YSN +A ++ L +  + +E   
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 157 KALELKPDYSKALLRRASANENLENFAEA 185
             +EL P++ K   R   A   L+   EA
Sbjct: 68  NCVELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G Q F  ++Y  A+K Y   +      PV + N +A +  L    +V++   KA+ + P 
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 165 YSKALLRRASANENLENFAEAM 186
           Y KA +R+  A     +  EA+
Sbjct: 496 YIKAYVRKGFAQITERDLDEAL 517

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           GN  +K++ +++A+ +Y  A +  QD  + +NI A     G+   V++S  +A+
Sbjct: 302 GNDLYKKRNFKEAIIHYTKAWNTFQDITYLNNIGAAQFERGDYGNVLKSLGQAV 355

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 62/113 (54%), Gaps = 4/113 (3%)

Query: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145
           N  +E  ET + A  LK +GN+    + Y+ A++ Y  A+  L  + V+++N +A Y + 
Sbjct: 89  NIPQEDAETKAKAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNS 148

Query: 146 GNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGD 197
            N ++ V+ + +A++L P YSK   R A A    ENF E++     VL + GD
Sbjct: 149 QNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K++GN+ FKE  Y+ A + Y   +D++ ++P+ YSN +   + LG   +VVE   K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 162 KPDYSKALLRR 172
            P+ +  + ++
Sbjct: 67  TPNTTDTVYKK 77

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 71/141 (50%), Gaps = 3/141 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K++GN F KE+ +  A++ Y  A+DL     +++SN +  +  + N +  +    +A++L
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 162 KPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEASIEPML--ERNLNKQAMRVL 219
            P   KA  RRA +   L  F +A  DL+VL      + A+ + +L  +R + ++  R  
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPAATKALLTCDRFIREERFRKA 135

Query: 220 KDKMSSDAKQQLPSNTFLASF 240
                ++AK  L     L+SF
Sbjct: 136 IGGAENEAKISLCQTLNLSSF 156

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 7/97 (7%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYS-----NISACYVSLGNL 148
           E + VA   K++GN  +K +++ DA   YN  +++K D    S     N +AC + L N 
Sbjct: 72  EPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNY 131

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEA 185
            + +    +AL+L P   KA  R   A   L+   EA
Sbjct: 132 RRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKAL 159
            K +GN  F  + Y  A+  +  A+++ + P  V YSN SACY S    E+ ++ + + +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 160 ELKPDYSKALLRRASANENLENFAEA 185
           ++ P +SK   R  +A   L    EA
Sbjct: 66  KISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 105 KGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKP 163
           +G +FF +  + +A+K Y   +    QD   +SN +A    L +  + +E   KA+ + P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 164 DYSKALLRRASANENLENFAEAMFDLSV 191
           ++ +A +R+A+A   ++ FA A+  L++
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLNI 473

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 54/93 (58%), Gaps = 7/93 (7%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL- 159
           A K +GN+ +K +++E+A+++YN A +L +D  + +N SA     G+ +  +++   A+ 
Sbjct: 248 AEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVE 307

Query: 160 ---ELKPDY---SKALLRRASANENLENFAEAM 186
              EL+ DY   +K+  R  +A   L++  +A+
Sbjct: 308 QGRELRADYKTIAKSFARIGNAYYKLKDLRKAI 340

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDLKQD-PVFYSNISACYVSLGNLEKVVESSTK 157
           ++  K++GN   K Q Y  A++ Y  A+ L     +++SN +  ++ + N +  +    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 158 ALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           ALE+ P   KA  RR  +   L  F  A  DL ++
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQ-----DPVFYSNISACYVSLGNL 148
           E + +A   K +GN  +K +++ DA + Y+  +D+K      +   Y+N +AC + + N 
Sbjct: 76  EPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNY 135

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEAM 186
            + +    +AL+L P   K   R A A   LE   EA+
Sbjct: 136 RRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 16/179 (8%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYAL-----DLKQDPVFYSNISACYVSLGNL 148
           E + +A   K +GN+ +K ++++DA + Y+  L     D   +   Y+N +AC + L N 
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNY 137

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEASIEPMLE 208
            + +E  +KAL + P   K   R + A   L    EA    +  +   D    SI  ML 
Sbjct: 138 RRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATFANQRIDPENKSILNMLS 197

Query: 209 R-NLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNFDE-SNEADVELLN 265
             +  +Q ++  ++K   +A+++      L S         TL+N       + VELLN
Sbjct: 198 VIDRKEQELKAKEEKQQREAQERENKKIMLESAM-------TLRNITNIKTHSPVELLN 249

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K++GN F KE+ +  A++ Y  A+DL     +++SN +  +  + N +  +    +A++L
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 162 KPDYSKALLRRASANENLENFAEAMFDLSVL 192
            P   KA  RRA +   L  F +A  DL+VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K++GN+ +K+  Y DA+  Y+  +  + Q+PV +SN +   + LG   + +E+  + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 162 KPDYSKALLR 171
                 A LR
Sbjct: 68  AASPQHAALR 77

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 99  SVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTK 157
           ++  K++GN F K + +  A + Y+ A++L     +++SN +  ++ L N +  +    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 158 ALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           A+EL P   KA  RR  +   L  F +A  DL ++
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + +  A++ +  A+++   P  V YSN SA Y S    ++ +  +T+ ++
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           + P +SK   R  +A   L N  EA
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKAL--- 159
           K +GN+ +K  K+++A++ YN A  L +D  + +N SA     G+ E  + +  +A+   
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 160 -ELKPDY 165
            EL+ DY
Sbjct: 319 RELRADY 325

