Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.836.5ON74874838970.0
TPHA0J002206.5ON74069225330.0
TDEL0G046606.5ON73965824230.0
CAGL0A01133g6.5ON80164824200.0
NDAI0I027306.5ON83270424170.0
YPL270W (MDL2)6.5ON77362823930.0
ZYRO0F00396g6.5ON73265423760.0
Suva_16.356.5ON76770223690.0
TBLA0A071906.5ON79464823550.0
Skud_16.76.5ON77360823510.0
Smik_6.4786.5ON77368423510.0
SAKL0E00748g6.5ON77467123390.0
NCAS0D022106.5ON77367523220.0
Kwal_56.223296.5ON77664122290.0
KLLA0D00748g6.5ON78967722300.0
KLTH0C11616g6.5ON74061521780.0
KNAG0E028006.5ON74168921600.0
ACR022W6.5ON75465620910.0
Ecym_30076.5ON76967020900.0
KAFR0B064806.5ON75163219900.0
TPHA0B046201.67ON72064014180.0
Ecym_10721.67ON68360114110.0
SAKL0C02244g1.67ON71264914090.0
Kpol_2000.791.67ON70761014010.0
TDEL0C063501.67ON69363813890.0
ZYRO0F17050g1.67ON71465613880.0
AFR683C1.67ON67762813760.0
KLLA0C01991g1.67ON70658913741e-180
NCAS0B087001.67ON71561213721e-180
Kwal_33.133081.67ON70665113641e-179
NDAI0A005601.67ON71461713541e-177
Smik_12.2481.67ON69662113371e-175
YLR188W (MDL1)1.67ON69559113321e-174
Suva_10.2841.67ON69362613261e-173
KLTH0F02024g1.67ON73466713261e-173
Skud_12.2531.67ON69261513171e-172
TBLA0A053001.67ON70762113081e-170
CAGL0E00385g1.67ON60860912421e-162
Suva_13.4915.20ON6936335542e-60
Skud_13.4755.20ON6916355491e-59
YMR301C (ATM1)5.20ON6906705436e-59
Smik_13.5185.20ON6876105393e-58
SAKL0H00968g5.20ON7006385313e-57
NCAS0D024305.20ON7026155296e-57
KAFR0I025805.20ON7096325281e-56
KLTH0B09482g5.20ON6946665271e-56
KLLA0A10131g5.20ON7206225235e-56
Kwal_26.94805.20ON7196125173e-55
Kpol_1018.1851.527ON12765185231e-54
TDEL0G004305.20ON6966415084e-54
KNAG0E013205.20ON6955255051e-53
TPHA0L022705.20ON7116615007e-53
Ecym_56495.20ON6963984998e-53
NDAI0I024405.20ON7305694991e-52
KAFR0E002301.527ON12705205071e-52
TBLA0C070005.20ON7255584962e-52
YKL209C (STE6)1.527ON12905245043e-52
SAKL0A10208g1.527ON13104995043e-52
Kpol_513.235.20ON7086474944e-52
TDEL0F003401.527ON12575144972e-51
CAGL0M13739g5.20ON7275544874e-51
TBLA0B100701.527ON12965274902e-50
KNAG0G001901.527ON12755324883e-50
ZYRO0D07106g5.20ON7095524785e-50
AGL335W5.20ON6915524751e-49
AFR432W1.527ON12845124803e-49
CAGL0K00363g1.527ON12275294786e-49
Suva_11.111.527ON12905414733e-48
Skud_11.111.527ON12955364671e-47
ZYRO0G02244g1.527ON12735304626e-47
NDAI0D015401.527ON12935114619e-47
NCAS0G035101.527ON12885374537e-46
TPHA0O001601.527ON12535284511e-45
KLTH0B01100g1.527ON12985274492e-45
KLLA0B14256g1.527ON12715314474e-45
Kwal_33.155611.527ON12975334431e-44
Smik_11.141.527ON13165604386e-44
YHL035C (VMR1)4.6ON15925294252e-42
Ecym_36121.527ON13154964225e-42
KNAG0J027304.52ON15375444201e-41
KNAG0E011204.6ON17175734066e-40
CAGL0E03982g4.6ON16595194067e-40
NCAS0J00160singletonON16545624067e-40
Smik_12.484.52ON15575444003e-39
NCAS0E041605.10ON15065554004e-39
KAFR0I013004.52ON15365454004e-39
NDAI0B006405.10ON14915463987e-39
KAFR0C065105.10ON14575093978e-39
CAGL0E03355g4.52ON15355583933e-38
Smik_8.64.6ON15855283923e-38
ZYRO0G07612g4.6ON16954933923e-38
Suva_10.234.6ON16615523924e-38
TPHA0C009608.303ON15235163905e-38
TBLA0G007104.6ON16915073899e-38
YLL048C (YBT1)4.6ON16615373889e-38
NCAS0C059304.6ON16575863871e-37
Ecym_84184.6ON16785173862e-37
TDEL0E056104.52ON15355253852e-37
Skud_12.524.52ON15615393853e-37
SAKL0H26026g4.6ON16535023843e-37
Ecym_42658.303ON15055013834e-37
TDEL0G018504.6ON16425043809e-37
KNAG0K001705.10ON14425493791e-36
KLLA0E00529g4.6ON16505273782e-36
NDAI0H001904.6ON16825213772e-36
Suva_10.60singletonON9905443753e-36
Suva_10.594.52ON15615443754e-36
Kpol_311.34.6ON16575063754e-36
Suva_8.164.6ON15995193745e-36
Smik_12.114.6ON16615513711e-35
Skud_12.224.6ON16615213711e-35
Skud_7.6145.10ON14775333702e-35
KAFR0L001904.6ON16535373683e-35
YLL015W (BPT1)4.52ON15595363665e-35
NDAI0J011508.303ON15174843656e-35
CAGL0G00242g5.10ON14775623656e-35
Kwal_56.22747na 1ON15385433656e-35
Skud_8.94.6ON15875193648e-35
TPHA0K023104.6ON16494913648e-35
KLTH0C09240gna 1ON15465303631e-34
Kpol_1060.75.10ON14605673621e-34
Smik_16.275.10ON14775393622e-34
KLLA0D04059g4.52ON15685263612e-34
Suva_7.5775.10ON14785703603e-34
Kwal_34.157704.6ON14365103585e-34
KLTH0H16038g4.6ON16495203577e-34
SAKL0H16016g8.303ON14994833551e-33
YGR281W (YOR1)5.10ON14775753541e-33
KAFR0B056308.303ON15154903523e-33
Skud_4.3958.303ON15164963514e-33
YDR135C (YCF1)8.303ON15154933495e-33
NCAS0B034708.303ON15124933487e-33
KNAG0I009908.303ON15355153489e-33
CAGL0C03289g4.6ON16485153471e-32
Smik_4.3808.303ON15165243452e-32
Suva_2.2978.303ON15164923442e-32
ZYRO0G22176g4.52ON15705353433e-32
TPHA0F001804.6ON16465113434e-32
TPHA0F004104.52ON15705713425e-32
SAKL0H00704g5.10ON14395053362e-31
Smik_11.367na 2ON15955723353e-31
TDEL0G003305.10ON14655533353e-31
YKR104WsingletonON3062943145e-31
Skud_18.2singletonON15805403327e-31
Kpol_1033.288.303ON15314863327e-31
KLTH0G12716g8.303ON15004833311e-30
AGR047W8.303ON14925243292e-30
Zrou_YGOB_Anc_5.105.10ON9925003254e-30
ZYRO0D06160g8.303ON15254983246e-30
KLLA0F20075g8.303ON15165183238e-30
TDEL0F043008.303ON15144793221e-29
KLTH0B09724g5.10ON14865073221e-29
CAGL0L06402g8.303ON15354703122e-28
TPHA0A056205.10ON14775243112e-28
Kwal_56.238448.303ON14944663094e-28
Kpol_YGOB_1041.454.52ON15685353085e-28
ACL072C4.6ON16275043085e-28
Kpol_1041.45singletonOFF15965353086e-28
TBLA0A06840singletonON10584923041e-27
TBLA0C06400singletonON13775423041e-27
SAKL0H23958g4.52ON15585213032e-27
Kwal_26.95325.10ON14715173032e-27
KLTH0B00396gsingletonON15074993032e-27
KLLA0C14234g5.10ON14545423005e-27
TBLA0C071005.10ON14855562845e-25
AGL346W5.10ON14004952764e-24
TBLA0A038008.303ON15466422659e-23
Ecym_56605.10ON15362522175e-17
YKR103W (NFT1)na 2ON12182312076e-16
ACR128C8.661ON8272411816e-13
Kpol_175.1singletonON13774211809e-13
SAKL0D10208g1.366ON7522391701e-11
KAFR0A037908.661ON8762831692e-11
KNAG0A029808.661ON8713051664e-11
TPHA0O010001.427ON10113211664e-11
NCAS0E004803.534ON6101901645e-11
TDEL0B057601.427ON10363061655e-11
KLLA0A01452g3.534ON6073311637e-11
Ecym_11943.534ON6093171628e-11
YPL147W (PXA1)8.661ON8702031639e-11
AEL032W1.366ON7532831621e-10
Smik_6.3448.661ON8702031621e-10
Suva_16.1638.661ON8702031602e-10
Suva_5.1343.534ON6101901592e-10
NDAI0I030203.534ON6091901583e-10
KAFR0J027003.534ON6081741583e-10
Ecym_24108.661ON8281901583e-10
SAKL0F01606g3.534ON6081901574e-10
TBLA0D017805.500ON15953081584e-10
TPHA0D011708.661ON9152071575e-10
ZYRO0D11880g5.500ON14982221575e-10
ZYRO0F07018g8.661ON8612511575e-10
TBLA0C012201.366ON7512361558e-10
ZYRO0G01144g1.366ON7522771558e-10
KAFR0C045401.366ON7522431549e-10
CAGL0I04862g3.220ON15072731551e-09
Skud_16.1358.661ON8702031541e-09
Smik_7.3131.366ON7522751541e-09
Kwal_26.87308.661ON8313541541e-09
TBLA0D01820singletonON15513041551e-09
YNR070W (PDR18)na 3ON13333151541e-09
KNAG0C019601.366ON7522381531e-09
CAGL0K10472g1.366ON7522681531e-09
KNAG0B004603.534ON6601881531e-09
ZYRO0D11836gna 4ON14622581541e-09
YFR009W (GCN20)1.366ON7522371531e-09
SAKL0C11616g3.220ON14842761541e-09
KLTH0D10890g8.661ON8302111531e-09
TBLA0D043501.427ON11192181541e-09
Kpol_1050.263.534ON6101901521e-09
Skud_14.404na 3ON14243071531e-09
NDAI0E012408.661ON8972041522e-09
SAKL0H21010gsingletonON14472691532e-09
TBLA0I033303.534ON6102121512e-09
TDEL0D040403.220ON15003111522e-09
TDEL0A036405.500ON15093041522e-09
KLLA0F11484g8.661ON8452051512e-09
Smik_5.1593.534ON6101881502e-09
YER036C (ARB1)3.534ON6101881503e-09
TDEL0D060203.534ON6101901503e-09
Skud_5.1453.534ON6101881503e-09
Skud_4.2623.220ON15012701513e-09
KLLA0D03432g3.220ON14832701513e-09
YDR011W (SNQ2)3.220ON15013121513e-09
KLTH0A01914g3.220ON14993021503e-09
KLLA0A10857g1.366ON7522881503e-09
KAFR0C052205.500ON14992481503e-09
TPHA0A058903.534ON6102721493e-09
ZYRO0E08800g3.534ON6101881493e-09
Ecym_36043.220ON14742281504e-09
ZYRO0B05588g3.133ON12702341504e-09
NCAS0A085701.427ON10603251494e-09
AGL142CsingletonON14972211504e-09
NCAS0E016303.220ON15652691495e-09
Ecym_27141.366ON7482721485e-09
KLTH0G01452g3.534ON6071891485e-09
KNAG0B038705.500ON15132221495e-09
Kwal_47.191163.534ON6071881467e-09
NCAS0D005801.366ON7532901468e-09
KLTH0H13442g1.366ON7522451468e-09
Kwal_23.51613.220ON14892681479e-09
Smik_4.2443.220ON15012701479e-09
KAFR0C00820na 5ON15173211479e-09
Kpol_1012.108.661ON8551511461e-08
AFR232C3.534ON6071881451e-08
Kpol_1043.431.366ON7522391451e-08
NCAS0E01640na 5ON15022931451e-08
ZYRO0D17710gsingletonON14862211451e-08
YOL075C3.133ON12942501451e-08
Suva_6.841.366ON7522531441e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.83
         (748 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...  1505   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   980   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   937   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   936   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   935   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   926   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   919   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   917   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   911   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   910   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   910   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   905   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      899   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   863   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   863   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   843   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   836   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   810   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   809   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   771   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   550   0.0  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   548   0.0  
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   547   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   544   0.0  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   539   0.0  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   539   0.0  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   534   0.0  
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   533   e-180
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   533   e-180
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   530   e-179
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   526   e-177
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   519   e-175
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   517   e-174
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   515   e-173
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   515   e-173
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   511   e-172
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   508   e-170
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   483   e-162
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   218   2e-60
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   216   1e-59
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   213   6e-59
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   212   3e-58
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   209   3e-57
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     208   6e-57
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   207   1e-56
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   207   1e-56
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   206   5e-56
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   203   3e-55
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   206   1e-54
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   200   4e-54
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   199   1e-53
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   197   7e-53
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   196   8e-53
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   196   1e-52
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   199   1e-52
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   195   2e-52
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   198   3e-52
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   198   3e-52
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   194   4e-52
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   196   2e-51
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   192   4e-51
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   193   2e-50
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   192   3e-50
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   188   5e-50
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   187   1e-49
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   189   3e-49
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   188   6e-49
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   186   3e-48
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   184   1e-47
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   182   6e-47
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   182   9e-47
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   179   7e-46
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   178   1e-45
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   177   2e-45
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   176   4e-45
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   175   1e-44
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   173   6e-44
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   168   2e-42
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   167   5e-42
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   166   1e-41
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   160   6e-40
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   160   7e-40
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   160   7e-40
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   158   3e-39
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    158   4e-39
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   158   4e-39
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    157   7e-39
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   157   8e-39
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   155   3e-38
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   155   3e-38
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   155   3e-38
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   155   4e-38
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   154   5e-38
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   154   9e-38
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   154   9e-38
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   153   1e-37
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   153   2e-37
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   152   2e-37
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   152   3e-37
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   152   3e-37
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   152   4e-37
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   150   9e-37
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   150   1e-36
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   150   2e-36
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   149   2e-36
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   149   3e-36
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   149   4e-36
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   149   4e-36
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   148   5e-36
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   147   1e-35
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   147   1e-35
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   147   2e-35
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   146   3e-35
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   145   5e-35
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   145   6e-35
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   145   6e-35
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   145   6e-35
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   144   8e-35
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   144   8e-35
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   144   1e-34
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   144   1e-34
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   144   2e-34
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   143   2e-34
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   143   3e-34
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   142   5e-34
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   142   7e-34
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   141   1e-33
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   140   1e-33
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   140   3e-33
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   139   4e-33
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   139   5e-33
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   138   7e-33
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   138   9e-33
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   138   1e-32
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   137   2e-32
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   137   2e-32
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   136   3e-32
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   136   4e-32
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   136   5e-32
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   134   2e-31
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   133   3e-31
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   133   3e-31
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   125   5e-31
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   132   7e-31
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   132   7e-31
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   132   1e-30
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   131   2e-30
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   129   4e-30
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   129   6e-30
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   129   8e-30
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   128   1e-29
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   128   1e-29
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   124   2e-28
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   124   2e-28
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   123   4e-28
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   123   5e-28
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   123   5e-28
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   123   6e-28
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   121   1e-27
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   121   1e-27
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   121   2e-27
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   121   2e-27
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   121   2e-27
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   120   5e-27
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           114   5e-25
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   110   4e-24
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   106   9e-23
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    88   5e-17
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    84   6e-16
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    74   6e-13
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    74   9e-13
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    70   1e-11
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    70   2e-11
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    69   4e-11
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    69   4e-11
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 68   5e-11
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    68   5e-11
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    67   7e-11
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    67   8e-11
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    67   9e-11
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    67   1e-10
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    67   1e-10
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    66   2e-10
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    66   2e-10
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    65   3e-10
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    65   3e-10
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    65   3e-10
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    65   4e-10
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    65   4e-10
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    65   5e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    65   5e-10
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    65   5e-10
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    64   8e-10
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    64   8e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    64   9e-10
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    64   1e-09
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    64   1e-09
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    64   1e-09
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    64   1e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              64   1e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    64   1e-09
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    64   1e-09
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    64   1e-09
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    64   1e-09
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    64   1e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    64   1e-09
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    64   1e-09
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    64   1e-09
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    64   1e-09
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    63   1e-09
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    64   1e-09
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     63   2e-09
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    64   2e-09
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    63   2e-09
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    63   2e-09
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    63   2e-09
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    63   2e-09
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    62   2e-09
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    62   3e-09
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    62   3e-09
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    62   3e-09
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    63   3e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    63   3e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    63   3e-09
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    62   3e-09
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    62   3e-09
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    62   3e-09
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    62   3e-09
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    62   3e-09
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    62   4e-09
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    62   4e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    62   4e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    62   4e-09
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    62   5e-09
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    62   5e-09
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    62   5e-09
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    62   5e-09
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    61   7e-09
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       61   8e-09
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    61   8e-09
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    61   9e-09
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    61   9e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              61   9e-09
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    61   1e-08
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    60   1e-08
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    60   1e-08
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    60   1e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    60   1e-08
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    60   1e-08
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    60   1e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    60   2e-08
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    60   2e-08
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    60   2e-08
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    60   2e-08
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    60   2e-08
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    60   2e-08
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    60   2e-08
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    60   2e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    60   2e-08
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    59   3e-08
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    59   3e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    59   3e-08
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    59   3e-08
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    59   4e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    59   4e-08
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    59   4e-08
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    59   4e-08
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    59   4e-08
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    59   5e-08
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    59   5e-08
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    59   5e-08
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    59   5e-08
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    59   5e-08
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    59   5e-08
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    59   5e-08
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    58   6e-08
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    58   6e-08
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    58   8e-08
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    58   9e-08
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    58   9e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    57   1e-07
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                57   1e-07
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    57   1e-07
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    57   1e-07
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    57   1e-07
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     57   1e-07
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    57   1e-07
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    57   2e-07
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    57   2e-07
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            57   2e-07
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    57   2e-07
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    57   2e-07
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            57   2e-07
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    57   2e-07
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    57   2e-07
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     57   2e-07
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    56   3e-07
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    56   3e-07
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    51   3e-07
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    56   3e-07
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    56   3e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    56   3e-07
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    56   3e-07
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    56   4e-07
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    56   4e-07
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    56   4e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    56   4e-07
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    56   4e-07
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    56   4e-07
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    56   4e-07
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    55   5e-07
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    55   5e-07
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    55   5e-07
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    55   5e-07
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    55   5e-07
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    55   5e-07
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    55   5e-07
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    55   6e-07
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    55   6e-07
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    55   6e-07
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    55   6e-07
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    55   7e-07
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    55   7e-07
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    55   7e-07
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    55   7e-07
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    55   7e-07
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    55   7e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    55   8e-07
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    55   8e-07
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    55   8e-07
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    55   8e-07
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    55   9e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    54   9e-07
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    54   1e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    54   1e-06
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    54   1e-06
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    54   1e-06
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    54   1e-06
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    54   1e-06
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    54   1e-06
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             54   2e-06
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    54   2e-06
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    54   2e-06
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    54   2e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    54   2e-06
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    54   2e-06
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    54   2e-06
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    53   2e-06
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    54   2e-06
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    52   2e-06
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    53   2e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    53   3e-06
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    53   3e-06
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    53   3e-06
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    52   3e-06
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    53   3e-06
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    53   3e-06
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    53   3e-06
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    53   3e-06
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    52   3e-06
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    53   4e-06
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    52   4e-06
NDAI0A08370 Chr1 complement(1924865..1929079) [4215 bp, 1404 aa]...    52   4e-06
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    52   4e-06
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    52   5e-06
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    52   5e-06
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    52   5e-06
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    51   5e-06
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    52   5e-06
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    52   5e-06
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    52   5e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    52   6e-06
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    52   6e-06
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    51   7e-06
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    52   7e-06
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    52   7e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    52   7e-06
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    52   8e-06
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    52   8e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    52   8e-06
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    51   8e-06
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    51   9e-06
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    51   9e-06
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    51   9e-06
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    51   9e-06
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    51   1e-05
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    51   1e-05
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    50   1e-05
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    51   1e-05
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    51   1e-05
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              51   1e-05
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    50   1e-05
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    50   2e-05
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    50   2e-05
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    50   2e-05
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    50   2e-05
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    49   2e-05
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              50   2e-05
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    50   2e-05
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    50   2e-05
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    49   2e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    50   2e-05
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    50   3e-05
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    50   3e-05
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    50   3e-05
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    50   3e-05
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    49   3e-05
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    49   3e-05
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    49   4e-05
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    49   4e-05
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    49   4e-05
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    49   4e-05
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    49   4e-05
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    49   4e-05
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    49   4e-05
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    49   5e-05
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    49   5e-05
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    49   5e-05
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    48   5e-05
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    49   6e-05
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    47   8e-05
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    48   9e-05
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    48   9e-05
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    47   1e-04
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    48   1e-04
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    47   1e-04
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    47   1e-04
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             47   1e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    47   2e-04
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    47   2e-04
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    47   2e-04
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    46   2e-04
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    47   2e-04
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    47   3e-04
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    46   3e-04
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    46   3e-04
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    46   3e-04
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    46   3e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    46   3e-04
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    46   3e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    46   4e-04
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    45   4e-04
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    45   6e-04
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   7e-04
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    44   7e-04
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    45   8e-04
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    44   0.001
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    44   0.001
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          44   0.001
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    44   0.001
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    44   0.001
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    44   0.001
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    44   0.001
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    44   0.001
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    44   0.001
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    44   0.001
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    44   0.001
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    44   0.002
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    44   0.002
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    43   0.002
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    44   0.002
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    44   0.002
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    44   0.002
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    44   0.002
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     44   0.002
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    43   0.002
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    42   0.002
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    44   0.002
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    43   0.003
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    43   0.003
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    43   0.003
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    42   0.003
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    43   0.003
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    43   0.004
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    42   0.004
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    42   0.004
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    42   0.005
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    42   0.005
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    42   0.005
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    42   0.005
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    42   0.006
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    41   0.006
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    42   0.008
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.008
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    42   0.008
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    42   0.008
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    42   0.009
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    42   0.009
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    41   0.010
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    40   0.012
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    41   0.013
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    41   0.014
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    40   0.016
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    40   0.029
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    39   0.048
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    38   0.053
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    39   0.054
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    38   0.057
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    39   0.070
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    38   0.085
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    37   0.089
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    38   0.099
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    38   0.099
Kwal_56.24144 s56 (871400..873259) [1860 bp, 619 aa] {OFF} YPL21...    38   0.11 
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    37   0.14 
Kwal_YGOB_56.24139 s56 (869882..873259) [3378 bp, 1125 aa] {ON} ...    37   0.15 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.20 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    37   0.21 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    37   0.22 
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    37   0.25 
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    36   0.47 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    36   0.48 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    36   0.53 
NCAS0B02520 Chr2 (422176..422730) [555 bp, 184 aa] {ON} Anc_8.47...    34   0.61 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    35   0.61 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    35   0.61 
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    34   1.3  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    34   1.6  
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    34   1.6  
Kpol_1065.38 s1065 (85860..86114) [255 bp, 84 aa] {ON} (85860..8...    31   1.7  
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    34   1.8  
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    34   1.8  
KNAG0M00750 Chr13 (126489..128060) [1572 bp, 523 aa] {ON} Anc_6....    34   1.9  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    34   1.9  
SAKL0A06908g Chr1 (612325..613836) [1512 bp, 503 aa] {ON} simila...    33   2.4  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    33   2.6  
NDAI0C05170 Chr3 complement(1201173..1201745) [573 bp, 190 aa] {...    32   2.6  
KNAG0F00950 Chr6 (173909..176167) [2259 bp, 752 aa] {ON} Anc_2.2...    33   3.1  
SAKL0B06842g Chr2 complement(590086..590343) [258 bp, 85 aa] {ON...    30   3.4  
ZYRO0G20746g Chr7 complement(1708413..1709594) [1182 bp, 393 aa]...    32   4.0  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    32   4.6  
Skud_7.420 Chr7 complement(704309..705736) [1428 bp, 475 aa] {ON...    32   4.8  
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    32   5.4  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    32   5.4  
Suva_43.1 Chr43 (2..1099) [1098 bp, 366 aa] {ON} YDR011W (REAL)        32   5.9  
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    32   7.0  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    32   9.2  