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  + +A+K Y+  +    +D   YSN +A    L +  + ++    A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 165 YSKALLRRASANENLENFAEAM 186
           + +A +R+A+A   ++ +A A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  +KY++A+  +  A+++ + P  V YSN SA Y S     + ++ + +  +
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 161 LKPDYSKALLRRASANENLENF--AEAMFDLSV-LSLNGDFNEASIEPMLERNLNKQA 215
           + P ++K   R  +A+  + N   AEA +  ++ L  N    +  IE +      +QA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANNKIAKEGIEQIQRVQSQRQA 126

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 6/105 (5%)

Query: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  +  A+K Y   +    +D   YSN +A    L +    +    KA+E  P+
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPN 451

Query: 165 YSKALLRRASANENLENFAEAMFDLSV-----LSLNGDFNEASIE 204
           + +A +R+A+A   +++F+ A+  L         +NG  N   I+
Sbjct: 452 FVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREID 496

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVV----ESSTKA 158
           K +GN+ +K + +++A+  YN A +L  +  + +N SA     G  +  +    E+  K 
Sbjct: 255 KVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKG 314

Query: 159 LELKPDY---SKALLRRASANENLENFAEAM 186
            E++ DY   +K+  R  +A   + N  EA+
Sbjct: 315 REMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 5/90 (5%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVF-----YSNISACYVSLGNLEKVVESS 155
             K +GN+ +K ++++DA + Y   L+++ +  F     ++N +AC + L N  + +E  
Sbjct: 85  GFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDC 144

Query: 156 TKALELKPDYSKALLRRASANENLENFAEA 185
           +KAL + P  +K   R + A   L    EA
Sbjct: 145 SKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLKQDP--VFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  F  + ++ A++ +  A+   ++P  V YSN S  Y SL   ++ +  +T+ ++
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 161 LKPDYSKALLRRASANENLENFAEA 185
           +K D+SK   R  +A+  L N  EA
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 106 GNQFFKEQKYEDALKYYN-YALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G ++F +  +  A+K Y+   +    D   YSN +A    L +    ++   KA+E+ P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 165 YSKALLRRASANENLENFAEAMFDLSV 191
           + +A +R+A+A   ++ ++ A+  L V
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV 485

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
             F  K+L+VDP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 290 LSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 349

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 350 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 381

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           LK KGN FFK   YE A+ YY  A  L   +P+++SN++   + L   ++ V +  K L
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            ++  K+L+VDPN +  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 292 LNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 351

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 352 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 383

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 2/87 (2%)

Query: 89  NFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGN 147
           NF+++ K+  +   KD+GN+    + Y+ A++ Y  A+     DP++YSN S  Y+ + +
Sbjct: 128 NFSDKDKQI-ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186

Query: 148 LEKVVESSTKALELKPDYSKALLRRAS 174
            E  +  +   + +  ++SKA +R A+
Sbjct: 187 YESAINDANFCISIDANFSKAYIRLAN 213

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 3/86 (3%)

Query: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145
           N  EE  ET + A  LK +GN+    ++YE A+K Y  A+D L  + ++Y+N +A + SL
Sbjct: 90  NIPEEDAETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSL 149

Query: 146 GNLEKVVESSTKALELKPDYSKALLR 171
              ++ ++ +  A+ + P Y +   R
Sbjct: 150 KEYDEAIKDAESAISVDPSYFRGYSR 175

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 93  EQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKV 151
           E K+  + ALK +GN+    + Y+ A+  Y+ A+++   +P +YSN +A Y  + +    
Sbjct: 92  EDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNA 151

Query: 152 VESSTKALELKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGD 197
           V  +  A++L P YSKA  R  +A     N  +A+     VL L GD
Sbjct: 152 VLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 34/128 (26%)

Query: 103 KDKGNQFFK-------EQKYEDALKYY--NYALDLKQDPVFYSNISACYVSLGNLEKVVE 153
           KD+G +FFK        Q+YE +L     N+AL +    V YSN++A    +G  ++ + 
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332

Query: 154 SSTKALELKPD---------------------YSKALLRRASANENLENFAEAMFDLSVL 192
               ALE+ P                      + K + RRA A E++EN+  A+ D   L
Sbjct: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392

Query: 193 SLNGDFNE 200
               +FN+
Sbjct: 393 IEKNNFND 400

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALE 160
            K+KGN++ K+  Y+ A+++Y+ A+ L     +++SN +  ++   N    V     AL+
Sbjct: 15  FKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALK 74

Query: 161 LKPDYSKALLRRASANENLENFAEAMFDLSVL 192
           L P   KA  RR  +   +  F +A  DL+V+
Sbjct: 75  LDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 17/129 (13%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            +   K+L++DP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 291 LNLLLKSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 350

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD-FDAASKQ-------YDIAKRL 474
              ++ D    ++ A R  P       + +EV  D G  ++  +KQ       Y  A RL
Sbjct: 351 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDALDAYKQAARL 403

Query: 475 EESLDAIHV 483
           +   D +H+
Sbjct: 404 DP--DNVHI 410

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 8/126 (6%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQDPV-----FYSNISACYVSLGNL 148
           E + +A   K++GN  +K ++++DA + YN  +++K D        Y+N +AC + + N 
Sbjct: 73  EPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNY 132

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEASIEPMLE 208
            + +     AL+  P   K   R   A   LE   EA   +    L  D +   ++ +L+
Sbjct: 133 RRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLD 191

Query: 209 RNLNKQ 214
             L KQ
Sbjct: 192 IVLKKQ 197

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K++GN   KE+ +  A++ Y  A+DL     +++SN +  +  + N +  +    +A++L
Sbjct: 16  KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKL 75

Query: 162 KPDYSKALLRRASANENLENFAEAMFDLSVL 192
            P   KA  RRA +   L  F +A  DL+VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQD-----PVFYSNISACYVSLGNL 148
           E + VA   K++GN  ++ ++Y+DA + YN  +D+K D        +SN +AC + L N 
Sbjct: 73  EPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNY 132