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score = 1505 bits (3897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/748 (98%), Positives = 735/748 (98%)

Query: 1   MWRIPRNAVSLRYHHPSLGCLMHKVPKTRNLIQFRQIVQLSNNKAKXXXXXXXXXXXXXK 60
           MWRIPRNAVSLRYHHPSLGCLMHKVPKTRNLIQFRQIVQLSNNKAK             K
Sbjct: 1   MWRIPRNAVSLRYHHPSLGCLMHKVPKTRNLIQFRQIVQLSNNKAKQFQLLQQQQQQQLK 60

Query: 61  SNTIARLLLNIPSKRFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAI 120
           SNTIARLLLNIPSKRFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAI
Sbjct: 61  SNTIARLLLNIPSKRFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAI 120

Query: 121 SLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLV 180
           SLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLV
Sbjct: 121 SLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLV 180

Query: 181 GTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSR 240
           GTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSR
Sbjct: 181 GTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSR 240

Query: 241 SLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQ 300
           SLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQ
Sbjct: 241 SLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQ 300

Query: 301 EATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAV 360
           EATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAV
Sbjct: 301 EATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAV 360

Query: 361 LGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASR 420
           LGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASR 420

Query: 421 LFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIV 480
           LFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIV
Sbjct: 421 LFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIV 480

Query: 481 GPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRD 540
           GPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRD
Sbjct: 481 GPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRD 540

Query: 541 NITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARAL 600
           NITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARAL 600

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGN 660
           IKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGN
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGN 660

Query: 661 DGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESD 720
           DGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESD
Sbjct: 661 DGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESD 720

Query: 721 ITQELLENPIKEAIMDVAADNKPITPRK 748
           ITQELLENPIKEAIMDVAADNKPITPRK
Sbjct: 721 ITQELLENPIKEAIMDVAADNKPITPRK 748

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/692 (69%), Positives = 573/692 (82%), Gaps = 21/692 (3%)

Query: 66  RLLLNIPSKRFNSTNTKEQE---SSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISL 122
           ++   I +KR++S+ T   +     +  DG+       D+KRL  LAK+DWKLL  A+ L
Sbjct: 45  KIACTITTKRWSSSKTTAPQVRVPKSRNDGN-------DIKRLLSLAKKDWKLLCIAVGL 97

Query: 123 LSVSCLIGMSLPKIIGIVLDELKQIMS--------NPDFTVD--DVPEIAFGLNLYEFIS 172
           L+VSC IGMSLPK+IG+VLD LK  +S        + D +++  ++P IAFGL+LYEF+ 
Sbjct: 98  LTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLG 157

Query: 173 LVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLS 232
            +G +LL+GTAAN+GRV+LLRVLSERVVARLR+ VIKKT+HQDAEFFDNNKVGDLISRL 
Sbjct: 158 CIGAALLIGTAANFGRVVLLRVLSERVVARLRSQVIKKTIHQDAEFFDNNKVGDLISRLG 217

Query: 233 SDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLI 292
           SDAYVVSRS+TQKVSDGFKA+LCG VG+GMM+SISP+LSAFLLF TPPVMLS+ YFGRLI
Sbjct: 218 SDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSISPELSAFLLFFTPPVMLSSMYFGRLI 277

Query: 293 RNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINA 352
           R+NSR LQEATG LT+V+EEQFSG+KTVQ+FVAEQ+EIKRYN+ I+ ++NVGK+SAFINA
Sbjct: 278 RDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINA 337

Query: 353 KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIM 412
           K F++T+ LGDMSFL+VLAYGSYLVLHG LSIGDLTAYMMYTE TGS++FGLS+FYSEIM
Sbjct: 338 KLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIM 397

Query: 413 QGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKID 472
           QG GAASRLFELTDRIP ISPT GKK++P KGEIEFKNVSF+YPTR  +QIFK+L+FKI+
Sbjct: 398 QGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIE 457

Query: 473 AGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPV 532
            GSNVCIVGPSGRGKSTIASLLL+YY PT G I VDGQDISK++SKSLRRH+ IVQQEP+
Sbjct: 458 PGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPI 517

Query: 533 LMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQ 592
           LMSG+IRDNITYGL  + T +E+R +TK+CFCHNFITKFP+ Y TILGP+GTLLSGGQKQ
Sbjct: 518 LMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQ 577

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRS 652
           RIAIARAL+KKP +LILDEATSALDVESE AINYTFGKLMK K +TIISIAHRLSTIRRS
Sbjct: 578 RIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRS 637

Query: 653 ENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINI 712
           E VIVLGNDGSV E+GKFK L+ +P SELS+LL+EK+T +ER  N    +  + E   N 
Sbjct: 638 EIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTINERNPNEKPAETPEQESQKNA 697

Query: 713 EN-STPESDITQELLENPIKEAIMDVAADNKP 743
            N S  +  + +E+L+N I+        D +P
Sbjct: 698 ANESIVDVVLEEEILQNDIRSQDEKDILDKQP 729

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/658 (68%), Positives = 550/658 (83%), Gaps = 12/658 (1%)

Query: 93  SNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPD 152
           +  K  L D+ RL  LAK DWKLL+ AI+LL+VSC IGM++PK+IG++LD LK  +   +
Sbjct: 85  AEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNE 144

Query: 153 -----FTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANV 207
                 ++ DVP I  G ++YEF+      ++ G  ANYGR++LLR+LSERVVARLRANV
Sbjct: 145 GKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANV 204

Query: 208 IKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISIS 267
           IKKT+HQD+EFFD +KVGDLISRL SDAYVVSRS+TQKVSDGFKA++CG VG+GMM+SIS
Sbjct: 205 IKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSIS 264

Query: 268 PQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQ 327
           PQLS  LL  TPPV+ SAS FGR IR+ S DLQEATG LT+V+EEQ SG++TVQSFVAEQ
Sbjct: 265 PQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQ 324

Query: 328 KEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDL 387
           KEI RY+HAIR IFNVGK++A+INA+FF+ T+ LGD+SFLVVLAYGSYLVL G L+IGDL
Sbjct: 325 KEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDL 384

Query: 388 TAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIE 447
           TA+M+YTEYTGSS+FGL++FYSE+MQG GAA+RLFELTDR+PSI PT GKKFVP KGEI 
Sbjct: 385 TAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIV 444

Query: 448 FKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFV 507
           FK+V+FSYPTR  N IF+++  KI AGSNVC+VGPSGRGKSTIA LLLR+YNP++GQIF+
Sbjct: 445 FKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFI 504

Query: 508 DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNF 567
           DGQDISK++ KSLRRH+ +VQQEPVLMSGT+RDNITYGL E P+++E+R + K+CFCHNF
Sbjct: 505 DGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNF 564

Query: 568 ITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           I KFP+ YDT++GP G LLSGGQKQRIAIARALIKKPTIL+LDEATSALDVESEGAINYT
Sbjct: 565 IVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYT 624

Query: 628 FGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
           FG+LMKSKS+TI+SIAHRLSTIRRSEN+IVLGNDGSV E GKFKEL+ADP SELSKLL+E
Sbjct: 625 FGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLLNE 684

Query: 688 KATRSERQQNTAEDQEID-PEETINIENSTPESDITQELLENPIKEAIMDVAADNKPI 744
           K++RSE   ++      + PE+  N +N+ PE     E  ++ ++E + DV A+ KPI
Sbjct: 685 KSSRSENSSSSYSPNASEQPEDEANQKNA-PE-----EAHDDSVEEILKDVTAEGKPI 736

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/648 (69%), Positives = 537/648 (82%), Gaps = 24/648 (3%)

Query: 75  RFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLP 134
           R  S   KE++S T  + S    E  D+ RL  L +RDWKLLLTA+ LL++SC IGM++P
Sbjct: 97  RKYSKKEKEEQSETKENHS----EFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIP 152

Query: 135 KIIGIVLDELKQIMS-----NPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRV 189
           K+IG++LD+LK  ++         ++D +P I FGL+ YEF+    ++LLVG AANYGR+
Sbjct: 153 KVIGLILDQLKNALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRI 212

Query: 190 ILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDG 249
           ILLRVLSER+VARLRA VIKKT+HQDAEFFD +KVGDLISRL SDAYVVSRS+TQKVSDG
Sbjct: 213 ILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDG 272

Query: 250 FKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKV 309
           FKA++CGSVGIGMM+++SPQLS  LL  TPPV+LSAS FG+ I   SR+LQEATG LTKV
Sbjct: 273 FKALICGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKV 332

Query: 310 AEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVV 369
           AEEQ SGIKTVQSFVAEQ+EI RYN AIR IFN+GK++A INAKFFS T+ +GD+SFL V
Sbjct: 333 AEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTV 392

Query: 370 LAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIP 429
           L +GSYLVL  SL+IGDLTA+MMYTEYTG+SIFGLSTFYSEIMQGAGAASRLFELTDR+P
Sbjct: 393 LGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVP 452

Query: 430 SISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
           SIS T G K+ P  GEIEFKNVSF+YPTR SN IFKNL+FKI+AGSNVCIVGPSGRGKST
Sbjct: 453 SISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKST 512

Query: 490 IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK 549
           +A LL +YY P++G+I +DGQ+I+ ++SKSLRRH+ +VQQEP+LMSGTIRDNI YGL E 
Sbjct: 513 VALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEM 572

Query: 550 PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
           PT+DE+R + K+CFCHNFIT+F +SYDT++GPHGTLLSGGQKQRIAIARALIKKP ILIL
Sbjct: 573 PTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILIL 632

Query: 610 DEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
           DEATSALDVESEGAINYTFG+LMK K +TI+SIAHRLSTIRRSENVIVLG+DGSV E+GK
Sbjct: 633 DEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 692

Query: 670 FKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTP 717
           FKEL+ DP SELS+LL+EK+T               P +T NI  + P
Sbjct: 693 FKELWDDPTSELSQLLNEKST---------------PHQTTNITVTPP 725

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/704 (65%), Positives = 570/704 (80%), Gaps = 34/704 (4%)

Query: 75  RFNST-NTKEQ-----ESSTHTDGSNDKFELS---------DLKRLARLAKRDWKLLLTA 119
           RFNST NT +      ES+  T  S +  E+          D+ RL  L K+D+KLL+ +
Sbjct: 121 RFNSTTNTTDTIPPHTESTESTKASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVS 180

Query: 120 ISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLL 179
           ++LL++SC IGM +PKIIG++LD LK + + PD      P I FGL LYEF+    V+L 
Sbjct: 181 LTLLTISCTIGMMIPKIIGLILDALKSVATTPDGGSSPPPTIMFGLTLYEFLGGFSVALF 240

Query: 180 VGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVS 239
           +G AANYGR+ILLR+LSER+VARLR+ V+K T+HQD+EFFD +KVGDLISRL +D+Y+VS
Sbjct: 241 IGCAANYGRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVS 300

Query: 240 RSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDL 299
           RS+TQK+SDG K+++CG VGIGMM+ +S  LS+ L+    PV+LSAS FG+ IR NSR+L
Sbjct: 301 RSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSREL 360

Query: 300 QEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTA 359
           Q+ATG LT+V+EEQ +G++TVQSFVAEQ+EIKR+NH+IR IF+VGK++AFINAKFF+ T+
Sbjct: 361 QDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTS 420

Query: 360 VLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAAS 419
           ++GD+SFL VL YGSYLVLHGSL+IGDLTA+M+YTEYTG++IFGLSTFYSEIMQGAGAAS
Sbjct: 421 LVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAAS 480

Query: 420 RLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCI 479
           RLFELTDR+P+I PTLGK + P KGEIEFKNVSF+YPTR SNQIFK+L+FKI  GSNVCI
Sbjct: 481 RLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCI 540

Query: 480 VGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIR 539
           VGPSG+GKSTIA LLL YYNPT+GQI +DGQDI+K++SKSLRR +++VQQEPVLMSGTIR
Sbjct: 541 VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600

Query: 540 DNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARA 599
           DNITYGL E+PT++E+R++ K+CFCHNFI KFP +YDT +GPHGTLLSGGQKQRIAIARA
Sbjct: 601 DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA 660

Query: 600 LIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLG 659
           LIKKP ILILDEATSALDVESEGAINYTFG+LMKSKS+TI+SIAHRLSTIRRSEN+IVLG
Sbjct: 661 LIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLG 720

Query: 660 NDGSVAEVGKFKELYADPGSELSKLLHEKATRSE-----------RQQNTAEDQEIDPEE 708
           NDGSV E+GKFKEL+ADP SELSKLL+EK++R +              ++A    I  E 
Sbjct: 721 NDGSVVEMGKFKELFADPTSELSKLLNEKSSRKKVVTKTVPPVSSTSVSSANGSSIHHEG 780

Query: 709 TI--------NIENSTPESDITQELLENPIKEAIMDVAADNKPI 744
           TI        + E+  P + IT + LE+ I+  + DV+A++KPI
Sbjct: 781 TILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAESKPI 824

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/628 (73%), Positives = 530/628 (84%), Gaps = 3/628 (0%)

Query: 81  TKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIV 140
           +K    S H    +   +  D+ RL  LAKRDWKLLLTAI LL++SC IGMS+PK+IGIV
Sbjct: 84  SKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIV 143

Query: 141 LDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVV 200
           LD LK   S  DF    +P   F L LYEF+S   V+LL+G AAN+GR ILLR+LSERVV
Sbjct: 144 LDTLKT-SSGSDFFDLKIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVV 200

Query: 201 ARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGI 260
           ARLRANVIKKT+HQDAEFFDN+KVGDLISRL SDAYVVSRS+TQKVSDG KA++CG VG+
Sbjct: 201 ARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 260

Query: 261 GMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTV 320
           GMM S+SPQLS  LLF TPPV+ SAS FG+ IRN S+DLQEATG LT+VAEEQ SGIKTV
Sbjct: 261 GMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320

Query: 321 QSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHG 380
           QSFVAE  E+ RYN AIR IF VGK +AF NAKFF+ T++LGD+SFL VLAYGSYLVL  
Sbjct: 321 QSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQS 380

Query: 381 SLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFV 440
            LSIGDLTA+M+YTEYTG+++FGLSTFYSEIMQGAGAASRLFELTDR PSISPT+G K+ 
Sbjct: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK 440

Query: 441 PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
           P++G IEFK+VSFSYPTR S QIFKNL+FKI  GS+VCIVGPSGRGKSTIA LLLRYYNP
Sbjct: 441 PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500

Query: 501 TTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITK 560
           TTG I +D QDISK++ KSLRRH+ IVQQEPVLMSGTIRDNITYGL   PT++E+RS+ K
Sbjct: 501 TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560

Query: 561 KCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +CFCHNFITKFPN+YDT++GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES
Sbjct: 561 QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620

Query: 621 EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSE 680
           EGAINYTFG+LMKSKS+TI+SIAHRLSTIRRSENVIVLG+DGSV E+GKFKELYA+P S 
Sbjct: 621 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSA 680

Query: 681 LSKLLHEKATRSERQQNTAEDQEIDPEE 708
           LS+LL+EKA      Q    ++ I+ E+
Sbjct: 681 LSQLLNEKAAPGPSDQQLQIEKVIEKED 708

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/654 (67%), Positives = 542/654 (82%), Gaps = 14/654 (2%)

Query: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDF---TVDD 157
           D  RL  LAKRDW+LL  AI+LL++SC+IGMS+PK+IG+VLD L++ +   D     +DD
Sbjct: 79  DAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDD 138

Query: 158 VPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217
           +  IAFGL +Y+F+ +    LLVGTAAN+ R+++LR+LSERVVARLR+ V+ KT+HQD+E
Sbjct: 139 LGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNKTLHQDSE 198

Query: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
           F+D +KVGDLISRL SDAYVVSRS+TQKVSDGFKA++CG VGIGMM+SISP+LS  LLF 
Sbjct: 199 FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258

Query: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
            PP++ SAS FG+ IR+ S+DLQEATG LT+VAEEQ SG+KTVQSFVAEQ+E+ RYN AI
Sbjct: 259 APPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAI 318

Query: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
           R I+NVG+++AFINA+FF+ T +LGDMSF+VVL YGSYLVL GSL+IGDLTA+M+YTEYT
Sbjct: 319 RGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYT 378

Query: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457
           GSS+FGL+TFYSE+MQG GAASRLF+LTD I SISPT G+K++P KG+IEFKNVSFSYPT
Sbjct: 379 GSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPT 438

Query: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517
           R  NQIFK+++ K+  GSNVCIVGPSGRGKSTIA LLLRYYNPT GQI VDGQDISKV+ 
Sbjct: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNC 498

Query: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577
           K+LRRH+ +VQQEP+LMSGTIRDNITYGL E  T++E+RS+ K+CFCHNFITKFP+ YDT
Sbjct: 499 KTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDT 558

Query: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637
           ++G  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFG+LMKS S+
Sbjct: 559 MIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSM 618

Query: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQ- 696
           TI+SIAHRLSTI+RSENVIVLG DGSV E GKFKEL+A+P SEL KLL EK++RS+    
Sbjct: 619 TIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678

Query: 697 ------NTAEDQEIDPEETINIENSTPESDITQELLENPIKEAIMDVAADNKPI 744
                 N  +D+ ++ +    I    PE+  + +     +KE   DV+++ KPI
Sbjct: 679 LPPPPPNATQDKVVE-QIAEKILERFPEAGQSPDAT---VKEIFKDVSSEGKPI 728

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/702 (67%), Positives = 557/702 (79%), Gaps = 37/702 (5%)

Query: 75  RFNSTNTKE------------QESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISL 122
           RFNST T++            Q +       +D ++  D+ RL  LAKRDWKLLLTAI L
Sbjct: 65  RFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSDDYK--DIIRLFMLAKRDWKLLLTAILL 122

Query: 123 LSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGT 182
           L++SC IGMS+PK+IGIVLD LK   S  DF    +P   F L LYEF+S   V+LL+G 
Sbjct: 123 LTISCSIGMSIPKVIGIVLDTLK-TSSGSDFFDLKIP--IFSLPLYEFLSFFTVALLIGC 179

Query: 183 AANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSL 242
            AN+GR ILLR+LSERVVARLRA+VIKKT+HQDAEFFDN+KVGDLISRL SDAYVVSRS+
Sbjct: 180 VANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 239

Query: 243 TQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEA 302
           TQKVSDG KA++CG VG+GMM S+SPQLS  LLF TPPV+ SAS FG+ IRN S+DLQEA
Sbjct: 240 TQKVSDGVKALICGVVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEA 299

Query: 303 TGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLG 362
           TG LT+VAEEQ SGIKTVQSFVAE  E+ RYN AIR IF VGK +AF NAKFF+ T++LG
Sbjct: 300 TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLG 359

Query: 363 DMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLF 422
           D+SFL VLAYGSYLVL   LSIGDLTA+M+YTEYTG+++FGLSTFYSEIMQGAGAASRLF
Sbjct: 360 DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF 419

Query: 423 ELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGP 482
           ELTDR PSISPT+G K+ P++G IEFK+VSFSYPTR S QIFK+L+FKI  GS+VCIVGP
Sbjct: 420 ELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGP 479

Query: 483 SGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI 542
           SGRGKSTIA LLLRYYNPTTG I +D QDI+K++ KSLRRH+ IVQQEPVLMSGTIRDNI
Sbjct: 480 SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 539

Query: 543 TYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIK 602
           TYGL   PT++E+RS+ K+CFCHNFITKFPN+YDT++GP+GTLLSGGQKQRIAIARALIK
Sbjct: 540 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIK 599

Query: 603 KPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDG 662
           KPT+LILDEATSALDVESEGAINYTFG+LMKSKS+TI+SIAHRLSTIRRSENVIVLG+DG
Sbjct: 600 KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 659

Query: 663 SVAEVGKFKELYADPGSELSKLLHEKAT--RSERQQNTAEDQEI-DPEETINIE------ 713
           SV E+GKFKELY++P S LS+LL+E+     SE+QQ   +D E  +P E  N +      
Sbjct: 660 SVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVEKDNEKEEPNEDENHDQRNEGD 719

Query: 714 ---------NSTP--ESDITQELLENPIKEAIMDVAADNKPI 744
                    N+ P    D   + +E  ++  + D A +  PI
Sbjct: 720 DGSNHDNDSNNKPLESKDKKSDDIEESVEHVLKDAAKEANPI 761

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/648 (69%), Positives = 545/648 (84%), Gaps = 6/648 (0%)

Query: 100 SDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVD--D 157
           S+L RL  +  RDWKLLL AI+LL++SC IGM++PK+IG+VLD LK +M++   +++  D
Sbjct: 146 SELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSD 205

Query: 158 VPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217
           +P IAFGL LY F+     +L++GT  NYGR ILLR+LSERVVARLR++VIKKT+HQDAE
Sbjct: 206 LPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAE 265

Query: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
           FFD NKVGDLISRL SDAYVVSRSLTQKVSDGFKA+LCG  GIGMMISISPQLS+FL+  
Sbjct: 266 FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGMMISISPQLSSFLVIF 325

Query: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
            P V++SAS FG+ IR+ S  LQEATG LT+V+EEQ +G+KTVQSFVAEQKEI+RYN+AI
Sbjct: 326 APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385

Query: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
           R I+N+GK SA +N+KF + T+V+GDMSFLVVLAYGSYLVLHGSL+IGDLTA+M+YT+YT
Sbjct: 386 RDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYT 445

Query: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457
            +SIFGLS FYSEIMQG GAA RLF+LTDRIP+I PT+G+KF+P  G IEF+N+ F+YPT
Sbjct: 446 ANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPT 505

Query: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517
           R  NQ+FKNL+FKI+ G++VCIVGPSGRGKSTIA LLLRYYNP++GQI +D QDI K++ 
Sbjct: 506 RPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP 565

Query: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577
           KSLR++M IVQQEPVLMSG+IRDNITYGL  + T DE+R ++K+CFCHNFITKFP++Y+T
Sbjct: 566 KSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYET 625

Query: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637
           I+GPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGKLMKSKS+
Sbjct: 626 IIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSV 685

Query: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQN 697
           TI+SIAHRLSTIRRSE +IVLGNDGSV E GKFKELYADP SELSKLL+EK +R+ +++ 
Sbjct: 686 TIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745

Query: 698 TAEDQEIDPEETINIE-NSTPESDITQELLENPIKEAIMDVAADNKPI 744
               Q  D E   + E N TP S     L  N + + + +V+ D+ P+
Sbjct: 746 PLPPQS-DGENGDDFEGNGTPAS--PPSLHNNLVTDVLKEVSDDSSPL 790

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/608 (74%), Positives = 522/608 (85%), Gaps = 5/608 (0%)

Query: 98  ELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDD 157
           +  D+ RL  LAKRDWKLLLTAI LL++SC IGMS+PK+IGIVLD LK   S  DF    
Sbjct: 101 DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKT-SSGSDFFELK 159

Query: 158 VPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217
           +P   F L LYEF+S   V+LL+G AAN+GR ILLR+LSERVVARLRA+VIKKT+HQDAE
Sbjct: 160 IP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAE 217

Query: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
           FFDN+KVGDLISRL SDAYVVSRS+TQKVSDG KA++CG VG+GMM S+SPQLS  LLF 
Sbjct: 218 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFF 277

Query: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
           TPPV+ SAS FG+ IRN S+DLQEATG LT+VAEEQ SGIKTVQSFVAE  E+ RYN AI
Sbjct: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337

Query: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
           R IF VGK +AF NAKFF+ T++LGD+SFL VLAYGSYLVL   LSIGDLTA+M+YTEYT
Sbjct: 338 RDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 397

Query: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457
           G+++FGLSTFYSEIMQGAGAASRLFELTDR PSISPT G K+ P++G +EFK+VSFSYPT
Sbjct: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPT 457

Query: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517
           R S QIFKNL+FKI  GS+VCIVGPSGRGKSTIA LLLRYYNP+TG I +D QDI+K++ 
Sbjct: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517

Query: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577
           KSLRRH+ IVQQEPVLMSGTIRDNITYGL   PT++E+RS+ K+CFCHNFITKFPN+YDT
Sbjct: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577

Query: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637
           ++G  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG LMKSKS+
Sbjct: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSM 637

Query: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKAT--RSERQ 695
           TIISIAHRLSTIRRSENVIVLG+DGSV E+GKFK+LYA+P S LS+LL+E+A    S++Q
Sbjct: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQ 697

Query: 696 QNTAEDQE 703
           Q   +D E
Sbjct: 698 QQIEKDNE 705

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/684 (68%), Positives = 546/684 (79%), Gaps = 28/684 (4%)

Query: 89  HTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIM 148
           H+   +   +  D+ RL  LAKRDWKLLLTAI LL++SC IGMS+PK+IGIVLD LK   
Sbjct: 92  HSTEQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLK-TS 150

Query: 149 SNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVI 208
           S  DF    +P   F L LYEF+S   V+LL+G AAN+GR ILLR+LSERVVARLRA+VI
Sbjct: 151 SGSDFFDLKIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVI 208

Query: 209 KKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISP 268
           KKT+HQDAEFFDN+KVGDLISRL SDAYVVSRS+TQKVSDG KA++CG VG+GMM S+SP
Sbjct: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSP 268

Query: 269 QLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQK 328
           QLS  LLF TPPV+ SAS FG+ IRN S+DLQEATG LT+VAEEQ SGIKTVQSFVAE  
Sbjct: 269 QLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN 328

Query: 329 EIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLT 388
           E+ RYN AIR IF VGK +AF NAKFF+ T++LGD+SFL VLAYGSYLVL   LSIGDLT
Sbjct: 329 ELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388

Query: 389 AYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEF 448
           A+M+YTEYTG+++FGLSTFYSEIMQGAGAASRLFELTDR PSISPT+G K+ P +G IEF
Sbjct: 389 AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEF 448

Query: 449 KNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVD 508
           K+VSFSYPTR S QIFK+L+FKI  GS+VCIVGPSGRGKSTIA LLLRYYNPTTG I +D
Sbjct: 449 KDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508

Query: 509 GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFI 568
            QDI+K++ KSLRR + IVQQEPVLMSGTIRDNITYGL   PT++E+RS+ K+CFCHNFI
Sbjct: 509 NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568

Query: 569 TKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
           TKFPN+YDT++GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF
Sbjct: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628

Query: 629 GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEK 688
           G+LMKSKS+TI+SIAHRLSTIRRSENVIVLG+DGSV E+GKFKELYA+  S LS+LL+E+
Sbjct: 629 GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNER 688

Query: 689 AT-----------RSERQQNTAEDQEIDPEE------------TINIENSTPESDITQEL 725
           A            + E +++T E ++ D +               +   S    D   E 
Sbjct: 689 AAPGPSDQQLQIEKVEEKEDTNEGEKHDQQNKQDDDNSHNNHDNDSNNQSLEVKDKNSEN 748

Query: 726 LENPIKEAIMDVAADNKPI--TPR 747
           +E  ++  + D A +  PI  TP+
Sbjct: 749 IEESVEHLLKDAAKEANPIKLTPQ 772

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/671 (65%), Positives = 547/671 (81%), Gaps = 13/671 (1%)

Query: 82  KEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVL 141
           KEQES++   G+  K    ++ RL RLA+ DWKLLL AISLL++SC IGM++PK+IG+VL
Sbjct: 111 KEQESTSGNSGAGYK----EIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVL 166

Query: 142 DELKQIMSNPDFTVD--DVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERV 199
           D  K  +++ +   D  D+P + +GL LY+F+++   +L++ T AN+GRV+LLR+L E++
Sbjct: 167 DVAKNAITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKL 226

Query: 200 VARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVG 259
           VARLR+NVIKKT+HQDAEFFD NKVGDLISRLSSDAYVVSRS+TQ +SDGFKA++CG VG
Sbjct: 227 VARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVG 286

Query: 260 IGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKT 319
           IGMM  IS  L+  L    PP+++ A+ +GR IR+ SRDLQ++TG+LTKVAEEQ SG+KT
Sbjct: 287 IGMMFHISSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKT 346

Query: 320 VQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLH 379
           VQSFVAEQKEIKRYNHAIR +F+VGK+ A  NA FFS T+VLGD SFL+VLAYGS+LVL 
Sbjct: 347 VQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQ 406

Query: 380 GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF 439
           GSLSIGDLTA+M+YTEY+GS++FGLS FYSE+M+GAGAASRLFELTD  PSI  T G  +
Sbjct: 407 GSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPY 466

Query: 440 VPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYN 499
           VP KGEI+F+NVSFSYPTR++NQIF NL+F ID+GSNVC+VGPSGRGKSTIASLLL+YYN
Sbjct: 467 VPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYN 526

Query: 500 PTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSIT 559
           PT+G+I +DGQDISK+S+KSLRRH+ +VQQEP+LMSG+IRDNITYG+   PT DE+RS++
Sbjct: 527 PTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVS 586

Query: 560 KKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           KKCFCHNFITKF + Y+T++GP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVE
Sbjct: 587 KKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVE 646

Query: 620 SEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGS 679
           SEGAINYT G+LMKS+ ITIISIAHRLSTIRRSENVIVLG+DGSV E+GKFKELYA   S
Sbjct: 647 SEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKES 706

Query: 680 ELSKLLHEKATRSERQQNTAEDQEIDPE---ETINIENSTPESDITQELLENPIKEAIMD 736
           +L KLL+EKA  +  + N    ++ DP    E +N E    +  I +++L     + + D
Sbjct: 707 KLYKLLNEKAKDTTSKMNAETVEKNDPSPKTEKLNDEEKEEQRRIEEQVLN----QVLDD 762

Query: 737 VAADNKPITPR 747
           +  D K  + R
Sbjct: 763 MNYDQKSTSLR 773

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/675 (66%), Positives = 552/675 (81%), Gaps = 18/675 (2%)

Query: 72  PSKRFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGM 131
           PS + N  +T E+  S            SD+ RL  L K DWKLLL A++LL++SC+IGM
Sbjct: 107 PSLQGNPLSTSEEPKS----------NFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGM 156

Query: 132 SLPKIIGIVLDELK-QIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVI 190
            +PK+IGI+LD LK Q  +  +      P + FGL +YEF+    ++LL G  AN+GR+I
Sbjct: 157 MIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLI 216

Query: 191 LLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGF 250
           LLR+LSER+VARLR+ VIK+T+HQDA+F+D +K GDLISRL +DAY+VSRS+TQK+SDGF
Sbjct: 217 LLRILSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGF 276

Query: 251 KAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA 310
           K+++CG VG+GMM S+S  LSA L  L  PV++SAS FG+ IR NSR+LQ+ATG LT+V+
Sbjct: 277 KSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVS 336

Query: 311 EEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVL 370
           EEQ +G+KTVQSFVAEQ+EIKR+N AIR+IF+VGK+SAFINAKFF+ T+++GD+SFL VL
Sbjct: 337 EEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVL 396

Query: 371 AYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS 430
            YGSYLVLHGSL+IGDLTA+M+YTEYTG+SIFGLSTFYSEIMQGAGAASRLFELTD +P 
Sbjct: 397 VYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE 456

Query: 431 ISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTI 490
           I PTLGK ++P KGEIEFKNVSFSYPTR  NQIFKNL+FKI+ GSNVCIVGPSG+GKSTI
Sbjct: 457 IRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTI 516

Query: 491 ASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP 550
           A LLL YYNPT+GQI +DGQDI+K++SKSLRR + IVQQEPVLMSG+IRDNITYGL   P
Sbjct: 517 ALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTP 576

Query: 551 TQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
           T++E+R + K+CFCHNFITKFP++YDT +GP GTLLSGGQKQRIAIARALIKKP ILILD
Sbjct: 577 TKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILD 636

Query: 611 EATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670
           EATSALDVESEGAINYTFG+LMK+KS+TI+SIAHRLSTIRRSENVIVLGNDGSV E+GKF
Sbjct: 637 EATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKF 696

Query: 671 KELYADPGSELSKLLHEKATRSERQQN-TAEDQEIDPEETINIENSTPESDITQELLENP 729
           KEL++DP SELSKLL+EK++R + + +  +   E+D + T       P   I    +E+ 
Sbjct: 697 KELFSDPSSELSKLLNEKSSRKKTKSDPISSAPEVDADAT-----GEPVEPI-DPAIEDA 750

Query: 730 IKEAIMDVAADNKPI 744
           +   + DV +++KPI
Sbjct: 751 LHSVLNDVTSESKPI 765

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/641 (65%), Positives = 513/641 (80%), Gaps = 3/641 (0%)

Query: 80  NTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGI 139
           + + Q+S T  D  +      ++ RL +LA  DWKLL  AI LL++S +IGMS+PK+IG+
Sbjct: 120 DKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGM 179

Query: 140 VLDELKQIMSNPDFTV--DDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSE 197
           VLD +K   S+    V  DD+P I   L++YEF+ +   +L++GT AN+GR++LLRVL E
Sbjct: 180 VLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGE 239

Query: 198 RVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGS 257
           ++VARLR+NVI+K +HQDAEFFD NKVGDLISRLSSDAYVVSRS+TQ VSDGFKA++CG 
Sbjct: 240 KLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGG 299

Query: 258 VGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGI 317
           VGIGMM++IS  L++ LL   PP+++ A  +G+ IR  SRDLQE+TG+LT+V+EEQ SG+
Sbjct: 300 VGIGMMVNISISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGV 359

Query: 318 KTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLV 377
           KT+QSFVAE KE++RYN AIR +F  GK+ A  NA FFS T VLGD+SFL+VLAYGS+LV
Sbjct: 360 KTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLV 419

Query: 378 LHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK 437
           L G L++GDLTA+M+YTEYTGS++FGLS FYSE+M+GAGAASRLFE+TD  PSI PT GK
Sbjct: 420 LQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGK 479

Query: 438 KFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRY 497
            +VP  G+I FK+VSFSYPTR  NQIF  L+F I+ GSNVCIVGPSGRGKSTI SLLLRY
Sbjct: 480 PYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRY 539

Query: 498 YNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRS 557
           YNP++GQI +D QDIS++S KSLRRH+ +VQQEP+LMSG+I+ N+TYGL  + + DE+RS
Sbjct: 540 YNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRS 599

Query: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           + KKCFCH F+TKFPN YDTI+GP G  LSGGQKQRIAIARAL+KKP ILILDEATSALD
Sbjct: 600 VAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALD 659

Query: 618 VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP 677
           VESEGAINYT GKLMKSK +TIISIAHRLSTIRRSENVIVLGNDGSV EVGKFK+LYAD 
Sbjct: 660 VESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQ 719

Query: 678 GSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPE 718
            SEL KLL++K  R +       D E D E+   I+N   E
Sbjct: 720 QSELYKLLNDKK-RDKPTPRVQSDPEKDREQEHQIDNQVRE 759

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/677 (62%), Positives = 525/677 (77%), Gaps = 28/677 (4%)

Query: 99  LSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIM---------- 148
           L+D+KRL  LA+ DWK+L+ A+SLL+VSC IGM++PK+IG+VLD  K  +          
Sbjct: 112 LADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNGNG 171

Query: 149 ---SNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRA 205
               +   T+DD+P I   + LY+F  L G +LL+GT AN+GRV+LL++L ER+VARLR+
Sbjct: 172 GLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARLRS 231

Query: 206 NVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMIS 265
           NVIKKTMH D EF+D NKVGDL+SRL +DAY+VSRS+TQ +SDGFKA++CG VGIGMM  
Sbjct: 232 NVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFH 291

Query: 266 ISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVA 325
           IS  L++ L    PP+++ A+ +G  IR  SR+LQ+A+G+LTKVAEEQ SGIKTVQSFVA
Sbjct: 292 ISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVA 351

Query: 326 EQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIG 385
           E KE+ RYN+A+R +FNVGK+ AF NA FFS T VLGD SFL+VLAYGS+LVL G+L+IG
Sbjct: 352 EGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIG 411

Query: 386 DLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGE 445
           DLTA+M+YTEYTGS++FGLSTFYSE+M+GAGAA+RLFEL D  P+I  T GK F P  G+
Sbjct: 412 DLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGK 471

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           +EF++VSFSYPTR +NQIFK+L+F I+ GSNVCIVGPSGRGKSTIASLLLRYYNPT+G+I
Sbjct: 472 VEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKI 531

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
            VDGQDI+K+SSKSLRR + +VQQEP+LMSGTIR+NITYG+  +P+ +E+RS+ KKCFCH
Sbjct: 532 LVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591

Query: 566 NFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
            FI+KFPN Y+TI+GP G LLSGGQKQRIAIARAL+ KP ILILDEATSALDVESEGAIN
Sbjct: 592 AFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAIN 651

Query: 626 YTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
           YT G+LMKSK +TIISIAHRLSTIRRSENVIVLG DGSV E+GKFK+LYA+  S L KLL
Sbjct: 652 YTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLL 711

Query: 686 HE--------------KATRSERQQNTAEDQEIDPEETINIENSTPESDITQE-LLENPI 730
            E               A   E +  T E+ + D  E  N ++     D  ++ L E  I
Sbjct: 712 TEPSEQQHSQHQQYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVI 771

Query: 731 KEAIMDVAADNKPITPR 747
            + + D++ D K  T R
Sbjct: 772 HQVLEDISHDQKTSTLR 788

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/615 (65%), Positives = 506/615 (82%), Gaps = 6/615 (0%)

Query: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQI---MSNPDFTVDD 157
           ++ RL RLA+ DWKLL  AI LL++S  +GM++PK+IGIVLD +K      S P  T++D
Sbjct: 108 EILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGP-MTLED 166

Query: 158 VPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217
           +P I +GL +++F+++    L+ GT AN+GR++LLRVL E++VARLR+NVIKK +HQDAE
Sbjct: 167 LPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAE 226

Query: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
           FFD NKVGDLISRLSSDAYVVSRS+TQ VSDGFKA++CG VGIGMMI+IS  L++ L   
Sbjct: 227 FFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISASLTSALFLF 286

Query: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
            PP+++ A  +G+ IR  SR+LQE+TG+LTKV+EEQ SG+KT+Q+FVAE KE+ RYN+AI
Sbjct: 287 APPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAI 346

Query: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
           R +F+ GK+ A  NA FFS T +LGD+SFL+VLAYGS+LVL G LS+GDLTA+M+YTEYT
Sbjct: 347 RKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYT 406

Query: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457
           GS++FGLS FYSE+M+GAGAASRLFE+TD    I P+ GK +VP+ GEI+F++VSFSYPT
Sbjct: 407 GSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPT 466

Query: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517
           R  NQIF  L+F I+ GSNVC+VGPSGRGKSTIASLLLRYY+P +G+I +DGQ+ISK+S 
Sbjct: 467 RPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSC 526

Query: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577
           KSLRRH+ +VQQEP+LMSG+IR N+TYG+  + T DE+RS+ KKCFCH FITKFP  Y+T
Sbjct: 527 KSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYET 586

Query: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637
           ++GP G  LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT G+LM+S+ +
Sbjct: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646

Query: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQ- 696
           TIISIAHRLSTIRRSENVIVLGNDGSV E+GKFKELYA+  SEL KLL++K     + Q 
Sbjct: 647 TIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQS 706

Query: 697 -NTAEDQEIDPEETI 710
            N+ E +E + ++ +
Sbjct: 707 RNSVETKENEVDDQV 721

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/689 (61%), Positives = 533/689 (77%), Gaps = 23/689 (3%)

Query: 71  IPSKRFNSTNTKEQESSTHT-----DGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSV 125
           IP +   ST+   +E              D+    D+ RL  L K DWKLL++A++LL+V
Sbjct: 55  IPRRVLYSTDVTPKEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTV 114

Query: 126 SCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAAN 185
           SC IGM +PK+IG VLD LK I    +F+      + + ++L  F   +   LL+G  AN
Sbjct: 115 SCGIGMCIPKVIGTVLDSLKDIQGK-EFS----ELMIWDMSLKHFFYGLSGLLLLGCGAN 169

Query: 186 YGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQK 245
           Y RVILLR+LSE +VA+LRANVIK  +HQDA+FFD  KVGDLISR+ +DA++VSRS+TQK
Sbjct: 170 YVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQK 229

Query: 246 VSDGFKAMLCGSVGIGMMISISPQLS-AFLLFLTPPVMLSASYFGRLIRNNSRDLQEATG 304
           +SDG KA+  GS G+GMM+SIS  LS + L+ +  P++LSA  FG+ IR+NS+ LQE T 
Sbjct: 230 ISDGVKAVFIGSAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTA 289

Query: 305 SLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDM 364
           +LT+V+EEQF+GIKT+QSFVAEQ E+ ++N +IR IF VGK++AFINAKFF+  +++GD+
Sbjct: 290 NLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDL 349

Query: 365 SFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL 424
           SFLVVL+YGS+LV    LS+GDLTA+M+YTEYTG++IF LS F+SEIMQGAGAASR+FEL
Sbjct: 350 SFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFEL 409

Query: 425 TDRIPSISPTLGKKFVPNKG-EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPS 483
           TD  P I+PT G KF+P KG EIEFKNVSF+YPTR +  IF+NL+FKI+ GSNVCIVGPS
Sbjct: 410 TDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPS 469

Query: 484 GRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT 543
           G+GKSTIA LLL YYNP+ GQI +DGQDIS +S+KSLRRH+ IVQQEP+LMSGTIRDNIT
Sbjct: 470 GKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNIT 529

Query: 544 YGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKK 603
           YGL   PT++E+RS+ K+CFCHNFIT+FP++YDT +GPHGTLLSGGQKQRIAIARALIKK
Sbjct: 530 YGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKK 589

Query: 604 PTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGS 663
           PT+LILDEATSALDVESEGAINYTFG+LMKSKS+TI+SIAHRLSTIRRSENVIVLGNDGS
Sbjct: 590 PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGS 649

Query: 664 VAEVGKFKELYADPGSELSKLLHEKATRSE-----RQQNTAEDQEIDPEETINIENSTPE 718
           V E GKFKEL+A+P SELSKLL EK++ +      + Q  ++  E DP  +     +TP 
Sbjct: 650 VVEQGKFKELFANPASELSKLLREKSSGNNAAPEIQPQEISQTIEEDPSFS---GEATPA 706

Query: 719 SDIT---QELLENPIKEAIMDVAADNKPI 744
           S +T    E     I E + D++ + KP+
Sbjct: 707 SSVTGFKAETEAETINEVLKDISTEGKPL 735

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/656 (61%), Positives = 506/656 (77%), Gaps = 25/656 (3%)

Query: 104 RLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPD-------FTVD 156
           RL RL K DWKLLL A+ LL++SC IGM++PK+IG+VLD  K  ++  +        ++ 
Sbjct: 108 RLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLL 167

Query: 157 DVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDA 216
           D+P I     L + ++    +LLVG+AAN+GR+ LL++L ER+VARLRA VIKKT+H DA
Sbjct: 168 DMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDA 227

Query: 217 EFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLF 276
           EFFD NKVGDLISRL SDAY+VSRS+T  +SDG KA LCG VG+GMM  IS  L++ ++ 
Sbjct: 228 EFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIM 287

Query: 277 LTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHA 336
             PP++++A+ +G+ IR  SR+LQ++TG+LT+V+EEQF+GIKT++SFVAE KE++RYN A
Sbjct: 288 FAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTA 347

Query: 337 IRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEY 396
           +R +FNV K+    +A FFS T VLGD+SFL+VLAYGS+LVL G LS+G LTA+M+YTEY
Sbjct: 348 VRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEY 407

Query: 397 TGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYP 456
           TGSS+FGLS FYSE+M+GAGAASRLFELTD   S+  T+G+ FVP  G IEFK+VSFSYP
Sbjct: 408 TGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYP 467

Query: 457 TRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS 516
           TR ++QIFK L   I  GSNVCIVGPSGRGKSTIASLLLR+Y+  +G I +DGQDISKVS
Sbjct: 468 TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVS 527

Query: 517 SKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYD 576
           +KSLR+H+ +VQQEPVLMSGTIRDNITYGL   P+ DE+R++ KKCFCHNFITKFP+ YD
Sbjct: 528 AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYD 587

Query: 577 TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKS 636
           T++GP G LLSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAINYT G+LM+SK 
Sbjct: 588 TVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKE 647

Query: 637 ITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSER-Q 695
           ITI+SIAHRLSTIRRSEN++VLGNDGSV E GKF +LY D  SEL KLL+E A+   + +
Sbjct: 648 ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEHASEPAKPE 707

Query: 696 QNTAEDQEIDPEETINIENSTPE-SDITQE-------LLENPIKEAIMDVAADNKP 743
            + A  QE         E S P+ +DI ++       L E  IK  + D A    P
Sbjct: 708 ASPAPAQE---------EASAPQAADIPRDIEGGNLRLNEEVIKHVLEDTARAPMP 754

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/670 (59%), Positives = 503/670 (75%), Gaps = 29/670 (4%)

Query: 104 RLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQ----------------- 146
           RL  LAK DWKLL  AI LLSVSC IGM++PK+IG+VLD  K                  
Sbjct: 102 RLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVN 161

Query: 147 -----IMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVA 201
                +++ P  ++D +P I   L++ +F+ +   +L+VG  AN+GRV+LL+++ ER+V+
Sbjct: 162 EDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVS 221

Query: 202 RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
           RLR+ VIK+TMH D EFFD NKVGDLISR  SDAYVVSRS+TQ VSDGFKA++CG VG+G
Sbjct: 222 RLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMG 281

Query: 262 MMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321
           MM  IS  L++ +L   PP+++ A  +G+ I   SR LQ+++G+LT+VAEEQ +GI+T++
Sbjct: 282 MMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIK 341

Query: 322 SFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGS 381
           SFVAE+KEI+RYN AIR +F VGK+ AF NA FFS T +LGDMSF++VL YG+ LVL G+
Sbjct: 342 SFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANLVLQGA 401

Query: 382 LSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP 441
           LSIGDLTA+M+YTEYTGSS+FGLSTFYSE+M+GAGAASRLFEL D   S+   +     P
Sbjct: 402 LSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTP 461

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
            +G+IEF++VSFSYPTR SNQIFK++SF I+ GSNVCIVGPSG+GKSTI SLLLR+Y+P 
Sbjct: 462 TQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPN 521

Query: 502 TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561
            G I +D  DISK ++KSLRRH+ +VQQEP LMSGTIRDNITYGL   PT DE+R ++K+
Sbjct: 522 YGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQ 581

Query: 562 CFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           CFCH FITKFP+ YDT++GP G  LSGGQ+QRIAIARALIKKP ILILDEATSALDVESE
Sbjct: 582 CFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 641

Query: 622 GAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
           GAINYT G LM+SK +TIISIAHRLSTIRRSEN+IV+GNDGSV EVGKF +LY +  SEL
Sbjct: 642 GAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESEL 701

Query: 682 SKLLHEK-ATRSERQQNTAEDQEIDPEETINIENSTPESDITQELL---ENPIKEAIMDV 737
            KLL+EK      + +NT+   +I P+   N + S  E  + +++    +  +K  + D+
Sbjct: 702 FKLLNEKDHDLVSKSENTS---DIPPDSPKNDDASGLEHLVAEDVASINDKVVKNVLNDI 758

Query: 738 AADNKPITPR 747
             D    T R
Sbjct: 759 THDKNSSTLR 768

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/632 (61%), Positives = 497/632 (78%), Gaps = 17/632 (2%)

Query: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPE 160
           DLKRL  L K+D KLL+ AI LL++SC IGM++PKIIG +LD L+    N    +  + +
Sbjct: 85  DLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRNNYEN----LTSLSQ 140

Query: 161 IA-FGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF 219
           I    + L  F+  VG++L+ G  AN+GRV++LR++SER+V+RLR+ V+K  +H+D EFF
Sbjct: 141 IKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFF 200

Query: 220 DNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTP 279
           D  KVGDL+SR+ +DA+VVSRS+T KV+DG ++   G  GIG+M+++S +L+  L  + P
Sbjct: 201 DTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRELTGALFAILP 260

Query: 280 PVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRH 339
           P++   S FG+ IR NS+ LQ+ TG LT+V EEQF+GI+TVQ FVAE+ EIKR+N+ +R 
Sbjct: 261 PIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLRE 320

Query: 340 IFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGS 399
           IF VGK+SAFIN KFF+  +++GD+ FL+VL YGSYLV+HGS+SIGDLTA+M+YTEYTG+
Sbjct: 321 IFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGN 380

Query: 400 SIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK-KFVP----NKGEIEFKNVSFS 454
           +IFGLS+FYSE+MQG GAASR+FE+ D+ P I  T G+ KF P       EIEFKNVSF 
Sbjct: 381 AIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFF 440