Query: 149 EKVVESSTKALELKPDYSKALLRRASA 175
            + V    +AL+      K   R A A
Sbjct: 133 RRCVNDCKRALQYNVKNIKCYYRIAKA 159

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 17/129 (13%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            ++  K+L+VDP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 290 LNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 349

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD-FDAASKQ-------YDIAKRL 474
              ++ D    ++ A R  P       + +EV  D G  ++  + Q       Y  A RL
Sbjct: 350 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYRQASRL 402

Query: 475 EESLDAIHV 483
           +   D +H+
Sbjct: 403 DP--DNVHI 409

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 17/129 (13%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            D+  K+L+ DP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 286 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 345

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD-FDAASKQ-------YDIAKRL 474
              ++ D    ++ A R  P       + +EV  D G  ++  + Q       Y  A RL
Sbjct: 346 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 398

Query: 475 EESLDAIHV 483
           +  ++ IH+
Sbjct: 399 D--VNNIHI 405

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 2/108 (1%)

Query: 92  EEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEK 150
           +E+ +  +  LK +GN+    + ++ A+  Y+ A+ +   + ++Y+N +A Y SL + EK
Sbjct: 92  DEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEK 151

Query: 151 VVESSTKALELKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGD 197
             E +  A+ + P+YSK   R   A   L    EA+     VL L GD
Sbjct: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            D+  K+L+ DP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 282 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 341

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 342 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 373

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            D+  K+L+ DP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 284 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 343

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 344 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 375

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 51/104 (49%), Gaps = 26/104 (25%)

Query: 105 KGNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESSTKAL 159
           +G+ FFK   Y  AL+ Y  +L+   +  P   + YSNI+A  + +G    +V+ + KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 160 ELKPD---------------------YSKALLRRASANENLENF 182
           +L P                      +SK +LR+A A E+LENF
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQDPV-----FYSNISACYVSLGNL 148
           E + +A   K++GN  +K ++++DA   Y  ALD+K D +      Y N++AC + + N 
Sbjct: 65  EPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNY 124

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEAM 186
              +    +AL+L     KA  R   A   L  F +++
Sbjct: 125 RSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            ++  K+L+VDP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 301 LNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 360

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 361 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 392

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            D+  K+L+ DP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 276 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 335

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 336 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 367

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            +F  K+L+V+P+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 262 LNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 321

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 322 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 353

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 80/186 (43%), Gaps = 30/186 (16%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYAL-----DLKQDPVFYSNISACYVSLGNL 148
           E + +A   K +GN+ +K ++++DA + Y   +     D   +   ++N +AC + L N 
Sbjct: 78  EPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNY 137

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEASIEPMLE 208
            + +E  +KAL + P   K   R + A  +L    EA            F   SIEP  +
Sbjct: 138 RRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA-------KSAAIFANQSIEPENK 190

Query: 209 RNLN--------KQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNFDE-SNEA 259
             LN        +Q +++ + K   +A+++      L S         TL+N       +
Sbjct: 191 SILNMLSVIERKEQELKIKEQKKQQEAQERENKKIMLESAM-------TLRNITNIRTHS 243

Query: 260 DVELLN 265
            VELLN
Sbjct: 244 PVELLN 249

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYAL-DLKQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           + K +GN+    + Y  A++ Y+ A+  L  + ++Y+N +A Y S+   +  ++ + KA+
Sbjct: 101 SFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAI 160

Query: 160 ELKPDYSKALLRRASANENLENFAEAM-FDLSVLSLNGDFNEASIEPMLERNLNKQAMRV 218
           E+ P YSK   R A A   L    EA+ +   VL + GD       P ++R+      RV
Sbjct: 161 EIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD----KATPAMKRDFEMAKNRV 216

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           ALK +GN+    + +E A+  Y+ A++ L  + ++Y+N +A + SL   ++ V  + KA+
Sbjct: 95  ALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAI 154

Query: 160 ELKPDYSKALLR 171
           E+ P YSK   R
Sbjct: 155 EIDPAYSKGYSR 166

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           KD+GN F K+Q +  A + Y  A++L     +F+SN +  ++   N +  +    KALEL
Sbjct: 16  KDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALEL 75

Query: 162 KPDYSKALLRRASANENLENFAEAMFDLSVL 192
                KA  RR  +   L  F +A  DL  +
Sbjct: 76  DSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
            LK KGN FFK+  YE A+ YY  A+     +P+ YSN +   + L    + V++  K L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 160 EL 161
           ++
Sbjct: 66  KM 67

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 59/127 (46%), Gaps = 8/127 (6%)

Query: 94  QKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQD-----PVFYSNISACYVSLG 146
           + E + +A   K++GN  ++ ++Y+DA + YN  +++  D        + N +AC + L 
Sbjct: 73  EGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELK 132

Query: 147 NLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEASIEPM 206
           N  + +    +AL   P   K   R   A  +L    EA   +    L  D N A++  +
Sbjct: 133 NHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGAL 191

Query: 207 LERNLNK 213
           L++ + K
Sbjct: 192 LDKIVKK 198

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
             +  K+L+VDP+ A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 284 LSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 343

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 344 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 375

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145
           N   E  ET + A  LK +GN+    + +E A+  Y+ A+  L  + V+Y+N +A + SL
Sbjct: 85  NIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSL 144

Query: 146 GNLEKVVESSTKALELKPDYSKALLR 171
              E+ V+ +  A+++ P YSK   R
Sbjct: 145 KKYEEAVKDAEDAIKVNPSYSKGYSR 170

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           A K +GN+    + +  A++ Y  A+  L  + ++Y+N +A + SL   E+ ++ +  A+
Sbjct: 103 AFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAI 162

Query: 160 ELKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGDFNEASIEPMLE--RNLNKQAM 216
           ++ P YSK   R A A   L    EA+     VL + GD   A ++   E  +   +++M
Sbjct: 163 KIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESM 222

Query: 217 RVLKDKMSSDAKQQLPSN 234
            V K K     + Q  +N
Sbjct: 223 NVEKSKTPEQGQGQQQTN 240

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 7/97 (7%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQDPV-----FYSNISACYVSLGNL 148
           E + +A   K++GN  +K +++ DA + Y   +++K D        Y+N +AC + L N 
Sbjct: 73  EPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNF 132

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEA 185
              +     AL   P   K   R   A   +  F  A
Sbjct: 133 RSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 13/125 (10%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLK--QDPV---FYSNISACYVSLGNL 148
           E + VA   K++ N  +K +++++A + Y   +++K   D V    ++N++AC + + N 
Sbjct: 73  EPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNF 132

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEA----MFDLSVLSLNGDFNEASIE 204
            + +    KAL+  P   K   R A A   L    EA     F L++ S N      ++E
Sbjct: 133 RRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKSLQ--TLE 190

Query: 205 PMLER 209
            +++R
Sbjct: 191 GVIDR 195

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 11/111 (9%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLK--QDPV---FYSNISACYVSLGNL 148
           E + VA   K++GN  +K ++Y+DA   Y+  +++K   D +    Y N +AC + L N 
Sbjct: 74  EPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNF 133

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEA----MFDLSVLSLN 195
              +    KAL       KA  R   A   L+   EA    +F L + S N
Sbjct: 134 RSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSVLFGLKLDSQN 184

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 102 LKDKGNQFFKEQKYEDALKYY-NYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALE 160
           L+ KGN  + + +YE A+ YY N +L    +PV  +N+S   + L   E  + +  +ALE
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 161 L 161
           +
Sbjct: 71  I 71

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 8/98 (8%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYAL------DLKQDPVFYSNISACYVSLGN 147
           E + +A   K++GN  +K ++++DA   Y   +      D+K     ++N +AC + L N
Sbjct: 71  EPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKN 130

Query: 148 LEKVVESSTKALELKPDYSKALLRRASANENLENFAEA 185
             + +     AL+L P   K   R   A   L+   EA
Sbjct: 131 FRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 56/125 (44%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESST 156
            KD+G ++FK+  Y  A + Y  +L+   K  P   +  SN+ A  +  G+   ++  ST
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIST 459

Query: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAMFDLSVLSLN 195
            AL+L P                      +SK + RRA A E +EN+ +A     +L  N
Sbjct: 460 SALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIEN 519

Query: 196 GDFNE 200
             FNE
Sbjct: 520 NIFNE 524

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 107/258 (41%), Gaps = 35/258 (13%)

Query: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191
           P  +  I   Y   G+L+   E+  K L+L P++ KA               E  F L +
Sbjct: 268 PKLWHGIGILYDRYGSLDFAEEAFKKVLDLDPNFEKA--------------NEIYFRLGI 313

Query: 192 L-SLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTL 250
           +    G +NEA IE     +LN    R       SD   Q+     L + F     +   
Sbjct: 314 IYKHKGRWNEA-IE-----SLNCILKRPPPPLTESDIWFQI--GNILENKFDWNGAKDAY 365

Query: 251 KNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTA 310
           ++  ++N ++ +LL  L  LY  ++  +   D     A    VK LE +P D       +
Sbjct: 366 EHVSKNNNSNPKLLKQLGCLYSMENVEFYNLD----IAMGHLVKSLELDPTD-------S 414

Query: 311 TALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYS-ALIMADKGESKNYFDFFDKA 369
           T   Y G     K D   ++E +Q+++    R   +  S  ++    G++ +  D + +A
Sbjct: 415 TTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRA 474

Query: 370 LDVDPNSAPVYYHRGQMH 387
           + ++P  + V+Y+ G ++
Sbjct: 475 IRLNPYISEVWYNLGTLY 492

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 34/80 (42%)

Query: 368 KALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKF 427
           K+L++DP  +  +Y+ G++H   + +             DS N   +  +  L Y  G+ 
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQN 464

Query: 428 DDCETLFSEAKRKFPTAPEV 447
            D    ++ A R  P   EV
Sbjct: 465 HDALDAYTRAIRLNPYISEV 484

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYAL-----DLKQDPVFYSNISACYVSLGNLEKVVESST 156
            K +GN+ +K ++++DA + Y   +     D   +   ++N +AC + L N  K VE   
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 157 KALELKPDYSKALLRRASANENLENFAEA 185
           KAL + P   K   R + +   L    EA
Sbjct: 146 KALTINPKNIKCYYRISKSFFQLRKLEEA 174

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESST 156
            +++G Q+FK   Y  + + Y  +L+      P   + YSNI A  + +G   K +++S+
Sbjct: 406 FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSS 465

Query: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAM 186
            ALE+ PD                     + K  LR+A A E++E+F  A+
Sbjct: 466 SALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAAL 516

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 37.4 bits (85), Expect = 0.024,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALE 160
           LK +GN  +++Q Y  AL++Y+  L+    +P+ +SN + C + L   ++  ++    L 
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGL- 65

Query: 161 LKPDYSKALLRRASANENLENFAEAM 186
                  ALLR +    NLE   + +
Sbjct: 66  -------ALLRTSPGIPNLERLHQKL 84

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145
           N  EE  E  + A  LK +GN+    + YE A+  Y  A+  L  + ++Y+N +A + SL
Sbjct: 90  NIPEEDAEIKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSL 149

Query: 146 GNLEKVVESSTKALELKPDYSKALLR 171
              ++ VE +  A+ + P Y +   R
Sbjct: 150 KGYDEAVEDAESAISIDPTYFRGYSR 175

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDLKQD-----PVFYSNISACYVSLGNL 148
           E + VA   K++GN  F  +++ +A   YN  +++K +        ++N +AC + L N 
Sbjct: 75  EPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNY 134