Query: 455 YPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISK 514
           YPTR +NQIFKNL+FK+ AGSNVCIVGPSGRGKSTIASLLL +YN  +GQI +DGQDI+ 
Sbjct: 441 YPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIAT 500

Query: 515 VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS 574
           +++KSLRR + IVQQEP+LMSGTIRDNITYGL E+P+++E+R + K+CFCHNFITKFP++
Sbjct: 501 LNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDT 560

Query: 575 YD--TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLM 632
           YD     G  GT LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG++M
Sbjct: 561 YDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIM 620

Query: 633 KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRS 692
           KSKS+TI+SIAHRLSTIRR E+VIVLGNDGSV E+GKFKELY +P SELSKLL+EK++  
Sbjct: 621 KSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSELSKLLNEKSSTK 680

Query: 693 ERQQNTAE-----DQEIDPEETINIENSTPES 719
           E            D + +PEE    +N++ E+
Sbjct: 681 EATPQPVNPPPFIDLQTNPEEKKEADNASEEN 712

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/640 (45%), Positives = 421/640 (65%), Gaps = 27/640 (4%)

Query: 75  RFNSTNTKEQESSTHTDGSNDKFE-----------LSDLKRLARLAKRDWKLLLTAISLL 123
           RFNSTN   +  +T    +  K E             D+KRL  LAK +   ++ A+ L+
Sbjct: 58  RFNSTNESSKGINTKLTETQQKLEKLSSEESTNTGFKDVKRLFTLAKPETAYIVLALVLI 117

Query: 124 SVSCLIGMSLPKIIGIVLDELKQIMSNPDF-------TVDDVPE----IAFGLNLYEFIS 172
            +S  + M +P +IG +LD L    SN D         VD+  +      +G    +F +
Sbjct: 118 LISSTVSMVVPSVIGKLLD-LSSNTSNDDTGDAKSKEKVDNKEDRDNNTIYGFTHTQFFA 176

Query: 173 LVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLS 232
            +G+  ++G  AN GR+++L+V  E++VARLR   +K  + QDA F D+N+VGDLISRLS
Sbjct: 177 GLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLISRLS 236

Query: 233 SDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLI 292
           SDA +V++S+T  VSDG +A+L G VG  MM  IS +L++ ++ L PP+ + A  +G+ I
Sbjct: 237 SDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVYGKKI 296

Query: 293 RNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINA 352
           RN SR LQ A G LTKVAEEQ +  KT+Q++  E+KEI+RY   +R +F+VG + A  + 
Sbjct: 297 RNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEAITSG 356

Query: 353 KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIM 412
            FF  T ++G+ + L +L  G+ ++  GSL++GDL+++MMY  YTGSS+FGLS+FYSE+M
Sbjct: 357 IFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFYSELM 416

Query: 413 QGAGAASRLFELTDRIPSISPTLGKKFVPNKGE-IEFKNVSFSYPTRASNQIFKNLSFKI 471
           +GAGAA+R+FEL DR P I PT+GK  V  KG+ I F++VSF YPTR ++++F  +SFKI
Sbjct: 417 KGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKISFKI 476

Query: 472 DAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEP 531
           + G ++C VGPSG GKST++ LLLRYY+ T G I +   +I  +S +  R+ + +VQQEP
Sbjct: 477 EPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVVQQEP 536

Query: 532 VLMSGTIRDNITYGLVEK--PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGG 589
           +L +GTI DNI Y + ++    +++V    KK  C  F+  FP+  +TI+GP GT LSGG
Sbjct: 537 MLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQLSGG 596

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTI 649
           QKQRIAIAR+ +  P+IL+LDEATSALD +SE  I  T  K  +++ +T ISIAHRLSTI
Sbjct: 597 QKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEGLTTISIAHRLSTI 655

Query: 650 RRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKA 689
           + S  V+VL  +GSV E GKF EL A+P SEL+ LL ++ 
Sbjct: 656 KYSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLSKEG 695

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/601 (47%), Positives = 405/601 (67%), Gaps = 6/601 (0%)

Query: 92  GSNDK-FELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSN 150
           G++ K +   +++RL +LA+ + K L  A+ L+ +S  + M++P +IG +LD  K+  + 
Sbjct: 72  GADSKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAG 131

Query: 151 PDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKK 210
            D   +    I +GL   +F + +G   ++G  AN GR+++L+V  E++VARLR   +K 
Sbjct: 132 GDGDEEQETRI-YGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKA 190

Query: 211 TMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQL 270
            + QDA F D N+VGDLISRLSSDA +VS+S+TQ  SDG +A++ G VG GMM  IS QL
Sbjct: 191 ALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQL 250

Query: 271 SAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEI 330
           +  +L L PP++L A  +GR IRN +R+LQ   G LTKVAEEQ +  +T+QS+  E+KEI
Sbjct: 251 TGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEI 310

Query: 331 KRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAY 390
           +RY   +R +F VG + A  +  FF  T ++G+M+ L +L  G+ ++  G++++G+L+++
Sbjct: 311 RRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSF 370

Query: 391 MMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP-NKGEIEFK 449
           MMY  YTGSS+FGLS+FYSE+M+GAGAASR+FEL DR+P I PT GK  +     EIEFK
Sbjct: 371 MMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFK 430

Query: 450 NVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDG 509
           NV FSYP+R+++ +F  L+ KI  G +VC+VGPSG GKSTI+SLLLR+Y+  +G I + G
Sbjct: 431 NVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGG 490

Query: 510 QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDE--VRSITKKCFCHNF 567
           Q+I   + +  RR + IVQQEP+L +G+I+DNI Y L      D+  V    +   C  F
Sbjct: 491 QNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRF 550

Query: 568 ITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           I+ FP+  DT++GP GT LSGGQKQRIAIARA I  P+ILILDEATSALD +SE  I   
Sbjct: 551 ISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQA 610

Query: 628 FGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
                +S  IT ISIAHR+STI  S  VIVL  +G V+E G F +L   P S L+KLL +
Sbjct: 611 LRARSESGKIT-ISIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSK 669

Query: 688 K 688
           +
Sbjct: 670 E 670

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/649 (44%), Positives = 420/649 (64%), Gaps = 30/649 (4%)

Query: 71  IPSKRFNSTNTKEQES---------STHTDGSNDKFELSDLKRLARLAKRDWKLLLTAIS 121
           + ++R N++  ++Q++         S H D     F+  D+KRL  LAK +   ++ A+ 
Sbjct: 68  LQARRLNTSTEQDQKTLQTLKTLKLSPH-DSKASGFK--DIKRLFLLAKPETNSMILALV 124

Query: 122 LLSVSCLIGMSLPKIIGIVLDELKQ--------------IMSNPDFTVDDVPEIAFGLNL 167
            + +S  + M++P +IG +LD  K+                 + D   D    + +GL  
Sbjct: 125 FILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASGEGVGSSDSSDNQEDSSDRLIYGLTF 184

Query: 168 YEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDL 227
            +F + +G   +VG  AN GR++LL+V  E++VARLR   +K  + QDA F DNN+VGDL
Sbjct: 185 PQFYTALGTIFVVGAFANMGRIVLLKVTGEKLVARLRTRTMKAALQQDATFLDNNRVGDL 244

Query: 228 ISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASY 287
           ISRLSSDA +VS+S+TQ +SDG +A++ G+VG GMM  IS +L+  +  + PP+ + A  
Sbjct: 245 ISRLSSDASIVSKSVTQNLSDGARAVIQGAVGFGMMSFISWKLTCVMTLMAPPLAVMAMV 304

Query: 288 FGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQS 347
           +G+ IRN SR LQ + G LTKVAEEQ S  +TVQ++  E++EI+RY   +R++FN+G + 
Sbjct: 305 YGKKIRNLSRQLQTSVGGLTKVAEEQLSAARTVQAYGGEKQEIRRYAGEVRNVFNIGLKE 364

Query: 348 AFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTF 407
           A  +  FF +T  +G+++ L +L  G+ ++  G++++GDL+++MMY  YTGSS+FGLS+F
Sbjct: 365 ALTSGVFFGVTGFVGNVALLALLLTGTSMIRSGAITVGDLSSFMMYAVYTGSSLFGLSSF 424

Query: 408 YSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGE-IEFKNVSFSYPTRASNQIFKN 466
           YSE+M+GAGAA+R+FEL DR P I PT G   V  +G+ IEF+NV+F+YPTR  N+IF  
Sbjct: 425 YSELMKGAGAAARVFELNDRKPLIHPTKGVDPVTLQGKTIEFRNVAFAYPTRRENRIFDG 484

Query: 467 LSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI 526
           LS  I  G +VCIVGPSG GKSTIASLLLRYY+   G+I + GQDI + + +  RR + +
Sbjct: 485 LSLDIQPGEHVCIVGPSGGGKSTIASLLLRYYDVDAGRIAIGGQDIRRFNLRKYRRLLGV 544

Query: 527 VQQEPVLMSGTIRDNITYGLVEKPTQDEVR--SITKKCFCHNFITKFPNSYDTILGPHGT 584
           VQQEP+L +GTI DNITY +  +   D+ R      +  C  F+  FP+  +T++GP G 
Sbjct: 545 VQQEPLLFNGTILDNITYAVPGELAGDDSRVSRAIGQANCTKFLANFPDGLETLVGPRGA 604

Query: 585 LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            +SGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  +  +    +  T +SIAH
Sbjct: 605 QMSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAQSL-RSRSRRGKTTVSIAH 663

Query: 645 RLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSE 693
           RLSTI+ S  VIVL   G V E G F+EL +DP S L++LL ++  R E
Sbjct: 664 RLSTIQHSSRVIVLDRHGGVGETGSFRELISDPDSHLTQLLLKEEERVE 712

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/610 (46%), Positives = 405/610 (66%), Gaps = 14/610 (2%)

Query: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLD---------ELKQIMSNP 151
           D+KRL  LA+ +   +  A+ L+ +S  + M +P +IG +LD         E  + +S  
Sbjct: 99  DVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADEENGKGVSEK 158

Query: 152 DFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKT 211
               +D  +  +GL   +F + +GV   VG  AN GR+I+L+V  ER+VARLR   +K  
Sbjct: 159 LKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVARLRTRTMKAA 218

Query: 212 MHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLS 271
           + Q+A F D+NKVGDLISRLS+DA +V++S+TQ VSDG +A+L G VG GMM  IS QL+
Sbjct: 219 LEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGMMSYISWQLT 278

Query: 272 AFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIK 331
           + +L L PP+   A  +GR IRN SR LQ + G LTKVAEEQ +  +T+Q++  E+KEI 
Sbjct: 279 SVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKKEIH 338

Query: 332 RYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYM 391
           RY   +R++F++G + A  +  FF  T ++G+ + L +L  G+ ++  G+L++G+L+++M
Sbjct: 339 RYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGALTVGELSSFM 398

Query: 392 MYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGE-IEFKN 450
           MY  YTGSS+FGLSTFYSE+M+GAGAA+R+FEL+DR P+I PT+GK  +   G+ +EFKN
Sbjct: 399 MYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITLFGKTVEFKN 458

Query: 451 VSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQ 510
           VSF YPTR   QIF++ S KI+ G +VC VGPSG GKST++SLLLRYY+   G I V G+
Sbjct: 459 VSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGE 518

Query: 511 DISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQD--EVRSITKKCFCHNFI 568
           DI   S +  RR + +VQQEP+L +GTI +NI Y + E+   +   +    +   C  F+
Sbjct: 519 DIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAIESANCSKFL 578

Query: 569 TKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
             FP+  +T++GP GT LSGGQKQRIA+AR  +  P+ILILDEATSALD +SE  I    
Sbjct: 579 NNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQSEDIIAQNL 638

Query: 629 GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL-HE 687
            +    K  T ISIAHRLSTI+ S  V+VLG +G V E G F+EL ++P S L+ LL  E
Sbjct: 639 -QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSSGLNILLTQE 697

Query: 688 KATRSERQQN 697
           +++ +E   N
Sbjct: 698 ESSANEGTPN 707

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/638 (45%), Positives = 417/638 (65%), Gaps = 10/638 (1%)

Query: 60  KSNTIARLLLNIPSKRFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTA 119
           + N+  R  +N+ S    +   + + S +  +GS  K    D+KRL RLAK +   +  A
Sbjct: 55  RWNSTQRAPVNVNSNASVTAVKEAKLSPSDLNGSGFK----DIKRLFRLAKPETLQIALA 110

Query: 120 ISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLL 179
           + L+ +S  + M++P I+G +LD  K      D T DD     FG+   +F + +    L
Sbjct: 111 LVLILISSAVSMTIPTIVGKLLDIAKDRKDADDTTEDDEGPKIFGMTTKQFCTALLAVFL 170

Query: 180 VGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVS 239
           VG AAN GR+++L++  ER+VARLR   +K  + QDA F D N+VGDLIS LSSDA +V+
Sbjct: 171 VGAAANAGRIVILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISCLSSDASIVA 230

Query: 240 RSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDL 299
           +S+TQ VSDG +A++ G VG GMM  IS QL++ ++ + PP+ + A  +GR IRN SR L
Sbjct: 231 KSVTQNVSDGTRAVIQGFVGFGMMGYISWQLTSVMILMIPPLGIMAVVYGRKIRNLSRQL 290

Query: 300 QEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTA 359
           Q + G LTKV+EEQ   +KT+QS+V E+KEI RY   +R++FN+G + A  +  FF  T 
Sbjct: 291 QTSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHRYATEVRNVFNIGLKEALTSGVFFGSTG 350

Query: 360 VLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAAS 419
           ++G++S L +L  G+ ++ +G +++GDL+++MMY  YTGSS+FGLS+FYSE+M+GAGAA+
Sbjct: 351 LVGNISLLALLMVGTNMIQNGLITVGDLSSFMMYAVYTGSSMFGLSSFYSELMKGAGAAA 410

Query: 420 RLFELTDRIPSISPTLGKKFV--PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNV 477
           R+FEL DR P I PT+G+  V   NK  I F+NVSF+YPTR + +IF  L   ++ G +V
Sbjct: 411 RVFELKDRKPLIPPTIGQDPVTLANK-TIRFENVSFTYPTRLNQKIFDGLDITVEPGEHV 469

Query: 478 CIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGT 537
           CIVGPSG GKST+ASLLLRYY+   G+I +   +I+  + +  RR + IVQQEP L +GT
Sbjct: 470 CIVGPSGSGKSTVASLLLRYYDTNEGRIMIGDHNINSFNVRKYRRLLGIVQQEPQLFNGT 529

Query: 538 IRDNITYGL-VEKPTQDE-VRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIA 595
           I DNI Y +  E+   D+ + +   +  C  F+  FP+   T++GP G  LSGGQKQRIA
Sbjct: 530 ILDNILYTVPPERADNDDLISTAIGQANCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIA 589

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENV 655
           +ARA +  P++LILDEATSALD +SE  +  T  ++   + +T ISIAHRLSTI+    V
Sbjct: 590 LARAFLLDPSLLILDEATSALDSQSEEIVAQTL-RVRVQRGLTTISIAHRLSTIKNCTRV 648

Query: 656 IVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSE 693
           +VLG  G V E G F+EL  +P SELS LL ++    E
Sbjct: 649 VVLGKCGQVVESGPFEELLRNPLSELSILLSQQQDEPE 686

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/656 (44%), Positives = 416/656 (63%), Gaps = 26/656 (3%)

Query: 75  RFNSTNTKEQESSTHTDGSNDKFELS----------DLKRLARLAKRDWKLLLTAISLLS 124
           R+NS+N K Q ++T+TD +    ELS          D+ RL  LA+ +   ++ A+ L+ 
Sbjct: 57  RWNSSNAK-QPNTTNTDKTGQIAELSSNEKNSSGFRDITRLLGLARPEVWYIMGALCLIV 115

Query: 125 VSCLIGMSLPKIIGIVLD----------ELKQIMSNPDFTVDDVPEIAFGLNLYEFISLV 174
           +S  + M LP +IG +LD          E ++     D   D      +G    +F  ++
Sbjct: 116 ISSTVSMLLPSVIGKLLDLAKSSSPSENEKQESGDGDDKDKDKEEGTIYGFTPKQFCVIM 175

Query: 175 GVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSD 234
           G   + G  AN GR+I+L+V  ER+VARLR   +K  + QD+ F D N+VGDLISRLSSD
Sbjct: 176 GGIFVAGAFANCGRIIILKVTGERLVARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSD 235

Query: 235 AYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRN 294
           + +V++SLTQ VSDG +A++ G VG GMM  IS QL+  +  + PP+   A  +G+ IRN
Sbjct: 236 SSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRN 295

Query: 295 NSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKF 354
            S+ LQ + G LTKVAEEQ    KT+QS+V E+KEI+RY   +R +F++G + A  +  F
Sbjct: 296 LSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMF 355

Query: 355 FSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQG 414
           F  T  +G++S L +L  G+ ++  G +++GDL+++MMY  YTG S+FGLS FYSE+M+G
Sbjct: 356 FGSTGFVGNISLLALLMSGASMIQSGLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKG 415

Query: 415 AGAASRLFELTDRIPSISPTLGKKFVPNKG-EIEFKNVSFSYPTRASNQIFKNLSFKIDA 473
           AGAA+R+FEL DR P+I+PTLGK     +   I FK+VSF+YPTR + +IF +L+  I  
Sbjct: 416 AGAAARVFELNDRKPAIAPTLGKGPTSIRNLPISFKDVSFTYPTRLNKKIFNHLNLTIQP 475

Query: 474 GSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVL 533
           G ++CI GPSG GKSTIASLL+RYY+   G I +   D+   + +  RR + +V QEPVL
Sbjct: 476 GEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVL 535

Query: 534 MSGTIRDNITYGLVEKPTQDEVR--SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQK 591
            +GTI +NI Y +     QDE R  +   K  C  F++ FP+  +T++GP G  LSGGQK
Sbjct: 536 FNGTILENILYAVPPSVAQDERRVSAAIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQK 595

Query: 592 QRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRR 651
           QR+A+ARA +  P +L+LDEATSALD +SE  +  T  + ++ + +T ISIAHR+STI  
Sbjct: 596 QRVALARAFLLDPALLVLDEATSALDSQSEEIVARTLQERVR-RGLTTISIAHRISTIAH 654

Query: 652 SENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH-EKATRSERQQNTAEDQEIDP 706
           S  V+VLG DG V E G F+EL   P SEL+ LL  ++  R E ++N +E +EI P
Sbjct: 655 STRVVVLGRDGFVVESGPFQELIDRPNSELNYLLSLQQDEREEIKENPSEPREIQP 710

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/628 (45%), Positives = 409/628 (65%), Gaps = 20/628 (3%)

Query: 75  RFNSTNTKEQESSTHTDGSNDKFELS----------DLKRLARLAKRDWKLLLTAISLLS 124
           R NST      +ST      ++ ELS          D++RL +LA+ + K L+ A+ L+ 
Sbjct: 50  RLNST--ANPRASTEEKPHQERLELSTATGNASGAKDVRRLFQLARPELKSLVCALVLIV 107

Query: 125 VSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEF-ISLVGVSLLVGTA 183
           +S  + M++P +IG +LD  ++ +     + D+   + +GL   +F ++L G+   VG  
Sbjct: 108 ISGAVSMTIPSVIGKLLDVAREDVEQE--SGDEEEAVLYGLPEKQFYLALSGI-FAVGAL 164

Query: 184 ANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLT 243
           AN GR+++L+   ER+VARLR   +K  + Q+  F D+N+VGDLISRLSSDA +VS+S+T
Sbjct: 165 ANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSIT 224

Query: 244 QKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEAT 303
           Q  SDG +A++ G+VG GMM  IS QL+A +  L PP++L A+++GR +RN SR+LQ   
Sbjct: 225 QNTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKV 284

Query: 304 GSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGD 363
           G LTKVAEEQ +  +TVQ++  E++EI+RY   +R++F+VG + A I+  FF  T  +G+
Sbjct: 285 GGLTKVAEEQLNATRTVQAYCGERREIRRYATEVRNVFDVGLKEALISGSFFGATGFVGN 344

Query: 364 MSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFE 423
            + L +L  G+ ++  G +S+G+L+++MMY  YTGSS+F LS+FYSE+M+GAGAA R+FE
Sbjct: 345 ATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFE 404

Query: 424 LTDRIPSISPTLGKKFVPNKGE-IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGP 482
           L DR P I PT+GK  V   G+ I F +V+F+YPTR  +Q+F  +   I  G +VCIVGP
Sbjct: 405 LNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGP 464

Query: 483 SGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI 542
           SG GKST+ASLLLR+Y+P +G I + G+DI   +    RR M IVQQEPVL + +I +NI
Sbjct: 465 SGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENI 524

Query: 543 TYGLVEKPTQDEVR--SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARAL 600
           TY L    T+D  R     +   C  F+  FP    T +GP GT LSGGQKQR+A+ARA 
Sbjct: 525 TYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARAF 584

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGN 660
           ++ P ILILDEATSALD +SE  +  T  +  +   IT ISIAHR STI+ S  VIVL  
Sbjct: 585 LQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKIT-ISIAHRKSTIQHSTRVIVLDK 643

Query: 661 DGSVAEVGKFKELYADPGSELSKLLHEK 688
            G V E G +++L  DPGS LS LL ++
Sbjct: 644 LGHVLETGTYQQLIGDPGSSLSGLLSKE 671

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  533 bits (1374), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 280/589 (47%), Positives = 397/589 (67%), Gaps = 9/589 (1%)

Query: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPE 160
           D+KRL  LAK + + +  A+ L+ +S  + M++P +IG +LD  ++    P+    +   
Sbjct: 85  DIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQPE---TEKET 141

Query: 161 IAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD 220
           + FGL   +F + +G   +VG  AN GR+++L+V  ER+VARLR   +K  + QDA F D
Sbjct: 142 MIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAALEQDATFLD 201

Query: 221 NNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280
           +N+VGDLISRLSSDA +VS+S+TQ +SDG +A++ G VG GMM  IS +L+  ++ L PP
Sbjct: 202 HNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCVMMLLAPP 261

Query: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340
           + + A  +G+ IRN SR LQ + G LTKV+EEQ S  KT+Q++  E+KEI RY   +R +
Sbjct: 262 LGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRYADEVRKV 321

Query: 341 FNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSS 400
           F+VG + A  +  FF +T  +G+++ L +L  G+ ++  G +++GDL+++MMY  YTGSS
Sbjct: 322 FHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMYAVYTGSS 381

Query: 401 IFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFV--PNKGEIEFKNVSFSYPTR 458
           +FGLS+FYSE+M+GAGAA+R+FEL DR P I PT+GK  V   NK  I F +V FSYPTR
Sbjct: 382 LFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENK-SIHFNHVKFSYPTR 440

Query: 459 ASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSK 518
             + IF++L+F +  G +VCIVGPSG GKST+ASLLLRYY+  +G+I +   +I   + +
Sbjct: 441 PQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNIRDFNLR 500

Query: 519 SLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR--SITKKCFCHNFITKFPNSYD 576
             RR + +VQQEP+L SGTI DNITY + ++   DE R      +  C  F+  FP+   
Sbjct: 501 KYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLANFPDGLQ 560

Query: 577 TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKS 636
           T +GP GT LSGGQKQRIA+ARA +  P+ILILDEATSALD +SE  +  +  +   ++ 
Sbjct: 561 TTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ-RSARG 619

Query: 637 ITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
            T ISIAHR+STI+ S  VIVL   G+VAE G F +L A P S L+KLL
Sbjct: 620 KTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLL 668

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  533 bits (1372), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 283/612 (46%), Positives = 404/612 (66%), Gaps = 11/612 (1%)

Query: 84  QESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDE 143
           Q+ S     SN    + D+KRL +LAK + K +L A+  + +S  + M++P IIG +LD 
Sbjct: 81  QKLSNEVSKSNG---MKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDL 137

Query: 144 LKQIMSNPDFTVDDVPE--IAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVA 201
            K    + D   +   E  + FGL   +F + +G   L G  AN  R+++L+V  ER+VA
Sbjct: 138 AKADNDDEDGDNNAKKEKLMIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVA 197

Query: 202 RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
           RLR   +K  ++QDA F D N+VGDLISRLSSDA +V++++TQ VSDG +A++ G VG G
Sbjct: 198 RLRTRTMKAALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFG 257

Query: 262 MMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321
           MM  IS +L+  ++ + PP+ + A  +GR IR  SR LQ + G LTKVAEEQ +  +T+Q
Sbjct: 258 MMSFISWKLTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQ 317