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEA 185
              +     AL L P   K   R   A   L N  EA
Sbjct: 135 RSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESST 156
            K KG+ FFK   Y ++L+ Y  +L+      P   +  SNI A  + +G   K +E+S+
Sbjct: 377 FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSS 436

Query: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAM 186
            AL L P                      + K ++RRA + E+LE+F+ A+
Sbjct: 437 MALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLK--QDP---VFYSNISACYVSLGNLEKVVESST 156
            K KG   FK   Y ++L+ Y  +L+      P   +  SNI A  + +G   K +E+S+
Sbjct: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436

Query: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAM 186
            ALEL P                      + K ++RRA + E+LE+F +A+
Sbjct: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           +LK +GN+    + YE A+K Y+ A+ +   + V+Y+N +A + SL N ++ ++ +  A+
Sbjct: 95  SLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAV 154

Query: 160 ELKPDYSKALLR 171
           ++   YSK   R
Sbjct: 155 KVDSSYSKGYSR 166

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 26/125 (20%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESST 156
            + KG + FK+  Y  A+  Y  +L+   ++ P   +  SN+   Y+ +G   K ++ + 
Sbjct: 293 FRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAP 352

Query: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAMFDLSVLSLN 195
            ALEL P+                     +SK ++R A A E+ EN+  A  +  +L  N
Sbjct: 353 LALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVAN 412

Query: 196 GDFNE 200
           G  NE
Sbjct: 413 GITNE 417

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 14/129 (10%)

Query: 79  NGEPDLKDSANFTEEQKETY---SVALKDKGNQFFKEQKYEDALKYYNYALDLKQ----- 130
           N EP+ K     +E+++E     ++ LK +GN+  + + Y+DA+  Y  A+DL +     
Sbjct: 65  NLEPEPK----LSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLP 120

Query: 131 -DPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDL 189
            D  + SN S      G  E+  + +   +++ P +SK   R A A      + +AM   
Sbjct: 121 VDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAY 180

Query: 190 -SVLSLNGD 197
             VL L G+
Sbjct: 181 KQVLDLEGN 189

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALE 160
           LK +GN FF++  Y  A  YY+  + L+  +P+ YSN +   +  GN    VE+  + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 92  EEQKE--TYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNL 148
           EE KE    + ALK +GN+    + Y  A++ YN A+ L     V+Y+N +A Y S    
Sbjct: 94  EEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKY 153

Query: 149 EKVVESSTKALELKPDYSKALLR 171
           ++ ++ +  A++++P++SK   R
Sbjct: 154 DEAIKDAESAIKVEPNWSKGYSR 176

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 55/125 (44%), Gaps = 28/125 (22%)

Query: 100 VALKDKGNQFFKEQKYEDALKYYNYALD-LKQ-DP---VFYSNISACYVSLGNLEKVVES 154
           +  K +G++ FK   Y  AL+ Y  +L+ L Q  P   + YSNI A  + +G   K +E 
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 155 STKALELKPD-----------------------YSKALLRRASANENLENFAEAMFDLSV 191
              AL L P                        +SK ++R+A + E+LEN+  A+     
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534

Query: 192 LSLNG 196
           L  NG
Sbjct: 535 LIENG 539

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 38/99 (38%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
             +  K+L+VD   A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 297 LGYLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 356

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 357 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 388

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145
           N  E+  ET + A  LK +GN+    + YE A+  Y  A+  L  + ++Y+N +A + SL
Sbjct: 90  NIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSL 149

Query: 146 GNLEKVVESSTKALELKPDYSKALLR 171
              ++ V+ +  A+ + P Y +   R
Sbjct: 150 KEYDQAVKDAESAISIDPSYFRGYSR 175

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145
           N  EE  ET + A  LK +GN+    + YE A+  Y  A+  L  + ++Y+N +A + SL
Sbjct: 90  NIPEEDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSL 149

Query: 146 GNLEKVVESSTKALELKPDYSKALLR 171
              ++ V+ +  ++ + P Y +   R
Sbjct: 150 REYDEAVKDAESSISIDPSYFRGYSR 175

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 32/77 (41%)

Query: 371 DVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDC 430
           ++DP+ A  +YH G++H +   Y             DS N   +  +  L Y   ++ D 
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 431 ETLFSEAKRKFPTAPEV 447
              ++ A R  P   EV
Sbjct: 367 LDAYTRAIRLNPYISEV 383

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 18/122 (14%)

Query: 257 NEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATALEYN 316
           N++  + L +L NLY+ +        + F +AAE Y + L  NP+   L +  AT     
Sbjct: 93  NQSSTKALTSLANLYRSR--------DMFQRAAELYERALSVNPE---LSDVWATL---- 137

Query: 317 GIFKFLKNDPLGSHEDIQRSIEL--HPRVNAYIYSALIMADKGESKNYF-DFFDKALDVD 373
           G    + +D   ++   Q+++    +P V    +   I+ D+  S  Y  + F K L++D
Sbjct: 138 GHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLEYAEEAFAKVLELD 197

Query: 374 PN 375
           PN
Sbjct: 198 PN 199

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.4 bits (80), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           K++GN  FK+  Y +A+  Y+  +  + Q+PV YSN +   + LG   + ++   + L
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (55%), Gaps = 3/86 (3%)

Query: 89  NFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSL 145
           N   E  ET + A  LK +GN+    + ++ A+K Y+ A++ L  + V+Y+N +A + S+
Sbjct: 85  NIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSM 144

Query: 146 GNLEKVVESSTKALELKPDYSKALLR 171
              E+ ++ +  A++  P YSK   R
Sbjct: 145 KAYEEAIKDAESAIKTDPTYSKGYSR 170

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 35.4 bits (80), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALE 160
           LK KGN  FK   Y +A+ +YN  + +   +P+ YSN +   +     ++ + +  K L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 161 L 161
           L
Sbjct: 66  L 66

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 41/104 (39%), Gaps = 7/104 (6%)

Query: 358 ESKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQL 417
           +++   +   K+L+VD   A  +YH G++H +   Y             DS N   +  +
Sbjct: 293 DTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 352

Query: 418 ACLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
             L Y   ++ D    ++ A R  P       + +EV  D G  
Sbjct: 353 GVLYYQISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 389

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 40/103 (38%), Gaps = 7/103 (6%)

Query: 359 SKNYFDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLA 418
           ++   +   K+L+VD   A  +YH G++H +   Y             DS N   +  + 
Sbjct: 298 TQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIG 357

Query: 419 CLTYHEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
            L Y   ++ D    ++ A R  P       + +EV  D G  
Sbjct: 358 VLYYQISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 393

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 38/99 (38%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            +   K+L++D   A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 344 LNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYY 403

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 404 QIAQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 435

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALE 160
           K +GN  FK+  Y +A+  Y+  +  + Q+PV YSN +   + LG   + +++  + L+
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 87  SANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSL 145
           +AN T+ +KE      K+ GN  FK+  Y +A+  Y+  +  + Q+PV YSN +   + L
Sbjct: 2   AANVTQFEKE------KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKL 55

Query: 146 GNLEKVVESSTKALE--LKPDYS 166
                 +++  + L   L P+++
Sbjct: 56  AEYTHAIQTCQEGLRYALGPEHA 78

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 38/99 (38%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            +   K+L+VD   A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 294 LNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYY 353

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 354 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 385

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 53/134 (39%), Gaps = 22/134 (16%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            ++  ++L+VD   +  +YH G++H +   Y             D+ N   +  +  L Y
Sbjct: 272 LNYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYY 331

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD-FDAASKQ-------YDIAKRL 474
              ++ D    ++ A R  P       + +EV  D G  ++  + Q       Y  A RL
Sbjct: 332 QIYQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARL 384

Query: 475 E-------ESLDAI 481
           E       E LDA+
Sbjct: 385 EPDNTHIRERLDAL 398

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALE 160
            K +GNQ+FKE  Y  A+K Y   +++  ++P+ YSN +   +     ++ V +    L 
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL- 64

Query: 161 LKPDYSKALLRRASANENLENFAEAMFDLSVLSLN 195
                 K + +  + +E ++   E   +L+  +LN
Sbjct: 65  ------KRVSKNDATHETIQKKLEYRLELAEKALN 93

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 38/99 (38%), Gaps = 7/99 (7%)

Query: 363 FDFFDKALDVDPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTY 422
            +   K+L+VD   A  +YH G++H +   Y             DS N   +  +  L Y
Sbjct: 364 LNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYY 423

Query: 423 HEGKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
              ++ D    ++ A R  P       + +EV  D G  
Sbjct: 424 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 455

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALD---LKQDP---VFYSNISACYVSLGNLEKVVESS 155
            K KG   FK   Y ++L+ Y  +L+   LK  P   +  SNI A  + +G   K +E+S
Sbjct: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431

Query: 156 TKALELKPD---------------------YSKALLRRASANENLENFAEAM 186
             AL L P                      + K ++RRA + E+LE+F  A+
Sbjct: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 96  ETYSVA--LKDKGNQFFKEQKYEDALKYYNYAL-----DLKQDPVFYSNISACYVSLGNL 148
           E + +A   K++ N  +K +++ DA + Y   +     D   +   ++N +AC + L N 
Sbjct: 80  EPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNY 139

Query: 149 EKVVESSTKALELKPDYSKALLRRASANENLENFAEA 185
              V    KA+E+ P   K   R   A   L  F EA
Sbjct: 140 RSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 65/146 (44%), Gaps = 9/146 (6%)

Query: 77  DSNGEPDLK-DSANFTEEQKETYSVA--LKDKGNQFFKEQKYEDALKYYNYALDL----- 128
           D NG  ++  D+      + E + +A   K +GN+ +K ++Y +A   Y   +++     
Sbjct: 49  DGNGGSNVTLDALKALAYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNND 108

Query: 129 KQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFD 188
           K + + + N +AC + + N    +    KAL   P   K   R A A   +E + E+   
Sbjct: 109 KINELLFVNKAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRES 168

Query: 189 LSVLSLNGDFNEASIEPMLERNLNKQ 214
           +    L  D   +S+  +L+  + KQ
Sbjct: 169 IE-FGLKVDSRNSSLLNLLKTIIKKQ 193

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYAL-DLKQDPVFYSNISACYVSLGNLEKVVESSTKAL 159
           ALK +GN+    + +E A+  Y+ A+  L  + V+++N +A Y SL    + VE +  A+
Sbjct: 100 ALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAI 159

Query: 160 ELKPDYSKALLR 171
           ++ P YSK   R
Sbjct: 160 KVNPSYSKGYSR 171

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKAL 159
            +K++GN  F+   +  A +YY   + L+ ++P+ YSN +   + L    + +++  + L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 160 -------ELKPDYSKALLRRASANENLENF 182
                  + +P   K L R   A E+L  F
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 103 KDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALEL 161
           K  GN +FK+  Y  A++YY   ++++ ++P+ YSN +   + L    + +ES    L+ 
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKY 66

Query: 162 KPDYSKALLRRASANENL 179
             D    + ++     NL
Sbjct: 67  VNDADSQVYKKLQYRYNL 84

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 26/103 (25%)

Query: 106 GNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESSTKALE 160
           G +FFK+  Y+ AL  Y  +L+   ++ P   + YSNI A  + +G   + V+    ALE
Sbjct: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612

Query: 161 LKPD---------------------YSKALLRRASANENLENF 182
           L P                      + K +LR+A A E++E +
Sbjct: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 22/111 (19%)

Query: 101 ALKDKGNQFFKEQKYEDALKYYN---------YALDLKQDPV---------FYSNISACY 142
           A+KD G   FK QK++ AL  Y          +  DL  + +          + NI+ C 
Sbjct: 220 AVKDIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCA 279