Query: 322 SFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGS 381
           ++  E  EI RY   +R +F+VG + A  +  FF  T ++G+++ + +L  G+ ++ +G+
Sbjct: 318 AYGGEALEIHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGT 377

Query: 382 LSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP 441
           L++GDL+++MMY  YTGSS+FGLS FYSE+M+GAGAA+R+FEL DR P I PT+G     
Sbjct: 378 LTVGDLSSFMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKS 437

Query: 442 NKGE-IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
             G+ IEF+NVSF+YPTR ++ I  NLS  I  G +VCIVGPSG GKST++SLLLRYY+ 
Sbjct: 438 LLGKSIEFQNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDV 497

Query: 501 TTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPT----QDEVR 556
           +TG I +DGQ+I + + +  RR + +VQQEP+L +GTI DNI Y ++ K T      +V+
Sbjct: 498 STGSIKIDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVK 557

Query: 557 SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
              ++  C  F+  FP   +T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSAL
Sbjct: 558 RALEQANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSAL 617

Query: 617 DVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD 676
           D +SE  +     + ++   +T ISIAHRLSTI+ S  VIVL   GSV E G F+EL   
Sbjct: 618 DSQSEEIVAKNLSERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDY 676

Query: 677 PGSELSKLLHEK 688
             SEL+ LL ++
Sbjct: 677 SRSELNMLLSQQ 688

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  530 bits (1364), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 288/651 (44%), Positives = 422/651 (64%), Gaps = 26/651 (3%)

Query: 75  RFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLP 134
           R+N   ++ Q SST T   ++     D+KRL +LA+ + + +  A++L+ +S  + M +P
Sbjct: 61  RWNHAESR-QPSSTLTPEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVP 119

Query: 135 KIIGIVLDELKQIMSNPDFTVDDVPEIA--------FGLNLYEFISLVGVSLLVGTAANY 186
            +IG ++D  K          +D    A        FGL + +F  ++    +VG AAN 
Sbjct: 120 GVIGKLMDAAKDDQQASKLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANM 179

Query: 187 GRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKV 246
           GR+++L+V  E++VARLR   +K ++ QDA F DNNKVGDLISRLSSDA +VS+SLTQ +
Sbjct: 180 GRIVILKVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNM 239

Query: 247 SDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSL 306
           SDG ++++ G VG GMM  IS +L+  ++ L PP+   A  +G+ IRN SR LQ + G L
Sbjct: 240 SDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGL 299

Query: 307 TKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF 366
           TK AEEQ S  +T+Q++  E+  I +Y   +R ++ VG + A  +  FF LT ++G+++ 
Sbjct: 300 TKAAEEQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAV 359

Query: 367 LVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTD 426
           L +L  G+ ++  G++++GDL+++M+Y  YTGSS+FG+S+FYSE+M+GAGAA+R+FEL D
Sbjct: 360 LALLLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELND 419

Query: 427 RIPSISPTLGKKFVPNKGE-IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGR 485
           R P+I PT G   V   G+ +EF+NV F+YPTR  + IF+NL+F+I+AG +VCIVGPSG 
Sbjct: 420 RRPAIHPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGG 479

Query: 486 GKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYG 545
           GKST+ASLLLR+Y+  TG I + GQ I+  + +  RR + +VQQEP+L +GTI DNI Y 
Sbjct: 480 GKSTVASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYS 539

Query: 546 LVEKPTQDE--VRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKK 603
           + +    DE  V     +  C  F++ FP+   T++GP GT LSGGQKQRIA+ARA +  
Sbjct: 540 VPQSLLNDENRVARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLD 599

Query: 604 PTILILDEATSALDVESEGAINYTFGKLMKSKSI---TIISIAHRLSTIRRSENVIVLGN 660
           P +LILDEATSALD  SE  +     + + S+S    T ISIAHR+STI+ S  VIVLG 
Sbjct: 600 PDLLILDEATSALDSRSEEVV----ARALYSRSTRGKTTISIAHRVSTIQHSSRVIVLGR 655

Query: 661 DGSVAEVGKFKELYADPGSELSKLLHEKATR-------SERQQNTAEDQEI 704
            G V E G F EL +DP S+L+ LL ++          S   +NT++ Q++
Sbjct: 656 SGYVVETGTFDELISDPDSQLNLLLRKEEEPSSEETTDSHVPENTSQGQQV 706

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  526 bits (1354), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 283/617 (45%), Positives = 409/617 (66%), Gaps = 14/617 (2%)

Query: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELK--QIMSNPDFTVDDV 158
           D++RL  LA+ + + +  A+  + +S  + M++P IIG +LD  K  Q  +  + +   V
Sbjct: 96  DIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEEEDSKTIV 155

Query: 159 PEIAF-GLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217
           P+I F GL   +F + +GV  LVG  AN GR+I+L+V  ER+VARLR   +K  + QDA 
Sbjct: 156 PDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKAALDQDAT 215

Query: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
           F D N+VGDLISRLSSDA +VS+++TQ VSDG +A++ G VG GMM  +S +L+  ++ +
Sbjct: 216 FLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKLTGVMMLM 275

Query: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
            PP+ + A  +GR IRN S+ LQE+ G L+KVAEEQ +  KT+Q++V E+ EI RY   +
Sbjct: 276 VPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEIHRYATEV 335

Query: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
           R++F +G + A  +  FF  T ++G+++ + +L  G+ ++  G+L++G+L+++MMY  YT
Sbjct: 336 RNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSFMMYAVYT 395

Query: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLG--KKFVPNKGEIEFKNVSFSY 455
           GSS+FGLS+FYSE+M+GAGAASR+FEL DR P I  T+G   K +  K  I+F+NVSF+Y
Sbjct: 396 GSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGK-SIKFENVSFTY 454

Query: 456 PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKV 515
           P+R +++IF NL+ +I+ G +VCIVG SG GKSTIASLLLRYY+   G I +   DI   
Sbjct: 455 PSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNF 514

Query: 516 SSKSLRRHMSIVQQEPVLMSGTIRDNITYG----LVEKPTQDEVRSITKKCFCHNFITKF 571
           S +  RR +  VQQEP L +G+I DNI Y     L  +   + V+   K+  C+ F+ KF
Sbjct: 515 SLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCNIFLGKF 574

Query: 572 PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKL 631
           P+   T++GP G  LSGGQKQRIA+ARA +  PT+LILDE+TSALD  SE  +  T  + 
Sbjct: 575 PDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVAKTL-QA 633

Query: 632 MKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATR 691
             ++ +T ISIAHRLSTI+ S  VIV+G  GSV E G F  L  +P SEL+ LL ++   
Sbjct: 634 RSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLLSQQ--- 690

Query: 692 SERQQNTAEDQEIDPEE 708
           +E        ++ +PEE
Sbjct: 691 NEHIDEDPSQEKQEPEE 707

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  519 bits (1337), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 276/621 (44%), Positives = 402/621 (64%), Gaps = 5/621 (0%)

Query: 90  TDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMS 149
           +D ++      D+KRL  L+K + K +  A+ L+ +S  + M++P +IG +LD L     
Sbjct: 77  SDANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLD-LASETE 135

Query: 150 NPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIK 209
           + +          +GL   +F + +G+  ++G  AN  R+I+L+V  ER+VARLR   +K
Sbjct: 136 DEEKEEKAKSNKLYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMK 195

Query: 210 KTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQ 269
             + QDA F D N+VGDLISRLSSDA +V++S+TQ VSDG +A++ G VG GMM  +S +
Sbjct: 196 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 255

Query: 270 LSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKE 329
           L+  ++ L PP+   A  +GR IRN SR LQ + G LTKVAEEQ +  +T+Q++  E+ E
Sbjct: 256 LTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 315

Query: 330 IKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTA 389
           ++RY   +R++F++G + A  +  FF  T ++G+ + L +L  G+ ++  GS+++G+L++
Sbjct: 316 VRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSS 375

Query: 390 YMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP-NKGEIEF 448
           +MMY  YTGSS+FGLS+FYSE+M+GAGAA+R+FEL DR P I PT+GK  V   +  I F
Sbjct: 376 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVF 435

Query: 449 KNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVD 508
           KNVSF+YPTR  +QIFK+L+  I+ G +VC VGPSG GKSTIASLLLRYY+  +G I   
Sbjct: 436 KNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFG 495

Query: 509 GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK--PTQDEVRSITKKCFCHN 566
            +DI   + +  RR +  VQQEP+L +GTI DNI Y +  +    +D +     +  C  
Sbjct: 496 DEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTK 555

Query: 567 FITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           F+  FP+   T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 556 FLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAK 615

Query: 627 TFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
              + ++ + +T ISIAHRLSTI+ S  V+VLG  GSV E G F++L A P SEL+ LL 
Sbjct: 616 NLQRRVE-RGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNALLA 674

Query: 687 EKATRSERQQNTAEDQEIDPE 707
           E+    +++     D+ I  E
Sbjct: 675 EQQDEEQKEGTADLDRGITQE 695

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  517 bits (1332), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 274/591 (46%), Positives = 390/591 (65%), Gaps = 6/591 (1%)

Query: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPE 160
           D+KRL  L+K + K +  A+ L+ +S  + M++P +IG +LD   +  S+ +        
Sbjct: 88  DIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASE--SDGEDEEGSKSN 145

Query: 161 IAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD 220
             +G    +F + +G   ++G  AN  R+I+L+V  ER+VARLR   +K  + QDA F D
Sbjct: 146 KLYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLD 205

Query: 221 NNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280
            N+VGDLISRLSSDA +V++S+TQ VSDG +A++ G VG GMM  +S +L+  ++ L PP
Sbjct: 206 TNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPP 265

Query: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340
           +   A  +GR IRN SR LQ + G LTKVAEEQ +  +T+Q++  E+ E++RY   +R++
Sbjct: 266 LGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNV 325

Query: 341 FNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSS 400
           F++G + A  +  FF  T ++G+ + L +L  G+ ++  GS+++G+L+++MMY  YTGSS
Sbjct: 326 FHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSS 385

Query: 401 IFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP-NKGEIEFKNVSFSYPTRA 459
           +FGLS+FYSE+M+GAGAA+R+FEL DR P I PT+GK  V   +  I FKNVSF+YPTR 
Sbjct: 386 LFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRP 445

Query: 460 SNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKS 519
            +QIFK+L+  I  G +VC VGPSG GKSTIASLLLRYY+  +G I    +DI   + + 
Sbjct: 446 KHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRK 505

Query: 520 LRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQ--DEVRSITKKCFCHNFITKFPNSYDT 577
            RR +  VQQEP+L +GTI DNI Y +  +  +  D +R    K  C  F+  FP+   T
Sbjct: 506 YRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQT 565

Query: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637
           ++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     + ++ +  
Sbjct: 566 MVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVE-RGF 624

Query: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEK 688
           T ISIAHRLSTI+ S  VIVLG  GSV E G F++L A P SEL+ LL E+
Sbjct: 625 TTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELNALLAEQ 675

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  515 bits (1326), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 280/626 (44%), Positives = 403/626 (64%), Gaps = 11/626 (1%)

Query: 90  TDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMS 149
           +D  +      D+KRL  L++ +   +  A+ L+ +S  + M++P +IG +LD       
Sbjct: 76  SDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDD 135

Query: 150 NPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIK 209
             D       ++ +GL+  +F + +G   L+G  AN  R+I+L+V  ER+VARLR   +K
Sbjct: 136 EEDAKETKDNKL-YGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMK 194

Query: 210 KTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQ 269
             + QDA F D N+VGDLISRLSSDA +V++S+TQ VSDG +A++ G VG GMM  +S +
Sbjct: 195 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 254

Query: 270 LSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKE 329
           L+  ++ L PP+   A  +GR IRN SR LQ + G LTKVAEEQ +  +T+Q++  E+ E
Sbjct: 255 LTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 314

Query: 330 IKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTA 389
           ++RY   +R++F+VG + A  +  FF  T ++G+ + L +L  G+ ++  G++++G+LT+
Sbjct: 315 VRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTS 374

Query: 390 YMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP-NKGEIEF 448
           +MMY  YTGSS+FGLS+FYSE+M+GAGAA+R+FEL DR P I PT+GK  V      I F
Sbjct: 375 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKPIVF 434

Query: 449 KNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVD 508
           K+VSF+YPTR  +QIFK+L+  I  G +VC VGPSG GKSTIASLLLRYY+ + G I   
Sbjct: 435 KDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDFG 494

Query: 509 GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK--PTQDEVRSITKKCFCHN 566
            +DI   + +  RR M  VQQEP+L +GTI DNI Y +  +    +D V     +  C  
Sbjct: 495 DEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRVARAIGQANCTK 554

Query: 567 FITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           F+  FP+   T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 555 FLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAK 614

Query: 627 TFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
              + +K + +T ISIAHRLSTI+ S  VIVLG  GSV E G F++L + PGSEL+ LL 
Sbjct: 615 NLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNALL- 672

Query: 687 EKATRSERQQNTAEDQEIDPEETINI 712
                +E+Q +  +D+ +  +   NI
Sbjct: 673 -----AEQQDDEGKDETVTSKNNNNI 693

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  515 bits (1326), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 285/667 (42%), Positives = 418/667 (62%), Gaps = 35/667 (5%)

Query: 75  RFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLP 134
           R+  +N   + S+T T    +     D+KRL +LA+ + K +  A+ L+ +S  + M +P
Sbjct: 61  RWQHSNA-SKPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVP 119

Query: 135 KIIGIVLDELKQ---IMSNPDFTVDDVPE--------------IAFGLNLYEFISLVGVS 177
            +IG ++D  K+     S  D    D  +              +  GL L +F   +   
Sbjct: 120 GVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSL 179

Query: 178 LLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYV 237
            +VG AAN GR+++L+V  E++VARLR   +K  + QDA F DNNKVGDLISRLSSDA +
Sbjct: 180 FVVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASI 239

Query: 238 VSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSR 297
           VS+SLTQ +SDG ++++ G VG GMM  IS +L+  ++ L PP+ + A  +GR IRN SR
Sbjct: 240 VSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSR 299

Query: 298 DLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSL 357
            LQ + G LTK AEEQ S  +T+Q++  E++ I+ Y   +R ++ VG + A  +  FF L
Sbjct: 300 TLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGL 359

Query: 358 TAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGA 417
           T ++G+ + L +L  G+ ++  G++++GDL+++M+Y  YTGSS+FG+S+FYSE+M+GAGA
Sbjct: 360 TGLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGA 419

Query: 418 ASRLFELTDRIPSISPTLGKKFVP-NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSN 476
           A+R+FEL DR P+I PT G+  V   +  +EFK V F+YPTR  + IF++LS +ID G +
Sbjct: 420 AARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEH 479

Query: 477 VCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSG 536
           VCIVGPSG GKST+ASLLLR+Y+   G I + GQ+I+  + +  RR + IVQQEP+L +G
Sbjct: 480 VCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNG 539

Query: 537 TIRDNITYGLVEKPTQDEVRSITK---KCFCHNFITKFPNSYDTILGPHGTLLSGGQKQR 593
           TI +NI Y + ++   +E   + +   +  C  F++ FP+   T++GP GT LSGGQKQR
Sbjct: 540 TILENILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQR 599

Query: 594 IAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSE 653
           IA+ARA +  P +LILDEATSALD  SE  I  T      ++  T ISIAHR+STI+ S 
Sbjct: 600 IALARAFLLDPDLLILDEATSALDSRSEEVIARTLHS-RTTRGKTTISIAHRVSTIQHST 658

Query: 654 NVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIE 713
            VIVLG +G V E G F EL ++  S+L+KLL +            E++ + P E  N  
Sbjct: 659 RVIVLGRNGGVVETGTFDELASNTDSQLNKLLRK------------EEEPVQPGEITNAP 706

Query: 714 NSTPESD 720
           +    SD
Sbjct: 707 HRPEGSD 713

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  511 bits (1317), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 270/615 (43%), Positives = 398/615 (64%), Gaps = 5/615 (0%)

Query: 90  TDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMS 149
           +D ++      D+KRL  L++ + K +  A+ L+ +S  + M++P +IG +LD +     
Sbjct: 77  SDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLD-VASESD 135

Query: 150 NPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIK 209
           + +          +GL   +F + +G+  ++G  AN  R+I+L++  ER+VARLR   +K
Sbjct: 136 DEEDEEKARDSKLYGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRTMK 195

Query: 210 KTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQ 269
             + QDA F D N+VGDLISRLSSDA +V++S+TQ VSDG +A++ G VG GMM  +S +
Sbjct: 196 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 255

Query: 270 LSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKE 329
           L+  ++ L PP+   A  +G+ IRN SR LQ + G LTKVAEEQ +  +T+Q++  E+ E
Sbjct: 256 LTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 315

Query: 330 IKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTA 389
           + RY   +R++F++G + A  +  FF  T ++G+ + L +L  G+ ++  G ++IG+L++
Sbjct: 316 VHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSS 375

Query: 390 YMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP-NKGEIEF 448
           +MMY  YTGSS+FGLS+FYSE+M+GAGAA+R+FEL DR P I PT+GK  +      + F
Sbjct: 376 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKPVVF 435

Query: 449 KNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVD 508
           KNVSF+YPTR  +QIFK+L+  I  G +VC VGPSG GKSTIASLLLRYY+  +G I  D
Sbjct: 436 KNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFD 495

Query: 509 GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK--PTQDEVRSITKKCFCHN 566
            +D+   + +  RR +  VQQEP+L +GTI DNI Y +  +    +D V    ++  C  
Sbjct: 496 DEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANCTK 555

Query: 567 FITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           F+  FP+   T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 556 FLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIVAK 615

Query: 627 TFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
              K ++ + +T ISIAHRLSTI+ S  +IVLG  GSV E G F++L A P SEL+ LL 
Sbjct: 616 NLQKRVE-RGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNALLA 674

Query: 687 EKATRSERQQNTAED 701
           E+     +++    D
Sbjct: 675 EQHDEEGKEKTANLD 689

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  508 bits (1308), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 273/621 (43%), Positives = 405/621 (65%), Gaps = 24/621 (3%)

Query: 84  QESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDE 143
           + +ST+T G   +    D+  L +LAK +   ++ ++ L+ ++  + M +P +IG +LD 
Sbjct: 85  KSNSTNTKGKTRE----DIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDI 140

Query: 144 LKQI--MSNPD--------------FTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYG 187
              I   SN D                 ++   + +G     F S +GV  +VG  AN G
Sbjct: 141 STGIEFASNKDENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTG 200

Query: 188 RVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVS 247
           R+I+L++  ER+VARLR   +K  + QD +F D+NKVGDLISRLSSD+ +VS ++T+ VS
Sbjct: 201 RIIILKLTGERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVS 260

Query: 248 DGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLT 307
           DG +A++ G VG+GMM  IS +LS  +LF+ PP+ + A  +GR IRN S+ LQE+ GSLT
Sbjct: 261 DGARAVIQGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLT 320

Query: 308 KVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFL 367
           K++EEQ +G +T+QS+V E+ EI +Y   +R +++VG   A  +  FF +T ++G+ + L
Sbjct: 321 KISEEQLNGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAML 380

Query: 368 VVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDR 427
            +L  G  ++ +G+LSIG L+++MMY  YTGSS+FGLS+FYSEIM+G+GAASR+FE+   
Sbjct: 381 SLLYVGCNMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKY 440

Query: 428 IPSISPTLGKKFVPNKGE-IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRG 486
           +P I+ T G   +  + + IEF+++ F+YPTR+ + IF++L+ KI+ G +VCI+GPSG G
Sbjct: 441 VPDINATKGIDPISFQDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSG 500

Query: 487 KSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGL 546
           KSTI+SLLLRYY+P  G I + G+DI + S +  R+ M +V QEPVL +GTI +NI Y +
Sbjct: 501 KSTISSLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNV 560

Query: 547 VEKPTQDEVR--SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKP 604
            E+   D+ R  +  +   C+ F+   P   +T +GP GT LSGGQKQR+A+ARA + +P
Sbjct: 561 PEEIANDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEP 620

Query: 605 TILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSV 664
           T+L+LDEATSALD  SE  +  T  K   +K  T ISIAHR+STI+ S  V+VL   G V
Sbjct: 621 TLLVLDEATSALDPRSESIVAQTL-KQRCAKGFTTISIAHRVSTIKHSSRVVVLDKVGHV 679

Query: 665 AEVGKFKELYADPGSELSKLL 685
            E G ++EL     S L+KLL
Sbjct: 680 VETGPYEELLGIKDSALNKLL 700

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  483 bits (1242), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 271/609 (44%), Positives = 385/609 (63%), Gaps = 26/609 (4%)

Query: 83  EQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLD 142
            + SST TD    +   + +K+L RLAK + K +  A+ L++VS  + MSLP +IG ++D
Sbjct: 16  HRNSSTKTDLKKTQ-TWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLID 74

Query: 143 ELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVAR 202
                 S PD  +       +GL   +F+  +G   +VG  AN GR+I+L++  E++VAR
Sbjct: 75  H----ASTPDAPI-------YGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVAR 123

Query: 203 LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGM 262
           LR   +K  + QDA F D ++VGDLISRLSSDA +VS+S+T  +SDG +A L G VGIGM
Sbjct: 124 LRTKTMKSMLSQDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGM 183

Query: 263 MISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQS 322
           M  IS +L+  +  + PP+ + A  +G  I+  SR LQ+  G L+K +EEQ + +KTVQ+
Sbjct: 184 MTYISLKLTTVMTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQA 243

Query: 323 FVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSL 382
           +  E+KE++RY++ +R +FN+G + A  +A FF  T ++G+++ + +L  G+      S+
Sbjct: 244 YAGERKELQRYSNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSI 300

Query: 383 SIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPN 442
           ++G+L+++MMY  YTGSS+FGL+ FYSE+M+G GAA R+ EL +    ISPT  K   P 
Sbjct: 301 TLGELSSFMMYGVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPT--KGISPP 358

Query: 443 KG----EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYY 498
           K      I F NVSF+Y    S  +   ++F+I  G +VC VG SG GKSTI+SLLLRYY
Sbjct: 359 KTLKGLPITFNNVSFAYSNGKS--VLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYY 416

Query: 499 NPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSI 558
              +G I +   DIS  + +  RR + +VQQEP+L +GTI DNITYGL +K   D +   
Sbjct: 417 RTGSGNISIGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDKSLTD-LNMA 475

Query: 559 TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            K   C  FI +     DT++GP G  LSGGQ+QRIA+AR  ++ P ILILDEATSALD 
Sbjct: 476 LKAANCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDT 535

Query: 619 ESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPG 678
           +SE  IN    +  ++  +T ISIAHRLSTIR S  VIV+  DG V E G F +L +   
Sbjct: 536 KSEDIINKELQRRQEA-GMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRD 593

Query: 679 SELSKLLHE 687
           SEL+KLL E
Sbjct: 594 SELNKLLKE 602

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  218 bits (554), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 192/633 (30%), Positives = 295/633 (46%), Gaps = 55/633 (8%)

Query: 99  LSDLKRLARLAKRDWKL--------LLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSN 150
           +S+LK L  L +  W          +L A+ LL  + ++ + +P          KQ + +
Sbjct: 89  MSELKILKDLFRYIWPQGNNKVRIRVLIALGLLISAKILNVQVPFF-------FKQTIDS 141

Query: 151 PDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKK 210
            + T DD P IA         + +G+++L    A +G V L   L   V AR+  N I+ 
Sbjct: 142 MNITWDD-PTIALP-------AAIGLTILCYGTARFGSV-LFGELRNAVFARVAQNAIRT 192

Query: 211 TMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI---- 266
              Q         +G  +SR +          T+ +S    AM+   + I   IS+    
Sbjct: 193 VSLQTFRHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLTAMVFHIIPISFEISVVCGI 252

Query: 267 -SPQLSAFLLFLTPPVMLSASYFG----RLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321
            + Q  A    +T   ML  S F         N  RD   A      VA +     + V+
Sbjct: 253 LTYQFGASFAAITFSTMLLYSMFTIKTTAWRTNFRRDANRADNKAASVALDSLINFEAVK 312

Query: 322 SFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGSYL 376
            F  E+    +YN ++ +       V +  AF+N+ +    T+ L  M ++     G   
Sbjct: 313 YFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNSGQNLIFTSALTAMMYM-----GCTG 367

Query: 377 VLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSIS---- 432
           V+ G L++GDL             +  L + Y E+ Q       LF+L      I     
Sbjct: 368 VIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFKLRKNEIKIKNAER 427

Query: 433 PTLGKKFVPNKGEIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIA 491
           P +  + VP   +I F+NV+F Y P R   +I KN SF I AGS   IVG SG GKSTI 
Sbjct: 428 PLMLPEHVPY--DITFQNVTFGYHPDR---KILKNASFTIPAGSKTAIVGSSGSGKSTIL 482

Query: 492 SLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPT 551
            L+ R+Y+P +G+I ++G+DI +    +LR+ + +V Q+  L + TI +N+ +G ++  T
Sbjct: 483 KLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDA-T 541

Query: 552 QDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
            +EV ++ +K      I K P  ++TI+G  G ++SGG+KQR+AIAR L+K   I+  DE
Sbjct: 542 DEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDE 601

Query: 612 ATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFK 671
           ATSALD  +E A+  T      S S T + IAHRL TI  ++ +IV  N G V E GK  
Sbjct: 602 ATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVFDN-GKVREEGKHL 660

Query: 672 ELYADPGSELSKLLHEKATRSERQQNTAEDQEI 704
           EL A PGS   +L   +      +    +DQ +
Sbjct: 661 ELLATPGSLYRELWTIQEDLHHLENELKDDQAL 693

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  216 bits (549), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 191/635 (30%), Positives = 302/635 (47%), Gaps = 59/635 (9%)

Query: 99  LSDLKRLARLAKRDWK--------LLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSN 150
           LS+L+ L  L +  W          +L A+ LL  + ++ + +P          KQ + +
Sbjct: 87  LSELRILKDLFRYIWPKGNNKVRVRVLIALGLLISAKVLNVQVPFF-------FKQTIDS 139

Query: 151 PDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKK 210
            + T DD P +A         + +G++++    A +G V L   L   V A++  N I+ 
Sbjct: 140 MNITWDD-PTVALP-------AAIGLTIISYGVARFGSV-LFGELRNAVFAKVAQNAIRT 190

Query: 211 TMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI---- 266
              Q  +      +G  +SR +          T+ +S    AM+   + I   IS+    
Sbjct: 191 VSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGI 250

Query: 267 -SPQLSAFLLFLTPPVMLSASYFGRLIRNNS------RDLQEATGSLTKVAEEQFSGIKT 319
            + Q  A    +T   ML  S F   I+  +      RD   A      VA +     + 
Sbjct: 251 LTYQFGASFAAITFSTMLLYSIFT--IKTTAWRTHFRRDANRADNKAASVALDSLINFEA 308

Query: 320 VQSFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGS 374
           V+ F  E+    +YN ++ +       V +  AF+N+ +    T  L  M ++     G 
Sbjct: 309 VKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYM-----GC 363

Query: 375 YLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTD---RIPSI 431
             V+ G L++GDL             +  L + Y ++ Q       LF+L     +I S+
Sbjct: 364 TGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIKSV 423

Query: 432 S-PTLGKKFVPNKGEIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
             P +  + VP   EI F+NV+F Y P R   +I KN SF I AG    IVG SG GKST
Sbjct: 424 ERPLMLPEHVPY--EITFENVTFGYHPDR---KILKNASFTIPAGWKTAIVGSSGSGKST 478

Query: 490 IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK 549
           I  L+ R+Y+P +G+I ++G+DI +    +LRR + +V Q+  L + TI +N+ +G ++ 
Sbjct: 479 ILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTPLFNDTIWENVKFGRIDA 538

Query: 550 PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
            T +EV++  +K      I K P  ++TI+G  G ++SGG+KQR+AIAR L+K   I+  
Sbjct: 539 -TDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQRLAIARVLLKNARIMFF 597

Query: 610 DEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
           DEATSALD  +E A+  T      S S T + IAHRL TI  ++ +IVL N G+V E GK
Sbjct: 598 DEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVLDN-GTVKEDGK 656

Query: 670 FKELYADPGSELSKLLHEKATRSERQQNTAEDQEI 704
             EL A PGS   +L   +   S  +    ++Q +
Sbjct: 657 HIELLATPGSLYRELWTIQEDLSHLENELKDEQAL 691

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  213 bits (543), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 200/670 (29%), Positives = 311/670 (46%), Gaps = 65/670 (9%)

Query: 68  LLNIPSKRFNSTNTKEQESS-----THTDGSNDKFELSDLKRLARLAKRDWK-------- 114
           L N   K      + EQ SS     T    ++    LS+LK L  L +  W         
Sbjct: 50  LWNQAQKDITHKKSVEQFSSAPKVKTQVKKTSKAPTLSELKILKDLFRYIWPKGNNKVRI 109

Query: 115 LLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLV 174
            +L A+ LL  + ++ + +P          KQ + + +   DD P +A         + +
Sbjct: 110 RVLIALGLLISAKILNVQVPFF-------FKQTIDSMNIAWDD-PTVALP-------AAI 154

Query: 175 GVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSD 234
           G+++L    A +G V L   L   V A++  N I+    Q  +      +G  +SR +  
Sbjct: 155 GLTILCYGVARFGSV-LFGELRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGG 213

Query: 235 AYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI-----SPQLSAFLLFLTPPVMLSASYFG 289
                   T+ +S    AM+   + I   IS+     + Q  A    +T   ML  S F 
Sbjct: 214 LTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSIFT 273

Query: 290 RLIRNNS------RDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI--- 340
             I+  +      RD  +A      VA +     + V+ F  E+    +YN ++ +    
Sbjct: 274 --IKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDS 331

Query: 341 -FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTG 398
              V +  AF+N+ +    T  L  M ++     G   V+ G+L++GDL           
Sbjct: 332 QIKVSQSLAFLNSGQNLIFTTALTAMMYM-----GCTGVIGGNLTVGDLVLINQLVFQLS 386

Query: 399 SSIFGLSTFYSEIMQGAGAASRLFELTDRIPSIS----PTLGKKFVPNKGEIEFKNVSFS 454
             +  L + Y ++ Q       LF+L      I     P +  + VP   +I F+NV+F 
Sbjct: 387 VPLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIKNAERPLMLPENVPY--DITFENVTFG 444

Query: 455 Y-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
           Y P R   +I KN SF I AG    IVG SG GKSTI  L+ R+Y+P +G+I ++G+DI 
Sbjct: 445 YHPDR---KILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIK 501

Query: 514 KVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPN 573
           +    +LR+ + +V Q+  L + TI +N+ +G ++  T +EV ++ +K      I K P 
Sbjct: 502 EYDIDALRKVIGVVPQDTPLFNDTIWENVKFGRID-ATDEEVITVVEKAQLAPLIKKLPQ 560

Query: 574 SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMK 633
            +DTI+G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      
Sbjct: 561 GFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFT 620

Query: 634 SKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSE 693
           S S T + IAHRL TI  ++ +IVL N G V E GK  EL A PGS L + L       +
Sbjct: 621 SGSRTSVYIAHRLRTIADADKIIVLDN-GRVREEGKHLELLAMPGS-LYRELWTIQEDLD 678

Query: 694 RQQNTAEDQE 703
             +N  +DQ+
Sbjct: 679 HLENELKDQQ 688

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  212 bits (539), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 187/610 (30%), Positives = 288/610 (47%), Gaps = 59/610 (9%)

Query: 99  LSDLKRLARLAKRDWK--------LLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSN 150
           LS+LK L  L +  W          +L A+ LL  + ++ + +P          KQ + +
Sbjct: 86  LSELKILKDLFRYIWPKENNKVRVRVLVALGLLISAKILNVQVPFF-------FKQTIDS 138

Query: 151 PDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKK 210
            +   DD P +A         + +G+++L    A +G V L   L   V AR+  N I+ 
Sbjct: 139 MNIAWDD-PTVALP-------AAIGLTILCYGVARFGSV-LFGELRNAVFARVAQNAIRT 189

Query: 211 TMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI---- 266
              Q  +      +G  +SR +          T+ +S    AM+   + I   IS+    
Sbjct: 190 VSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGI 249

Query: 267 -SPQLSAFLLFLTPPVMLSASYFGRLIRNNS------RDLQEATGSLTKVAEEQFSGIKT 319
            + Q  A    +T   ML  S F   I+  +      RD  +A      VA +     + 
Sbjct: 250 LTYQFGASFAAITFSTMLLYSMFT--IKTTAWRTKFRRDANKADNKAASVALDSLINFEA 307

Query: 320 VQSFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGS 374
           V+ F  E+    +YN ++         V +  AF+N+ +    T  L  M ++     G 
Sbjct: 308 VKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYM-----GC 362

Query: 375 YLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSIS-- 432
             V+ G+L++GDL             +  L + Y ++ Q       LF+L      I   
Sbjct: 363 TGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNA 422

Query: 433 --PTLGKKFVPNKGEIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
             P +  + VP   +I F+NV+F Y P R   +I KN SF I AG    IVG SG GKST
Sbjct: 423 ERPLMLPEHVPY--DITFENVTFGYHPDR---KILKNASFTIPAGWKTAIVGSSGSGKST 477

Query: 490 IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK 549
           I  L+ R+Y+P +G+I ++G+DI +    +LR+ + +V Q+  L + TI +N+ +G ++ 
Sbjct: 478 ILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVPQDTPLFNDTIWENVKFGRID- 536

Query: 550 PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
            T +EV ++ +K      I K P  +DTI+G  G ++SGG+KQR+AIAR L+K   I+  
Sbjct: 537 ATDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNAKIMFF 596

Query: 610 DEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
           DEATSALD  +E A+  T      S S T + IAHRL TI  ++ +IVL N G V E GK
Sbjct: 597 DEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRTIADADKIIVLDN-GRVREEGK 655

Query: 670 FKELYADPGS 679
             EL A P S
Sbjct: 656 HLELLATPNS 665

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  209 bits (531), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 186/638 (29%), Positives = 298/638 (46%), Gaps = 68/638 (10%)

Query: 99  LSDLKRLARLAKRDWK--------LLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSN 150
           +S+LK L  L K  W          +LTA++LL  + L+ + +P      +D +    S+
Sbjct: 93  ISELKILKDLFKYIWPSGDNKVRFRVLTALALLIGAKLLNVQVPFFFKDAVDSMNIEWSD 152

Query: 151 PDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKK 210
                  V  IA  L +  +            AA +G  +L   +   V A +  N I+K
Sbjct: 153 ----ATTVLPIAITLTVLSY-----------GAARFG-AVLFGEIRNAVFASVAQNAIRK 196

Query: 211 TMHQDAEFFDNNKVGDLISRLSSD------------AYVVSRSLTQKVSDGFK-AMLCGS 257
              Q  +      +G  +SR +              +YV+S  +   +   F+ +++CG 
Sbjct: 197 VSLQTFQHLMRLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPIAFEISVVCGI 256

Query: 258 VGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGI 317
           +      S +    A +L  +     + ++     R+ +R    A      VA +     
Sbjct: 257 LTYQFGTSFAAVTFATMLLYSIFTFKTTAWRTEFRRSANR----ADNKAASVALDSLINF 312

Query: 318 KTVQSFVAEQKEIKRYNHAIRHIFN----VGKQSAFINA-KFFSLTAVLGDMSFLVVLAY 372
           + V+ F  E+    +Y++++ +  N    V +  AF+N+ +    T+ L  M ++     
Sbjct: 313 EAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNSGQNLIFTSALTAMMYM----- 367

Query: 373 GSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSIS 432
           G   V+ G LS+GDL             +  L + Y E+ Q       LF+L     +I 
Sbjct: 368 GCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNKVNIQ 427

Query: 433 PTLGKKFVPNKG--EIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
            +     +P     EI+F+NV+F Y P R   +I +N +F + AG    IVGPSG GKST
Sbjct: 428 NSKTPLMLPKDKPCEIKFENVTFGYHPDR---KILENANFTLPAGWKTAIVGPSGSGKST 484

Query: 490 IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK 549
           I  L+ R+Y+P  G+I +DG+DI ++  KSLRR + +V Q+  L + TI +N+ +G +  
Sbjct: 485 ILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPLFNDTIWENVKFGKITA 544

Query: 550 PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
            T D++R    K      I   P   +TI+G  G ++SGG+KQR+AIAR L+K   I+  
Sbjct: 545 -TDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQRLAIARVLLKDTPIMFF 603

Query: 610 DEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
           DEATSALD  +E A+  T  +     S T I IAHRL TI  ++ ++VL N G V E GK
Sbjct: 604 DEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADADKIVVLEN-GRVKEEGK 662

Query: 670 FKELYADPGSELSK---------LLHEKATRSERQQNT 698
             EL + P S  S+         LL E+    ++QQ+T
Sbjct: 663 HAELLSKPTSLYSELWNIQENLDLLEEEIEMDKKQQDT 700

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  208 bits (529), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 183/615 (29%), Positives = 290/615 (47%), Gaps = 54/615 (8%)

Query: 99  LSDLKRLARLAKRDWKL--------LLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSN 150
           +S++K L  L K  W          ++ AISLL  + L+ + +P          KQ +  
Sbjct: 85  ISEMKILKDLFKYIWPRGDNKVRIRVVIAISLLIGAKLLNVQVPFF-------FKQTVDA 137

Query: 151 PDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKK 210
            + T DD P +A         + +G+++L    A +G V+   V    V A++  N I+ 
Sbjct: 138 MNITWDD-PTVALP-------AAIGLTILCYGFARFGAVLFGEV-RNAVFAKVAQNAIRT 188

Query: 211 TMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI---- 266
              Q  +      +G  +SR +          T+ +S    AM+   + I   IS+    
Sbjct: 189 VSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHILPITFEISVVCGI 248

Query: 267 -SPQLSAFLLFLTPPVMLSASYFGRLIRNNS------RDLQEATGSLTKVAEEQFSGIKT 319
            + Q  A    +T   M+  S F   IR  +      RD  +A      VA +     + 
Sbjct: 249 LTYQFGASFAAITFTTMILYSIFT--IRTTAWRTQFRRDANKADNKGASVALDSLINFEA 306

Query: 320 VQSFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGS 374
           V+ F  E+    +Y+ ++         V +  A++N+ +    T+ L  M ++     G 
Sbjct: 307 VKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAYLNSGQNLIFTSALTAMMYM-----GC 361

Query: 375 YLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTD---RIPSI 431
             V+ G L++GDL             +  L + Y E+ Q       LF+L     +I + 
Sbjct: 362 TGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLRKNEIKIENG 421

Query: 432 SPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIA 491
           +  +  K      EI F+NV+F Y ++   +I  N SF I  G    +VGPSG GKSTI 
Sbjct: 422 TNPIVLKASDGPFEITFENVTFGYDSK--RKILNNASFTIPGGLKTAVVGPSGSGKSTIL 479

Query: 492 SLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPT 551
            L+ R+Y+P  G+I ++G D+ +    SLRR M +V Q+  L + TI +N+ +G ++  T
Sbjct: 480 KLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDA-T 538

Query: 552 QDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
            +EV ++ +K      I K P  Y+TI+G  G ++SGG+KQR+AIAR L+K   I+  DE
Sbjct: 539 DEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDE 598

Query: 612 ATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFK 671
           ATSALD  +E A+  T     +S S T + IAHRL TI  ++ +IVL  DG+V E G   
Sbjct: 599 ATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIADADKIIVL-EDGAVKEEGTHS 657

Query: 672 ELYADPGSELSKLLH 686
            L A PGS  + L +
Sbjct: 658 GLLATPGSLYANLWN 672

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  207 bits (528), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 196/632 (31%), Positives = 299/632 (47%), Gaps = 56/632 (8%)

Query: 99  LSDLKRLARLAKRDW-----KLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDF 153
           +S+LK L  L K  W     K+ L    L+S+S LIG  L  +   V    K+ + + + 
Sbjct: 103 ISELKILKDLFKYIWPRGDSKVKLRV--LISLSLLIGAKLLNVQ--VPFFFKKTVDSMNV 158

Query: 154 TVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMH 213
           T DD P +A         + +G+++L    A +  V L   L   V  ++  N IK    
Sbjct: 159 TWDD-PSVALP-------AAIGLTILSYGVARFSTV-LFGELRNAVFVKVAQNAIKTV-- 207

Query: 214 QDAEFFDNNKVGDLISRLSSDAYVVSRSL---TQKVSDGFKAMLCGSVGIGMMISI---- 266
              E F +    DL   LS     ++R++   T+ +S    AM+   + I   IS+    
Sbjct: 208 -SVETFRHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPITFEISVVCGI 266

Query: 267 -SPQLSAFLLFLTPPVMLSASYFGRLIRNNS------RDLQEATGSLTKVAEEQFSGIKT 319
            + Q  A    +T   ML  S F   I+  +      RD  +A      +A +     + 
Sbjct: 267 LTHQFGASFAEITFMTMLLYSIFT--IKTTAWRTQFRRDANKADNKGASIALDSLINFEA 324

Query: 320 VQSFVAEQKEIKRYNHAIRHIFN----VGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGS 374
           V+ F  E     +YN A+    N    + K  AF+N+ +    T  L  M +L     G 
Sbjct: 325 VKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNSGQNLIFTTALTGMMYL-----GC 379

Query: 375 YLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPT 434
             V+ G+L++GDL             +  L + Y E+ Q       LF+L      I   
Sbjct: 380 TGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNEVKIHNI 439

Query: 435 LGKKFVPNKG---EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIA 491
              K +  +    EI F+NV+F Y   A  +I KN SF I AG    IVGPSG GKSTI 
Sbjct: 440 ENPKIILKEDGPFEITFENVTFGY--HADRKILKNASFTIPAGWKTAIVGPSGSGKSTIL 497

Query: 492 SLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPT 551
            L+ R+Y+P  G+I ++G D+ ++   SLR+ + +V Q+  L + +I +N+ +G ++   
Sbjct: 498 KLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQDTPLFNDSIWENVKFGRID-AL 556

Query: 552 QDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
             E+  + +K    + I K P SY+TI+G  G ++SGG+KQR+AIAR L+K  +++  DE
Sbjct: 557 DSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGGEKQRLAIARVLLKDASVMFFDE 616

Query: 612 ATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFK 671
           ATSALD  +E A+  T     K+ S T I IAHRL TI  ++ +IVL  DG+V E G   
Sbjct: 617 ATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTIADADKIIVL-EDGTVREEGTHN 675

Query: 672 ELYADPGSELSKL--LHEKATRSERQQNTAED 701
           EL A   S   +L  + E     ER+    +D
Sbjct: 676 ELLAKSTSLYKELWNVQENLDLIEREIEIEKD 707

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  207 bits (527), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 190/666 (28%), Positives = 306/666 (45%), Gaps = 70/666 (10%)

Query: 70  NIPSKRFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDW--------KLLLTAIS 121
           N P  + N+  +    +    + ++    + +LK L  L K  W          +L A+S
Sbjct: 56  NSPKIQENTVKSSPAPAKPKANEASKTPTIGELKILKDLFKYIWPNGDNKVKARVLIALS 115

Query: 122 LLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVG 181
           LL  S ++ + +P     ++D +    ++P   +               I++  + L  G
Sbjct: 116 LLVGSKVLNVQVPFFFKQIVDSMNIEWADPTAVLP--------------IAVTAMILSYG 161

Query: 182 TAANYGRVI-------LLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSD 234
            AA +G V+       +   +++  + R+     +  M  D  +  + + G L   +   
Sbjct: 162 -AARFGSVLFGELRNAIFASVAQSAITRVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRG 220

Query: 235 AYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI-SPQLSAFLLFLTPPVMLSASYFG---R 290
              +S  L+  V      ++  +V IG +  I + Q  A    +T   ML  S F     
Sbjct: 221 TKGISYVLSAMVFH----IIPITVEIGAVCGILTYQFGASFAAMTFTTMLLYSIFTFKTT 276

Query: 291 LIRNNSR-DLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI----FNVGK 345
             R   R    +A      VA +     + V+ F  EQ    +Y++++         V +
Sbjct: 277 AWRTEFRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQ 336

Query: 346 QSAFINA-KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGL 404
             AF+NA + F  T+ L  M ++     G   V+ G+LS+GDL             +  L
Sbjct: 337 SLAFLNAGQNFIFTSALTAMMYM-----GCTGVISGTLSVGDLVLINQLVFQLSVPLNFL 391

Query: 405 STFYSEIMQGAGAASRLFELTDRIPSIS----PTLGKKFVPNKGEIEFKNVSFSY-PTRA 459
            + Y E+ Q       LF+L      I     P +     P+K  I F+NVSF Y P R 
Sbjct: 392 GSVYRELKQSLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSK--IVFENVSFGYDPDR- 448

Query: 460 SNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKS 519
              I KN SF + AG    IVGPSG GKSTI  L+ R+Y+P  G+I VDG+D+ ++  +S
Sbjct: 449 --MILKNSSFTMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIES 506

Query: 520 LRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTIL 579
           LRR + +V Q+  L + +I +N+ +G +   + +E+R   +K    + + + P   DTI+
Sbjct: 507 LRRAIGVVPQDTPLFNDSIWENVRFGKISA-SDEEIRLAVEKAQLESLVDQLPKGRDTIV 565

Query: 580 GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITI 639
           G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T 
Sbjct: 566 GERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTS 625

Query: 640 ISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKL---------LHEKAT 690
           + IAHRL TI  ++ +IV+   G V E GK  EL A PGS  ++L         L+E+  
Sbjct: 626 VYIAHRLRTIADADKIIVI-QQGQVKEEGKHAELLAKPGSLYAELWNVQENLDVLNEELQ 684

Query: 691 RSERQQ 696
           R E Q+
Sbjct: 685 REETQE 690

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  206 bits (523), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 184/622 (29%), Positives = 292/622 (46%), Gaps = 50/622 (8%)

Query: 90  TDGSNDKFELSDLKRLARLAKRDWK--------LLLTAISLLSVSCLIGMSLPKIIGIVL 141
           T+G +    +S+L+ +  L K  W          +L A++LL  + L+ + +P      +
Sbjct: 96  TNGKSKTPTISELRIMKDLFKYIWPSGDNKVKIRVLIALALLIGAKLLNVQVPFFFKQTI 155

Query: 142 DELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVA 201
           D +  I   PD  V  V  +A           + +++L   AA +G V+    L   V A
Sbjct: 156 DSM-NIEWGPD--VATVLPVA-----------ITMTILSYGAARFGAVMFGE-LRNAVFA 200

Query: 202 RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
           ++  N I+K   Q  +      +G  +SR +          T+ +S    AM+   + I 
Sbjct: 201 KVAQNAIRKVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHMIPIT 260

Query: 262 MMISI-----SPQLSAFLLFLTPPVMLSASYFG---RLIRNN-SRDLQEATGSLTKVAEE 312
             IS+     + Q  +    +T   ML  S+F       R    R    A      VA +
Sbjct: 261 FEISVVCGILTYQFGSSFAAMTFVTMLLYSFFTFKTTAWRTEFRRSANRADNKAASVALD 320

Query: 313 QFSGIKTVQSFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFL 367
                + V+ F  E+    +Y+ ++         V +  AF+NA + F  T+ L  M ++
Sbjct: 321 SLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYM 380

Query: 368 VVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDR 427
                G+  V+ G+L++GDL             +  L + Y E+ Q       LF+L   
Sbjct: 381 -----GASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKN 435

Query: 428 IPSISPTLGKKFVPNK--GEIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSG 484
              I  T     +P     EI+F+NV+F Y P R    I KN +F I  G    IVGPSG
Sbjct: 436 PILIKNTERPLMLPEHLPCEIKFENVTFGYQPDR---NILKNATFTIAPGKKTAIVGPSG 492

Query: 485 RGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITY 544
            GKSTI  L+ R+Y+P  G+I +DG+DI ++    LRR + +V Q+  L + TI +N+ +
Sbjct: 493 SGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKF 552

Query: 545 GLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKP 604
           G +   T +E+ +  +K    + I K P   +TI+G  G ++SGG+KQR+AIAR L+K  
Sbjct: 553 GRIN-ATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARVLLKDT 611

Query: 605 TILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSV 664
            I+  DEATSALD  +E ++  T  +     + T + IAHRL TI  ++ +IVL N G+V
Sbjct: 612 PIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVLEN-GAV 670

Query: 665 AEVGKFKELYADPGSELSKLLH 686
            E G    L A+P S  S+L +
Sbjct: 671 REEGTHNALLANPNSLYSELWN 692

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  203 bits (517), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 187/612 (30%), Positives = 285/612 (46%), Gaps = 49/612 (8%)