Query: 143 VSLGNLEKVVESSTKALE--LKPDYS--KALLRRASANENLENFAEAMFDL 189
           +  G+ +K + S+T+ +      D S  KAL RR  A  +L++   A+ DL
Sbjct: 280 IKTGDYQKALTSTTEVVHDAAADDKSKAKALYRRGLAYYHLKDPEMAITDL 330

>SAKL0H19272g Chr8 complement(1701420..1703108) [1689 bp, 562 aa]
           {ON} highly similar to uniprot|P40970 Saccharomyces
           cerevisiae YDR062W LCB2 Component of serine
           palmitoyltransferase responsible along with Lcb1p for
           the first committed step in sphingolipid synthesis which
           is the condensation of serine with palmitoyl-CoA to form
           3- ketosphinganine
          Length = 562

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 66/167 (39%), Gaps = 27/167 (16%)

Query: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193
            +S  S   +   +L    E        KPD   A++       N  NF  ++ D   L 
Sbjct: 187 IHSGGSRTQIGTTDLHIAAEEYVAGFVGKPD---AIIFSMGYGTN-ANFFNSILDSKCLV 242

Query: 194 LNGDFNEASIEP----------MLERNLNKQAMRVLKDKM-SSDAKQQLPSNTFLASFFG 242
           ++ +FN ASI              + N  K   ++++D++     K   P    L +  G
Sbjct: 243 VSDEFNHASIRTGVRLSGAAVKTFKHNNTKALEKLIRDQIVQGQPKSHRPWKKILIAVEG 302

Query: 243 IFTPETTLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAA 289
           +++ E T+ N           L AL+ L K+K + YL  DE+ S  A
Sbjct: 303 LYSMEGTMCN-----------LPALIEL-KKKYKCYLFVDEAHSIGA 337

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 29/126 (23%)

Query: 87  SANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDP-------VFYSNIS 139
           S N TE ++ ++    K+KG   F+   Y  A  + NY   L   P       V +SNI 
Sbjct: 314 SPNLTELERHSFE-EFKEKGANSFRTGDYHAA--FQNYEKSLNSLPLTHPLRVVSFSNII 370

Query: 140 ACYVSLGNLEKVVESSTKALELKPD-------------------YSKALLRRASANENLE 180
            C + +G   + +  ++ AL+L P                    +SK +  +A A E +E
Sbjct: 371 ICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVE 430

Query: 181 NFAEAM 186
           N+ +A+
Sbjct: 431 NYEKAL 436

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G  F+    Y+  +  +  AL +K  D + ++ + A   +    E+ +++  KAL+LKP 
Sbjct: 426 GILFYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 485

Query: 165 YSKALLRRASANENLENFAEAM-FDLSVLSLN 195
           + +A    A +  N+  F EA  + L+ LS++
Sbjct: 486 FVRARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 34/89 (38%), Gaps = 7/89 (7%)

Query: 373 DPNSAPVYYHRGQMHFLSQQYXXXXXXXXXXXXSDSSNIFPYIQLACLTYHEGKFDDCET 432
           DP+ A  +YH G++H +   Y             DS N   +  +  L Y   ++ D   
Sbjct: 281 DPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 340

Query: 433 LFSEAKRKFPTAPEVPNFYAEVLTDKGDF 461
            ++ A R  P       + +EV  D G  
Sbjct: 341 AYTRAIRLNP-------YISEVWYDLGTL 362

>TBLA0I03250 Chr9 (784716..789692) [4977 bp, 1658 aa] {ON} Anc_3.515
            YGL206C
          Length = 1658

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 9/69 (13%)

Query: 95   KETYSVALKDKGNQFFKEQKYEDA-LKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVE 153
            KE   + L+  G+Q F+EQ Y+ A L Y N +         YS +++ YV LG+    VE
Sbjct: 1200 KEPNVINLEQVGDQLFEEQNYKAAKLCYTNVS--------NYSKLASTYVYLGDYRAAVE 1251

Query: 154  SSTKALELK 162
            S+ KA  +K
Sbjct: 1252 SARKASNIK 1260

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 137 NISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEA 185
           NI ACY  L +L+  +  S K+L+L PD +K  +R       L+++  A
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIRCTRTLIKLKDWKRA 131

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 26/111 (23%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESST 156
            K++G + FK   Y  AL+ Y  +L+    + P   +  SNI A     G   K +E ST
Sbjct: 397 FKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEIST 456

Query: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAM 186
            ALE  P                      + K +L+RA A E++E++  A+
Sbjct: 457 SALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL 507

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLKQDPV-FYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G  + ++Q+  D+++++  A+ +    V  +  +   Y S G +E  ++   K LEL P 
Sbjct: 682 GISYLEKQQAADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFEKPLELSPH 741

Query: 165 YSKALLRRASANENLENFAEAM 186
           +  AL  +A    ++  F E++
Sbjct: 742 HPHALYFKALGLSDVGQFVESI 763

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 77  DSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFY 135
           D N + +LK   N  +++        KD GN+ FK+ +Y+ A++ Y   + L+  + V Y
Sbjct: 13  DVNRQRNLKHWNNGLQDKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGY 72

Query: 136 SNISACYVSLGNLEKVVESSTKALELKPDYSK 167
           SN++  Y+      +  + +  A E+   Y K
Sbjct: 73  SNLAMAYLK----NRCPDEAKTACEMGLSYCK 100

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 69/173 (39%), Gaps = 35/173 (20%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLKQDPV-FYSNISACYVSLGNLEKVVESSTKALELKPD 164
            N F  +Q++E A+ Y+  AL L +     ++ +   +V + N    +E   +A+++ P 
Sbjct: 391 ANYFSAKQQHEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPC 450

Query: 165 YSKALLRRASANENLENFAEAMFDLSVLSLNGDFNEASIEPMLERNLNKQAMRVLKDKMS 224
             KA      A E L+    A++ L            S++P+ +R    QA+    DK+ 
Sbjct: 451 DFKAWYGLGQAYEVLDRHLYALYYLQ--------KACSLKPLDKRMW--QALANCYDKLD 500

Query: 225 SDAKQQLPSNTFLASFFGIFTPETTLKNFDE----SNEADVELLNALVNLYKR 273
                                P   +K F      SN+ D+ +L  L  LY+R
Sbjct: 501 R--------------------PNQAIKCFQRASQLSNDQDITILYYLATLYER 533

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 26/111 (23%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALD--LKQDP---VFYSNISACYVSLGNLEKVVESST 156
            K KG   FK   Y ++L+ Y  AL+      P   +  SNI A  + +G   K + +S 
Sbjct: 359 FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSD 418

Query: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAM 186
            AL L P                      + K ++RRA + E+LE+F  A+
Sbjct: 419 LALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G  F+    Y+  +  +  AL ++  D + ++ + A   +    E+ +++  KAL+LKP 
Sbjct: 433 GILFYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 492

Query: 165 YSKALLRRASANENLENFAEAM-FDLSVLSLN 195
           + +A    A +  N+  + EA  + L+ LS++
Sbjct: 493 FVRARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 18/98 (18%)

Query: 109 FFKEQKYEDALKYYNYALD----LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
            F+++ +  +LK +   L     LK DP     I AC+  L + +  + +  ++LEL P 
Sbjct: 207 LFRKKNFMASLKLFQELLVNNPVLKPDPRI--GIGACFWQLKDYKMAINAWERSLELDPT 264

Query: 165 ------------YSKALLRRASANENLENFAEAMFDLS 190
                       + K L+   + +E  +NF +AM DLS
Sbjct: 265 NKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 102 LKDKGNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKAL 159
            K KGN  +K+  + DA+ +Y  A+     +PV YSN +   + L N     +   + L
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080W
           (REAL)
          Length = 750

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 137 NISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEA 185
           NI ACY  L +L+  ++ S ++L+L PD  K  +R       L+++  A
Sbjct: 92  NICACYEKLDDLKSCLKISRRSLKLDPDNVKCYIRCTRTLIKLKDWKRA 140

>SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G+ + K   YE A+  +   L+   QD   Y  I   Y+ L  +EK ++S   AL L+P 
Sbjct: 583 GHTYRKMGDYERAVACFKIVLETSNQDTSVYCAIGLIYLKLRKIEKAIDSLHNALALQPS 642

Query: 165 --YSKALLRRA 173
              ++ LL++A
Sbjct: 643 NQIAQDLLKQA 653

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 106 GNQFFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G  F+  +++   +  +  AL++   D + ++ + A   +    E+ +++  KAL LKP 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 165 YSKALLRRASANENLENFAEAMFD-LSVLSLN 195
           + +A    A ++ N+  + EA    LS LS++
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 50/104 (48%), Gaps = 10/104 (9%)

Query: 109 FFKEQKYEDALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSK 167
           F+ + +++  +  +  AL +   D + ++ + A   +    E+ +++  KAL+LKP + +
Sbjct: 406 FYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVR 465

Query: 168 ALLRRASANENLENFAEA---------MFDLSVLSLNGDFNEAS 202
           A    A ++ N+  + EA         M ++  +S NG  N  S
Sbjct: 466 ARYNLAVSSINIGCYKEAAEYLLSALKMHEVEGVSQNGTANPVS 509

>KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {ON}
           Anc_2.665 YKL022C
          Length = 704

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 106 GNQFFKEQKYEDALKYYNYAL-DLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164
           G+ + K    E A++ + Y L D ++DP  Y  +   Y+    L+K ++   +AL +KP 
Sbjct: 560 GHTYRKLGDNERAIECFKYVLQDSEKDPDLYVTLGFLYLQTKQLQKGIDCLHRALAIKPG 619

Query: 165 YSKA 168
            + A
Sbjct: 620 MTSA 623

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 67/152 (44%), Gaps = 29/152 (19%)

Query: 102 LKDKGNQFFKEQKYEDAL----KYYNYALDLKQD--PVFYSNISACYVSLGNLEKVVESS 155
            K+ G ++F    Y +AL    K +N  L  K     +  SNI +C + LG   K +ES 
Sbjct: 336 FKNNGVKYFSSGDYHNALLEFEKSFN-TLPFKHPLRIISLSNIVSCQLKLGENSKALESV 394

Query: 156 TKALELK---PDYS-----------------KALLRRASANENLENFAEAMFDLSVLSLN 195
             AL+L    P+ S                 K  L+ A   E+LEN+ +A+   + L  N
Sbjct: 395 KLALDLSDLAPNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEKALSLYANLISN 454

Query: 196 GDFNEASIEP--MLERNLNKQAMRVLKDKMSS 225
           G   +  ++     E+ +N +  +  K+K+SS
Sbjct: 455 GITEQKVMDGKRRCEKIVNPEKFKPAKEKISS 486

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query: 118 ALKYYNYALDLK-QDPVFYSNISACYVSLGNLEKVVESSTKALEL--KPDYSKALLRRAS 174
           +L Y+  A  LK  D   +  +++CYV +GN    ++S  +AL+L    D   +LL + +
Sbjct: 524 SLYYFQKACTLKPLDKRMWQALASCYVKIGNFNDAIKSFERALQLSINTDQDSSLLYKLA 583

Query: 175 ----ANENLENFAEAM 186
                + +LEN  E M
Sbjct: 584 EVYEKSNDLENCKEYM 599

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,008,799
Number of extensions: 2323330
Number of successful extensions: 8159
Number of sequences better than 10.0: 244
Number of HSP's gapped: 8335
Number of HSP's successfully gapped: 305
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)