Query: 99  LSDLKRLARLAKRDWK--------LLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSN 150
           +S+LK L  L K  W          +L A+ LL  S L+ + +P     ++D +     N
Sbjct: 113 ISELKILKDLFKYIWPSGDNKVKIRVLIALGLLVGSKLLNVQVPFFFKQIVDSM-----N 167

Query: 151 PDFT-VDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIK 209
            ++T    V  IA G  +  + +    S+L G   N     +   + +  + R+     +
Sbjct: 168 IEWTDATSVLPIAIGSMILSYGAARFGSVLFGELRN----AIFASVGQSAITRVSLQTFQ 223

Query: 210 KTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI-SP 268
             M  D  +  + + G L   +      +S  L+  V      ++  +V IG +  I + 
Sbjct: 224 HLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFH----IIPITVEIGAVCGILTY 279

Query: 269 QLSAFLLFLTPPVMLSASYFG---RLIRNNSR-DLQEATGSLTKVAEEQFSGIKTVQSFV 324
           Q       +T   ML  S F       R   R    +A      VA +     + V+ F 
Sbjct: 280 QFGGSFAAMTFSTMLLYSIFTFKTTAWRTEFRKSANKADNKAASVAVDSLINFEAVKYFN 339

Query: 325 AEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGSYLVLH 379
            EQ    +Y+ ++         V +  AF+N+ +    T+ L  M ++     G   V+ 
Sbjct: 340 NEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSALTAMMYM-----GCTGVMS 394

Query: 380 GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSIS----PTL 435
           G LS+GDL             +  L + Y E+ Q       LF+L     SI     P +
Sbjct: 395 GELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVSIQNSKKPLM 454

Query: 436 GKKFVPNKGEIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLL 494
               VP+  EI FKNVSF Y P R    I KN SF I  GS   IVGPSG GKSTI  L+
Sbjct: 455 LPPNVPS--EIVFKNVSFGYDPDRL---ILKNASFTIPTGSKTAIVGPSGSGKSTILKLV 509

Query: 495 LRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDE 554
            R+Y+P  G+I +DG+D+ ++  +SLRR + +V Q+  L + +I DN+ +G ++   Q+ 
Sbjct: 510 FRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKFGRIDATDQEI 569

Query: 555 VRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
            R+I +       I + P   DTI+G  G ++SGG+KQR+AIAR L+K   I+  DEATS
Sbjct: 570 ERAIDRAQL-RALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATS 628

Query: 615 ALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY 674
           ALD  +E A+  T  +   + S T + IAHRL TI  ++ +IVL   G V E GK  EL 
Sbjct: 629 ALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVL-EHGRVKEEGKHAELL 687

Query: 675 ADPGSELSKLLH 686
           A P S  ++L +
Sbjct: 688 ATPKSLYAELWN 699

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  206 bits (523), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 147/518 (28%), Positives = 253/518 (48%), Gaps = 23/518 (4%)

Query: 183  AANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVGDLISRLSSDAYVVSR 240
             +N+ +  +L   SE  +  LR   +++   +  E+F  + NK  ++ + L +D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 241  SLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQ 300
             ++Q +S     +    VG+   I+   +LS   + + P +++ +  +G +++N     +
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 301  EATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAV 360
                +L  +  E  +G+KT++    +    K Y+     +  + ++ A +     ++T  
Sbjct: 883  TKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTA 942

Query: 361  LGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASR 420
            +      ++  YG  LV+ G  S   +        +T  +   L +   +I +G  AAS 
Sbjct: 943  IATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNSLISQIPDISRGQRAASW 1002

Query: 421  LFELTD-------------RIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNL 467
            ++ + +             R   I    G+K    +  +   N+ F+YPT     I+ NL
Sbjct: 1003 IYRIIEESEDTKEQTITDGRFDEIH--CGEKVDKTQPLVSIHNLEFAYPTALDVNIYDNL 1060

Query: 468  SFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIV 527
            S  ++ G  V IVG SG GKST+  LL + Y      I +DG D+++  +++LRR +S+V
Sbjct: 1061 SLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISVV 1120

Query: 528  QQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLS 587
            +Q+PVL  GT+R+N+ YGL   P + ++  I K    ++FI   P   +T      +L+S
Sbjct: 1121 EQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLET--SVDTSLIS 1178

Query: 588  GGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLS 647
            GGQ QR+ IARAL++KP ILILDE TSALD  S   IN    K     S+  ISI H   
Sbjct: 1179 GGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHNEQ 1236

Query: 648  TIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
             +R    V VL  DG + E G F +L+  PG+EL K++
Sbjct: 1237 MMRSCNTVAVL-KDGKICETGPFNKLFK-PGNELYKVV 1272

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 154/617 (24%), Positives = 276/617 (44%), Gaps = 43/617 (6%)

Query: 110 KRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYE 169
           KRDW L+ T +     + L+      + G V D LK      DF   ++P+     NLY 
Sbjct: 20  KRDWLLIATMVLTTIANGLVPAVTSILTGKVFDLLK------DFADPNIPK---DHNLYH 70

Query: 170 FISLVGVSLLVGTAAN----YGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVG 225
            + L  +SL+   A      +  +       E     +R  ++   + +  E++D  +  
Sbjct: 71  QLVLRSMSLMALAACAFPLIWTSISTWMSFGEGQGFTVRYRMLNSYLDKSMEWYDKKE-- 128

Query: 226 DLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI-------SPQLSAFLLFLT 278
                LS D   ++R + +  +   +A       I  M+S+       S  L+  +L  T
Sbjct: 129 ----NLSGDFTQLNRCVEELRASSAEASAITLQNISSMLSLIGVSFYYSWSLTLIILCGT 184

Query: 279 PPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIR 338
           P +++ A  F R I+  +      +G    +     +  + ++    + KEI+ +     
Sbjct: 185 PLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKLSCTQLKEIESFEELTL 244

Query: 339 HIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTG 398
              +   + +   A   S    L    F+    +G+  +  G+L+I D+          G
Sbjct: 245 KCNDYFIKLSLYVAANISTLRFLSLAMFVQGFWFGNTEIRKGNLNISDVITCFSSCLMLG 304

Query: 399 SSIFGLSTFYSEIMQGAGAASRLFE--LTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYP 456
           S++   +  Y   +Q    A R  +  L D    I  +  K+   +K +I F++VSFSYP
Sbjct: 305 STL-NTTLGYLIFLQKGQVALRKIQSFLNDNKVEIDESALKQIDISKADISFRHVSFSYP 363

Query: 457 TRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS 516
           +R ++ +  ++S    +G    IVG SG GKST+++LLL+ Y+   G I +    I ++ 
Sbjct: 364 SRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKLYDEYDGYISIGSTHIREID 423

Query: 517 SKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-----TQDEVRSITKKCFCHNFITKF 571
            + L +++++V+Q   L + T+ +NI  G  ++       Q +++   K     + I   
Sbjct: 424 QQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQKKLKEAIKMACLESVIDSL 483

Query: 572 PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKL 631
            N  DTILG  G  LSGGQ+QR+A+ARA ++   +LILDEA SALD+     +     K 
Sbjct: 484 SNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEAVSALDIVHREQLMSNITKW 543

Query: 632 MKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKL-----LH 686
            + +  T I + H LS I   + + V+  +G + E G   +L  DP S   ++     +H
Sbjct: 544 RQGR--TTIILTHELSQISIQDYLYVV-EEGRIIESGFQGQLMYDPDSAFCRMNILQNVH 600

Query: 687 EKATRSERQQN-TAEDQ 702
           +K   ++R  + T ED+
Sbjct: 601 DKYENNDRFSSVTLEDE 617

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  200 bits (508), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 190/641 (29%), Positives = 299/641 (46%), Gaps = 64/641 (9%)

Query: 99  LSDLKRLARLAKRDW-------KL-LLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSN 150
           +S+LK L  L    W       KL ++ A+ LL  + L+ + +P     V+D +     N
Sbjct: 82  MSELKILRNLVHYIWPKGNNKVKLRVIAALMLLIGAKLLNVQVPFFFKDVVDSM-----N 136

Query: 151 PDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKK 210
            D++   V             + + ++++   AA +G V L   L   V AR+  N I+ 
Sbjct: 137 VDWSDSTVA----------LPAAIALTVICYGAARFGSV-LFGELRNAVFARVAQNAIRT 185

Query: 211 TMHQDAEFFDNNKVGDLISRLSSDAYVVSRSL---TQKVSDGFKAMLCGSVGIGMMISI- 266
                 E F +    DL   LS     ++R++   T+ +S    AM+   + I   IS+ 
Sbjct: 186 V---SLETFKHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHILPITFEISVV 242

Query: 267 ----SPQLSAFLLFLTPPVMLSASYFGRLIRNNS----RDLQEATGSLTKVAEEQFSGIK 318
               + Q  A    +T   ML  S F   +        RD  +A      VA +     +
Sbjct: 243 CGILTYQFGASFAGITFATMLLYSIFTIKVTAWRTAFRRDANKADNKAASVALDSLINFE 302

Query: 319 TVQSFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYG 373
            V+ F  E     +Y++++         + +  AF+NA + F  T+ L  M ++     G
Sbjct: 303 AVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNAGQNFIFTSALSAMMYM-----G 357

Query: 374 SYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISP 433
              V+ G L++GDL             +  L + Y E+ Q       LF L +    I  
Sbjct: 358 CTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFNLRNNKIKIHN 417

Query: 434 TLGKKFVP-NKG--EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTI 490
                 +P N G  EI+F+NV+F Y TR   +I +N SF I AG    IVGPSG GKSTI
Sbjct: 418 NDKPLMLPENAGPFEIKFENVTFGYDTR--RKILRNASFTIPAGVKTAIVGPSGSGKSTI 475

Query: 491 ASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP 550
             L+ R+Y+P +G++ V+G+D+ +    S R+ + +V Q+  L + TI +N+ +G ++  
Sbjct: 476 LKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVPQDTPLFNDTIWENVKFGRID-A 534

Query: 551 TQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
           T DEV +  +K      I K P    TI+G  G ++SGG+KQR+AIAR L+K   I+  D
Sbjct: 535 TDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISGGEKQRLAIARVLLKNSQIMFFD 594

Query: 611 EATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670
           EATSALD  +E ++  T  +     S T + +AHRL TI  ++ ++VL  +G V E G  
Sbjct: 595 EATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRTIADADKILVL-EEGCVREEGSH 653

Query: 671 KELYADPGSELSKLLHEKATRSERQQN-TAEDQEIDPEETI 710
            EL + P S   +L        + Q+N    DQEI  E  +
Sbjct: 654 TELLSRPNSLYKQLW-------DIQENLDVIDQEIKQERQL 687

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  199 bits (505), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 168/525 (32%), Positives = 253/525 (48%), Gaps = 39/525 (7%)

Query: 174 VGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSS 233
           + +++L    A +G V L   L   V A++  N I+       E F +    DL   L+ 
Sbjct: 144 IAMTVLSYGVARFGAV-LFGELRNAVFAKVAQNAIRTV---SLETFKHLMKLDLGWHLTR 199

Query: 234 DAYVVSRSL---TQKVSDGFKAMLCGSVGIGMMISI-----SPQLSAFLLFLTPPVMLSA 285
               ++R++   T+ +S    AM+   + I   IS+     + Q  A    +T   M+  
Sbjct: 200 QTGGMTRAMDRGTKGISYVLSAMVFHIIPISFEISVVCGILTHQFGAQFAGITFLTMMLY 259

Query: 286 SYFGRLIRNNS------RDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRH 339
           S F   IR  +      R    A      +A +     + V+ F  E     +YN+A+  
Sbjct: 260 SIF--TIRTTAWRTEFRRSANRADNKGASIALDSLINFEAVKYFNNESYLASKYNNALMT 317

Query: 340 I----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYT 394
                  V +  AF+N+ +    T+ L  M ++     G   +L G+L++GDL       
Sbjct: 318 YRDAQIKVSQSLAFLNSGQNLIFTSALTAMMYM-----GCTGILGGNLTVGDLVLINQLV 372

Query: 395 EYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKG---EIEFKNV 451
                 +  L + Y E+ Q       LF+L      I      K +P  G   EI F+NV
Sbjct: 373 FQLSVPLNFLGSVYRELKQSLIDMESLFKLRRNEVVIKNVEQPKMLPADGKPFEIRFENV 432

Query: 452 SFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQ 510
           +F Y P R    I KN SF I AG  + IVGPSG GKSTI  L+ R+Y+P  G+I ++G 
Sbjct: 433 TFGYEPDRT---ILKNASFVIAAGKKIAIVGPSGSGKSTILKLVFRFYDPQEGRILINGI 489

Query: 511 DISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITK 570
           D+ ++   SLR+ + +V Q+  L + TI +N+ +G ++  T +EV +  +K      I+K
Sbjct: 490 DVKEIDLDSLRKVIGVVPQDTPLFNDTIWENVRFGRID-ATDEEVWAAVEKAHLSPLISK 548

Query: 571 FPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGK 630
                DTI+G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E  +  T   
Sbjct: 549 LSRGTDTIVGERGLMISGGEKQRLAIARVLLKNADIMFFDEATSALDTHTEQNLLKTIRA 608

Query: 631 LMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
             K+ S T I IAHRL TI  ++ +IVL  DGSV E G   EL A
Sbjct: 609 NFKTGSKTSIYIAHRLRTIADADKIIVL-EDGSVKEEGTHTELLA 652

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  197 bits (500), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 194/661 (29%), Positives = 304/661 (45%), Gaps = 78/661 (11%)

Query: 61  SNTIARLLLNIPSKRFNSTNTKEQESSTHTDGSNDKFE------LSDLKRLARLAKRDW- 113
           S T    + +IPS   +    K + S+T    + DK E      +S+LK +  L K  W 
Sbjct: 59  SKTANEKITSIPSSLIDGDAGKVKLSTTAVPPAADKPENNKTPTISELKIMKELFKYLWP 118

Query: 114 ------KL-LLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLN 166
                 KL ++ A+SLL  + L+ + +P      +D +     N D++   V   A    
Sbjct: 119 KGEKNVKLRVIIAVSLLIGAKLLNVQVPFFFKDTVDSM-----NVDWSDSTVALPA---- 169

Query: 167 LYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGD 226
                  + ++++   AA +G V L   L   + A++  N IK    Q    FD+    D
Sbjct: 170 ------AIALTIISYGAARFGAV-LFGELRNAIFAKVAQNTIKTISLQT---FDHLMKLD 219

Query: 227 LISRLSSDAYVVSRSL---TQKVSDGFKAMLCGSVGIGMMISI-----SPQLSAFLLFLT 278
           L   LS     ++R++   T+ +S    AM+   + I   IS+     + Q  A    +T
Sbjct: 220 LGWHLSRQTGGLTRAMDRGTKGISYVLTAMIFHIIPITFEISVVCGILTYQFGASFAGIT 279

Query: 279 PPVMLSASYFGRLIRNNS------RDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKR 332
              ML    F   +R  +      R   +A      +A +     + V+ F  EQ    +
Sbjct: 280 FTTMLLYGIF--TLRTTAWRTKFRRQANKADNKGASIALDSLINFEAVKYFNNEQYLASK 337

Query: 333 YNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDL 387
           YN +++        V +  AF+N+ +    T+ L  M ++     G   +L G+LS+GDL
Sbjct: 338 YNTSLKSYTEAQVKVAQSLAFLNSGQNLIFTSALTAMMYM-----GCTGILGGNLSVGDL 392

Query: 388 TAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL--------TDRIPSISPTLGKKF 439
                        +  L + Y ++ Q       LF+L         ++ P+I       F
Sbjct: 393 VLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLRKNEVKILNNKNPAILSLKDGPF 452

Query: 440 VPNKGEIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYY 498
                 IEFKNV+F Y P R   +I +N SF I AG    +VGPSG GKSTI  L+ R+Y
Sbjct: 453 -----NIEFKNVTFGYDPNR---KILRNASFIIPAGVKTAVVGPSGSGKSTILKLVFRFY 504

Query: 499 NPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSI 558
           +P  G++ V+G D+      SLRR + +V Q+  L + TI +N+ +G V   T +++ + 
Sbjct: 505 DPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTPLFNDTIWENVKFGDVT-ATDEQILNA 563

Query: 559 TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +K      I K P  Y+TI+G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD 
Sbjct: 564 VEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQRLAIARVLLKNAPIMFFDEATSALDT 623

Query: 619 ESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPG 678
            +E  +  T        S T + IAHRL T+  S+ +IVL  +GS+ E G    L + P 
Sbjct: 624 HTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADSDKIIVL-KEGSIFEEGTHLGLLSKPN 682

Query: 679 S 679
           S
Sbjct: 683 S 683

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  196 bits (499), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 132/398 (33%), Positives = 204/398 (51%), Gaps = 18/398 (4%)

Query: 297 RDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA 352
           RD   A      VA +     + V+ F  E+    +Y+ ++         V +  AF+N+
Sbjct: 293 RDANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFLNS 352

Query: 353 -KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEI 411
            +    T+ L  + ++         V+ GSL++GDL             +  L + Y E+
Sbjct: 353 GQNLIFTSALTAVMYMACSG-----VMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYREL 407

Query: 412 MQGAGAASRLFELTDRIPSISPTLGKKFVPNK--GEIEFKNVSFSY-PTRASNQIFKNLS 468
            Q       LF L     +I   L  + +P K   +I F+NV+F Y P R   +I KN +
Sbjct: 408 KQSLIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYDPER---KILKNAT 464

Query: 469 FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQ 528
           F I AG    IVGPSG GKSTI  L+ R+Y P  G+I +DG+DI +V   SLR+ + +V 
Sbjct: 465 FTIPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVP 524

Query: 529 QEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSG 588
           Q+  L + TI +N+ +G ++   +D   +I +       I   P   +TI+G  G ++SG
Sbjct: 525 QDTPLFNDTIWENVKFGRIDASDKDITNAIERAQLT-KLIQNLPKGINTIVGERGLMISG 583

Query: 589 GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLST 648
           G+KQR+AI+R L+K   ++  DEATSALD  +E ++  T  +  + +S T + IAHRL T
Sbjct: 584 GEKQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRT 643

Query: 649 IRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
           I  ++ +IVL N+  V E G  K L   PGS  S+L +
Sbjct: 644 IADADKIIVL-NNSRVHEEGDHKTLLKTPGSLYSELWN 680

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  196 bits (499), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 178/569 (31%), Positives = 266/569 (46%), Gaps = 50/569 (8%)

Query: 144 LKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARL 203
            KQ + + +    D P IA  +++   I   GV       A +G V L   L   V A++
Sbjct: 163 FKQTIDSMNIEWSD-PTIALPMSICLTIFSYGV-------ARFGAV-LFGELRNAVFAKV 213

Query: 204 RANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSL---TQKVSDGFKAMLCGSVGI 260
             N I+       E F +    DL   L      ++R++   T+ +S    AML   + I
Sbjct: 214 AQNAIRTV---SLETFQHLMKLDLGWHLKRQTGGLTRAMDRGTKGISYVLSAMLFHIIPI 270

Query: 261 GMMISI-----SPQLSAFLLFLTPPVMLSASYFGRLIRNNS------RDLQEATGSLTKV 309
           G  IS+     + Q  A    +T   ML  S F   IR  +      RD  +A      V
Sbjct: 271 GFEISVVCGILTYQFGASFAGITFTTMLLYSIFT--IRTTAWRTQFRRDANKADNKGASV 328

Query: 310 AEEQFSGIKTVQSFVAEQKEIKRYNHAIRH----IFNVGKQSAFINA-KFFSLTAVLGDM 364
           A +     + V+ F  E     +Y+ ++         V +  AF+N+ +    T+ L  M
Sbjct: 329 ALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQSLAFLNSGQNLIFTSALTMM 388

Query: 365 SFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL 424
            +L     G   V+ G+L++GDL             +  L + Y E+ Q       LF+L
Sbjct: 389 MYL-----GCTGVIEGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQL 443

Query: 425 TDRIPSI-------SPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNV 477
                 I       +P + K       EI+F+NV+F Y T  + +I KN SF I AG   
Sbjct: 444 RKNPIKIQNAKTGPAPIMLKS-SDGPFEIKFENVTFGYDT--NRKILKNASFIIPAGLKT 500

Query: 478 CIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGT 537
            +VGPSG GKSTI  L+ R+Y+P  G++ ++G ++ +    SLRR M +V Q+  L + T
Sbjct: 501 AVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLRRVMGVVPQDTPLFNDT 560

Query: 538 IRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIA 597
           I +N+ +G +     +E++ + +K      I K P    TI+G  G ++SGG+KQR+AIA
Sbjct: 561 IWENVKFGRIN-ANDEEIKQVIEKAQLAPLIEKLPQREKTIVGERGLMISGGEKQRLAIA 619

Query: 598 RALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIV 657
           R L+K   I+  DEATSALD  +E A+  T      S + T I IAHRL TI  ++ +IV
Sbjct: 620 RVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIYIAHRLRTIADADKIIV 679

Query: 658 LGNDGSVAEVGKFKELYADPGSELSKLLH 686
           L  DG V E G   EL A  GS  S L +
Sbjct: 680 L-EDGKVKEEGSHNELLATKGSLYSNLWN 707

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  199 bits (507), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 165/520 (31%), Positives = 256/520 (49%), Gaps = 40/520 (7%)

Query: 192  LRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVGDLISRLSSDAYVVSRSLTQKVSDG 249
            L  +SE  +  LR   ++   +++ E+F  D NK  +L + + +D     R L   +S+ 
Sbjct: 769  LGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDL----RDLRSLISEF 824

Query: 250  FKAM----LCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGS 305
              AM    +    G+   ++   +LS   + + P ++L ++ +G +++      +     
Sbjct: 825  ISAMSTFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVAD 884

Query: 306  LTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMS 365
            L     E   GIKT++    EQ  I+RY+     + ++G++ A       ++T  L    
Sbjct: 885  LENCVYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCI 944

Query: 366  FLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQ------GAGAAS 419
              ++  YG  LV      IG+ T   M+  +T   +F + T  S I Q      G  AAS
Sbjct: 945  EAILFYYGLKLVF-----IGEYTTMKMFKTFT-LLLFTIMTCTSLINQIPDVTRGQRAAS 998

Query: 420  RLFEL---TDRIPSISPTLGK-KFVPN----KGEIEFKNVSFSYPTRASNQIFKNLSFKI 471
            R+F +   +DR    S   G+ + +P     K  I   N+ F YP+  S+ +F  L+ +I
Sbjct: 999  RIFRILDESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQI 1058

Query: 472  DAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEP 531
                 V +V  SG GKST+  LL R Y      IF+DG DI++    SLR  ++IV+Q+P
Sbjct: 1059 ADNQTVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKP 1118

Query: 532  VLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQK 591
             L  G+IR N+ YG   +    ++  + K+    +F+T  PN  DT      +LLSGGQ 
Sbjct: 1119 TLFEGSIRKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDT--NVDTSLLSGGQA 1176

Query: 592  QRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKS--KSITIISIAHRLSTI 649
            QRI IARAL++K  ILILDE TSALD ES     +    L+KS    +  I+I H    +
Sbjct: 1177 QRICIARALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMM 1232

Query: 650  RRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKA 689
            R   NVIVL  DG  A+ G F ELY  PG+EL +++   A
Sbjct: 1233 RACGNVIVL-QDGETAQQGTFDELY-KPGNELHRIVIAHA 1270

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 141/523 (26%), Positives = 243/523 (46%), Gaps = 52/523 (9%)

Query: 202 RLRANVIKKTMHQDAEFFDNNK--VGDLISRLSSDAYVVSRS-----LTQKVSDGFKAML 254
           R+R  ++   + +  E+FD N   +GD +        V S S     +T +      A++
Sbjct: 103 RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAEASAITFQNFVAIIALV 162

Query: 255 CGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQF 314
           C S         S  L+  +L  +P +++ A++F R+I N ++   + TG   +      
Sbjct: 163 CTS------FYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLTWSM 216

Query: 315 SGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFF-----SLTAVLGDMSFLVV 369
           +  + V+ +  +  EIK++   +     +     FINA F+     S+   L    F+  
Sbjct: 217 NAAQLVKLYCTQDFEIKKFKEIV-----IRCNDYFINAWFYVSANTSILRFLSLAMFVQG 271

Query: 370 LAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFG--LSTFYSEIMQ------GAGAASRL 421
             +GS ++    +S+  +      T ++   + G  L+T   +I+       G       
Sbjct: 272 FWFGSTMIKKNKMSVDQVI-----TCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQDF 326

Query: 422 FE-----LTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSN 476
            E      TDR    S  L    VP    I F  +SF YP+R  + + KN+S   D    
Sbjct: 327 LEDKSEMATDRDRQTSINLDN--VPIS--ISFDAISFCYPSRPDDMVLKNISMNFDPNKT 382

Query: 477 VCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSG 536
             IVG SG GKST+++LLL++YN   G I V+G ++  +    + +++++V+Q+  L + 
Sbjct: 383 TFIVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFND 442

Query: 537 TIRDNITYGLVEKPTQDEVRS-ITKKC---FCHNFITKFPNSYDTILGPHGTLLSGGQKQ 592
           T+R+N+  GL      ++V S + + C      N I K P+  DT +G  G  LSGGQ+Q
Sbjct: 443 TLRNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQ 502

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRS 652
           R+A+ARA ++   ++ILDEA SALD  +   +        +SK  T I + H L+ I  S
Sbjct: 503 RVALARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSK--TAIILTHELNQILPS 560

Query: 653 ENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQ 695
           + + ++ N G + E G   EL  +  S   K  H + +  E +
Sbjct: 561 DFLYLMEN-GQIKEEGYQNELIENVESTFCKFFHLQNSNRESE 602

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  195 bits (496), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 169/558 (30%), Positives = 263/558 (47%), Gaps = 43/558 (7%)

Query: 154 TVDDV------PEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANV 207
           TVDD+      P IA         + +G++++      +G V+   V    V A++  N 
Sbjct: 155 TVDDMNVDWSDPTIALP-------AAIGLTIICYGLTRFGAVLFGEV-RNAVFAKVAQNA 206

Query: 208 IKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI- 266
           I+K   Q  +      +G  +SR +          T+ +S    AM+   V I   IS+ 
Sbjct: 207 IQKISLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLNAMVFHIVPITFEISVV 266

Query: 267 ----SPQLSAFLLFLTPPVMLSASYFG---RLIRNN-SRDLQEATGSLTKVAEEQFSGIK 318
               + Q  A    +T   ML  S F       R    R   +A      +A +     +
Sbjct: 267 CGILTYQFGASFAAITFTTMLLYSIFTFKTTAWRTKFRRQANKADNKGASIALDSLINFE 326

Query: 319 TVQSFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYG 373
            V+ F  E+   ++Y+  +         V +  AF+N+ +    T+ L  M ++     G
Sbjct: 327 AVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQSLAFLNSGQNLIFTSALTVMMYM-----G 381

Query: 374 SYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISP 433
              ++ G+L++GDL             +  L + Y E+ Q       LF+L    P I  
Sbjct: 382 CTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQLKKN-PIIIK 440

Query: 434 TLGKKF-VPNKGE----IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKS 488
            + K   +  KG     I F+NV+F Y  +   +I KN SF+I++G    IVGPSG GKS
Sbjct: 441 NVEKPLMLAEKGHMPMTIRFENVTFGYDKQ--RKILKNASFQIESGQKTAIVGPSGSGKS 498

Query: 489 TIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVE 548
           TI  LL R+Y+P  G+I V+G D  +    SLR+ + +V Q+  L + TI +N+ +G + 
Sbjct: 499 TILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTIWENVRFGRI- 557

Query: 549 KPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI 608
             + DE+  +  K      + K P   +TI+G  G ++SGG+KQR+AIAR L+K   I+ 
Sbjct: 558 GASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLAIARVLLKDADIMF 617

Query: 609 LDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
            DEATSALD  +E A+  T  +  K  S T + IAHRL TI  ++ +IVL  +G+V E G
Sbjct: 618 FDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKIIVL-QEGTVREEG 676

Query: 669 KFKELYADPGSELSKLLH 686
           K  EL A  GS   +L +
Sbjct: 677 KHSELLARSGSLYKELWN 694

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  198 bits (504), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 151/524 (28%), Positives = 260/524 (49%), Gaps = 32/524 (6%)

Query: 178  LLVGTAA-----NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVGDLISR 230
            L++G AA     N+ +  LL   SE  V  LR  V++K   ++ ++F  +NNK  ++ + 
Sbjct: 765  LVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISAL 824

Query: 231  LSSDAYVVSRSLTQKVSDGFKAML----CGSVGIGMMISISPQLSAFLLFLTPPVMLSAS 286
            + +D     R L   VS+   AM       ++G+   +    +LS   + + P +++ ++
Sbjct: 825  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSA 880

Query: 287  YFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQ 346
             +G +++    D + +   L     +  + IKT++   AE      Y+     +  +  +
Sbjct: 881  IYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASK 940

Query: 347  SAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLST 406
             A       S+T ++      ++  YG  LV+    +  ++        +T  S   L +
Sbjct: 941  RAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVS 1000

Query: 407  FYSEIMQGAGAASRLFELTDRIPSI-------SPTLGKKFVPNKGE-----IEFKNVSFS 454
               +I +G  AAS ++ + D   +        + T+G       G+     +  +N++F+
Sbjct: 1001 QIPDISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFA 1060

Query: 455  YPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISK 514
            YP+  +  ++KN++F +  G  + I+G SG GKST+  LL + YN   G+I +DG D++ 
Sbjct: 1061 YPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVND 1120

Query: 515  VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS 574
             +  SLR+ +S+V+Q+P+L +GTIRDN+TYGL ++  + E+    K    H+F+   P  
Sbjct: 1121 WNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQG 1180

Query: 575  YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKS 634
             DT +    TLLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN    K    
Sbjct: 1181 LDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKK--GP 1236

Query: 635  KSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPG 678
             ++  + I H    +R   ++ VL  DG V E G F  LY + G
Sbjct: 1237 PALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNNRG 1279

 Score =  191 bits (484), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 154/552 (27%), Positives = 263/552 (47%), Gaps = 40/552 (7%)

Query: 195 LSERVVARLRANVIKKTMHQD-AEFFDNNK--VGDLISRLSSDAYVVSRSLTQKVSDGFK 251
           + ER   R+R+ +++  + +   E++DNN+  +GD  ++++     +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 252 AMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAE 311
            ++     +G     S  L+  +L  +P +   A  F R+I   S      T    ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 312 EQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVV-- 369
              +  + V+ +  ++ E K++   I     +   + FI + FF + A  G + FL +  
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEII-----LNCNTFFIKSCFF-VAANAGILRFLTLTM 271

Query: 370 ----LAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL- 424
                 +GS ++  G L+I D+          GS++         + +G  A  ++  L 
Sbjct: 272 FVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLL 331

Query: 425 ---TDRIPSISPTLGKKFVPNKG--EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCI 479
              + R P ++ T+  +F  +    ++ F NVSFSYP+R S  + KN+S    AG    I
Sbjct: 332 KDGSKRNP-LNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFI 390

Query: 480 VGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIR 539
           VG SG GKST+++LLLR+Y+   G I ++G +I  +  K L  ++++V+Q   L + T+R
Sbjct: 391 VGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLR 450

Query: 540 DNITYGLVEK-----PTQDEVRSITKKCFCH-----NFITKFPNSYDTILGPHGTLLSGG 589
            NI  G  +       + +E R + K   C       FI   P+  +T++G  G  LSGG
Sbjct: 451 KNILLGSTDSVRNADCSTNENRHLIKDA-CQMALLDRFILDLPDGLETLIGTGGVTLSGG 509

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTI 649
           Q+QR+AIARA I+   IL LDEA SALD+     +        K K  T I + H LS I
Sbjct: 510 QQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQI 567

Query: 650 RRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQ---QNTAEDQEIDP 706
             S++ + L  +G V E G   EL ADP +  S   H +   S+ +       E++ I  
Sbjct: 568 -ESDDYLYLMKEGEVVESGTQSELLADPTTTFSTWYHLQNDYSDAKTIVDTETEEKSIHT 626

Query: 707 EETINIENSTPE 718
            E+ N +  TP+
Sbjct: 627 VESFNSQLETPK 638

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  198 bits (504), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 152/499 (30%), Positives = 241/499 (48%), Gaps = 21/499 (4%)

Query: 191  LLRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVGDLISRLSSDAYVVSRSLTQKVSD 248
             L   SE  +  LR   I+K   QD  +F  D NK  ++ + + +D   +   +++ +S 
Sbjct: 813  FLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVSEFLSS 872

Query: 249  GFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTK 308
                ++  SVGI        +LS   + L P  +L + ++G L++    D +     L  
Sbjct: 873  ISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELEN 932

Query: 309  VAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLV 368
               E F GI T++    E + +++Y +  + +    K+ A       + +  L      +
Sbjct: 933  QLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTLTLAVQAI 992

Query: 369  VLAYGSYLVLHGSLS---IGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT 425
            +  YG  LV  GS S   + +    +++T  T  S+ G      +I +G  AA+ +F + 
Sbjct: 993  LFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATYIFRII 1049

Query: 426  DRIPSISPTLGKKFVPNKGE----IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVG 481
            D     +    KK    K      I  KN+SFSYP+  S  I+K L   + +G  + +VG
Sbjct: 1050 DNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGETIAVVG 1109

Query: 482  PSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN 541
             SG GKST+  L+   Y    G I +DG DI++  +  LR  +S+V+Q+P    GT+ +N
Sbjct: 1110 ESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGEN 1169

Query: 542  ITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALI 601
            + YG+  + TQ +V+         +F+   P   DT +    +L+SGGQ QR++IARA++
Sbjct: 1170 LLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLSIARAML 1227

Query: 602  KKPTILILDEATSALDVESEGAINYTFGKLMKSK--SITIISIAHRLSTIRRSENVIVLG 659
            +KP IL LDE TSALD  +  AI      L+K     IT I I H    +R  E + VL 
Sbjct: 1228 RKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACERIAVLQ 1283

Query: 660  NDGSVAEVGKFKELYADPG 678
            N G VAE G F +LYA  G
Sbjct: 1284 N-GKVAEDGSFDDLYAQRG 1301

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 129/469 (27%), Positives = 214/469 (45%), Gaps = 33/469 (7%)

Query: 267 SPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAE 326
           S  L+  ++   P +++ +    +LI   +R     +    ++    F   + ++ F  +
Sbjct: 177 SWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQ 236

Query: 327 QKEIKRYNHAIRHI------FNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHG 380
           Q EI+++  +++         ++   +++   +FF+L        F+    +G+ ++  G
Sbjct: 237 QFEIEKFELSVKKCTKYFIRISLFSSASYAMLRFFTLCM------FIQGFWFGNKMIRQG 290

Query: 381 SLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT----DRIPSISPTLG 436
            L+ GD+          G+++         + +G  A  ++   T    D     +  + 
Sbjct: 291 VLTTGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIIS 350

Query: 437 KKFVPNK---------GEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGK 487
             F+ N          GEI FKNVSFSYPTR +  + KN+S          IVG SG GK
Sbjct: 351 DAFILNHINANKFRCGGEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGK 410

Query: 488 STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLV 547
           STI  LLL+ Y   TG I VDG DI  + +  L  ++++V+Q   L + TI++NI  G  
Sbjct: 411 STIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCK 470

Query: 548 EKPTQDE-VRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTI 606
            K   D  VR   +       I   PN  DT+LG  G  LSGGQKQR+A+ARA ++   I
Sbjct: 471 GKAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPI 530

Query: 607 LILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
           LILDEA S +D+     +     K    K +T + + H L+ I   E+ +    +G + E
Sbjct: 531 LILDEAISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRE 587

Query: 667 VGKFKELYADPGSELSKL--LHEKATRSERQQNTAEDQEIDPE--ETIN 711
            G    L  +  S  ++L  L +  T   R+  +  + E  PE  E +N
Sbjct: 588 SGFKCNLEKNENSHFNRLWRLQKAKTGFSRRSVSTSNLEKFPENAEVVN 636

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  194 bits (494), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 192/647 (29%), Positives = 307/647 (47%), Gaps = 60/647 (9%)

Query: 72  PSK---RFNSTNTKEQESSTHTDGSNDKF-ELSDLKRLARLAKRDW-----KLLLTAISL 122
           P+K   + N+   KEQ ++  +  S  K   +S+LK +  L K  W     K+ +  I  
Sbjct: 68  PAKTNLKVNNNTIKEQTAAKVSKQSGPKAPTISELKIMKDLLKYIWPKGDNKVKIRVI-- 125

Query: 123 LSVSCLIGMSLPKIIGI-VLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVG 181
           L++  LIG    K++ I V    KQI+ + +    D P +A         + +G++++  
Sbjct: 126 LALMLLIG---AKVLNIQVPFYFKQIIDSMNVEWSD-PTVALP-------AAIGLTIITY 174

Query: 182 TAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRS 241
             + +G V L   L   V A++  + I   M+   + F +    DL   LS     ++R+
Sbjct: 175 GVSRFGAV-LFGELRNAVFAKVAQSAI---MNISLQTFKHLMKLDLGWHLSRQTGGLTRA 230

Query: 242 L---TQKVSDGFKAMLCGSVGIGMMIS-----ISPQLSAFLLFLTPPVMLSASYFGRLIR 293
           +   T+ +S    AM+   + I   IS     ++ Q  A    +T   ML  + F   IR
Sbjct: 231 MDRGTKGISYVLGAMIFHIIPITFEISMVCGILTYQFGASFAGITFTTMLLYAIF--TIR 288

Query: 294 NNS------RDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFN----V 343
             +      R    A      +A +     + V+ F  EQ    +Y  ++    N    V
Sbjct: 289 TTAWRTEFRRAANRADNKGASIALDSLINFEAVKYFNNEQYLANKYYSSLVDYRNSQVKV 348

Query: 344 GKQSAFINA-KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIF 402
            +  AF+N+ +    T+ L  + +L     G   V+ G+L++GDL             + 
Sbjct: 349 AQSLAFLNSGQNLIFTSALTAIMYL-----GCTGVIGGNLTVGDLVLINQLVFQLSVPLN 403

Query: 403 GLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNK---GEIEFKNVSFSYPTRA 459
            L + Y E+ Q       LF+L      I        +PN+    EI+F+NV+F Y    
Sbjct: 404 FLGSVYRELKQSLIDMESLFKLRKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYD--K 461

Query: 460 SNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKS 519
             +I KN SF I AG    +VGPSG GKSTI  L+ R+Y+P  G+I ++G DI ++   S
Sbjct: 462 ERKILKNASFTIPAGWKTAVVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLAS 521

Query: 520 LRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTIL 579
           LR+ + +V Q+  L + TI +N+ +G +E  T +E+    +K      I K P   +TI+
Sbjct: 522 LRKVIGVVPQDTPLFNDTIWENVKFGRIE-ATDNEILQAIEKAQLAPLIKKLPKGRETIV 580

Query: 580 GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITI 639
           G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +     S T 
Sbjct: 581 GERGLMISGGEKQRLAIARVLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTS 640

Query: 640 ISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
           + IAHRL TI  ++ +IVL  DG V E G  ++L A   S  S+L +
Sbjct: 641 VYIAHRLRTIADADKIIVL-KDGQVEEEGTHRQLIAKKESLYSELWN 686

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  196 bits (497), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 146/514 (28%), Positives = 252/514 (49%), Gaps = 19/514 (3%)

Query: 172  SLVGVSLLVGTAA-NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISR 230
            SL+ + + +  A  N+ +  L    SE  + +LR  V+++   ++ ++F   +     S 
Sbjct: 736  SLIVIGVAIADAILNFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRER--HKASE 793

Query: 231  LSSDAYVVSRSLTQKVSDGF----KAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSAS 286
            +S+      R L    SD         +  SVGI   + I  +LS   + + P +++ ++
Sbjct: 794  VSALLLNDLRDLRALASDFLIAVSSFAVVSSVGIIWALIIGWKLSLVCISMFPLIVIFSA 853

Query: 287  YFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQ 346
             +G  ++      + A   L  +  E  +GIKT++    E   +++Y     H+  +  +
Sbjct: 854  VYGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASR 913

Query: 347  SAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLST 406
             A       ++   L      ++  Y   LV+ G  +   +   +    +T  +   L +
Sbjct: 914  RAITTGLGVAVIEALAMSIQAILFYYALKLVIDGQYTTKKMFETLTLLLFTIMTCNILIS 973

Query: 407  FYSEIMQGAGAASRLFELTD-RIPSISPTLGKK------FVPNKGEIEFKNVSFSYPTRA 459
               +I +G  AA+R+ ++ D ++    P   KK         +   I  +NV+F+YP+  
Sbjct: 974  QVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQNVTFAYPSAP 1033

Query: 460  SNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKS 519
            S  IF +L  ++  G    +VG SG GKST+ +LL + Y PT+G + V+ +D+++ + + 
Sbjct: 1034 SIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDVNEWNIRD 1093

Query: 520  LRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTIL 579
            LRR MS+V+Q P + SGT+R+N+ YGL   P + E+  + +    H+FI+K P   DT +
Sbjct: 1094 LRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLPLGLDTTI 1153

Query: 580  GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITI 639
                 LLSGGQ QR+ IARA++K+P ILILDE TSALD  S   IN    +     +   
Sbjct: 1154 DID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINNIVRR--GCPAPLT 1209

Query: 640  ISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
            ISI H +  ++  + +I L N G VA  G F  L
Sbjct: 1210 ISITHNVDMMKACDEIIFLKN-GRVAGTGSFDAL 1242

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 147/512 (28%), Positives = 245/512 (47%), Gaps = 33/512 (6%)

Query: 194 VLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVV--SRSLTQKVSDGFK 251
           +L ER    +R  ++ K +    E++D  K  D+    +     V  +R+   + S    
Sbjct: 84  LLGERCGFGIRRRLLYKYLENPFEWYD--KTEDICGNFTQQNRCVEEARASCAEASAVIT 141

Query: 252 AMLCGSVG-IGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA 310
             L   +  IG     S  L+   L   P +++   +F R ++  +    E T   +++ 
Sbjct: 142 RSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLL 201

Query: 311 EEQFSGIKTVQSFVAEQKEIKRYNHAIRHI---FNVGKQSAFINA---KFFSLTAVLGDM 364
           +   +  + ++    E +EIK + + +++    F    Q + IN    KF SL       
Sbjct: 202 DWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLSLAM----- 256

Query: 365 SFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFE- 423
            F+    +GS ++  G ++IGD+          GS+I G       I +G+ A + + + 
Sbjct: 257 -FVQAFWFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKF 315

Query: 424 LTDRIPSISPTLGKKFVPN---KGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIV 480
           L D   + +     + VP    KG+I F+NV FSYP+R  + + +++S    AG    ++
Sbjct: 316 LADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLL 375

Query: 481 GPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRD 540
           G SG GKS++++LLL++Y   TG I VDG++I  +    L +++++V+Q   + +GT+++
Sbjct: 376 GKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKE 435

Query: 541 NITYGLVEKPTQDEVRSITK-KCFC-----HNFITKFPNSYDTILGPHGTLLSGGQKQRI 594
           NI  G+      DE   +TK K  C      NFI    +  +T++G  G  LSGGQ+Q++
Sbjct: 436 NIIIGI---DGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKV 492

Query: 595 AIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSEN 654
           AIARAL+K P ILILDE+ SALDV   G I        K K  T I + H L+ I  S +
Sbjct: 493 AIARALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEK--TTIILTHELNQI-GSND 549

Query: 655 VIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
              L   G   E G  + L  DP +      H
Sbjct: 550 FCYLIESGQCIEHGLEETLVNDPSTRFHSWKH 581

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  192 bits (487), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 162/554 (29%), Positives = 260/554 (46%), Gaps = 32/554 (5%)

Query: 174 VGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSS 233
           +G++++    A +G  +L   L   + AR+  N I+    Q  E      +G  +SR + 
Sbjct: 182 LGLTIMCYGLARFG-AVLFGELRNAIFARVAQNAIRNVSLQTFEHLMKLDLGWHLSRQTG 240

Query: 234 DAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI-----SPQLSAFLLFLTPPVMLSASYF 288
                    T+ +S    AM+   + I   IS+     + Q  A    +T   ML  S F
Sbjct: 241 GLTRAMDRGTKGISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLYSIF 300

Query: 289 G-RLIRNNSRDLQEATGSLTK---VAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI---- 340
             R     +R  +EA  +  K   VA +     + V+ F  E     +Y++++       
Sbjct: 301 TIRTTAWRTRFRKEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQ 360

Query: 341 FNVGKQSAFINA-KFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGS 399
             V +  AF+N+ +    T  L  M ++     G   V+ G L++GDL            
Sbjct: 361 VKVAQSLAFLNSGQSLIFTTALTGMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSV 415

Query: 400 SIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKG---EIEFKNVSFSYP 456
            +  L + Y E+ Q       LF+L      I      K +       EI+F+NV+F Y 
Sbjct: 416 PLNFLGSVYRELKQSLIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYD 475

Query: 457 TRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS 516
                +I KN SF I AG    I GPSG GKST+  L+ R+Y+P  G++ V+G D+ +  
Sbjct: 476 --GQRKILKNASFTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYD 533

Query: 517 SKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYD 576
              LR+ + +V Q+  L + TI +N+ +G +E  + +E+  +  K    + I K P    
Sbjct: 534 IDQLRKAIGVVPQDTPLFNDTIWENVKFGRIE-ASDEEITRVIDKAQLSDLIAKLPQGSS 592

Query: 577 TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKS 636
           TI+G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +   S  
Sbjct: 593 TIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGE 652

Query: 637 ITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQ 696
            T + IAHRL TI  ++ +IVL  +G+V E G  +EL A   S     L+++  R +   
Sbjct: 653 KTSVYIAHRLRTIADADKIIVL-EEGTVREEGTHQELLARENS-----LYKELWRIQEDL 706

Query: 697 NTAEDQEIDPEETI 710
           +  ED+    +ET+
Sbjct: 707 DLLEDEINHEKETL 720

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  193 bits (490), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 151/527 (28%), Positives = 264/527 (50%), Gaps = 25/527 (4%)

Query: 173  LVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNK--VGDLISR 230
            ++G++++ G + N+ +  LL + SE  +  LR   +K+ + +  ++F + K    ++ + 
Sbjct: 775  VIGITIIDGIS-NFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSAL 833

Query: 231  LSSDAYVVSRSLTQKVSDGFKAM----LCGSVGIGMMISISPQLSAFLLFLTPPVMLSAS 286
            + +D     R L   VS+   AM    +    G+   +    +L+   + + P +++ ++
Sbjct: 834  ILNDL----RDLRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSA 889

Query: 287  YFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQ 346
             +G +++ +  D + +  +L  +  +  S IKT++S   E      Y  A   + NV  +
Sbjct: 890  IYGAVLQKSETDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATK 949

Query: 347  SAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLST 406
             +       S+T  +      ++  YG  L++ G  ++  +        +T  +   L  
Sbjct: 950  RSIYTGLGISITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVN 1009

Query: 407  FYSEIMQGAGAASRLFEL---TDRIPSI----SPTLGKKFVPNKGEI-EFKNVSFSYPTR 458
               ++ +G  AAS ++ +   +D    +    S  +    + N   I + KN++F+Y + 
Sbjct: 1010 QIPDMSRGQRAASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYEST 1069

Query: 459  ASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSK 518
             S ++   L+ K+  G  + I G SG GK+T+ SLL+++Y+    QI+ +G+DI     +
Sbjct: 1070 PSIKVLDGLTLKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFE 1129

Query: 519  SLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTI 578
            SLR  + IV+Q+P ++SG+IRDN+        +  E+  + K     +FI   P+  DTI
Sbjct: 1130 SLRDAIVIVEQKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTI 1189

Query: 579  LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSIT 638
            +    TLLSGGQ QRI IARAL++KP ILILDE TSALD  S   IN    K +    +T
Sbjct: 1190 IDT--TLLSGGQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVT 1245

Query: 639  IISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
            IISI H  S +   +NV VL N G + EVG +  L A   S L KLL
Sbjct: 1246 IISITHSESMMTSCQNVAVLKN-GKIVEVGTYDSL-ATSSSHLGKLL 1290

 Score =  167 bits (424), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 164/632 (25%), Positives = 283/632 (44%), Gaps = 39/632 (6%)

Query: 96  KFELSDLKRLARLA-------KRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIM 148
           K ++S LK+ AR+          D+KLL     L+S+S L    +P I  I+   +  I+
Sbjct: 6   KQKISALKKKARINIYMHINFHDDYKLLF----LISLSTLANGLVPTISSILTGRIFAIL 61

Query: 149 S---NPDFTVDDVPEIAFGLNLYEFISL-VGVSLLVGTAANYGRVILLRVLSERVVARLR 204
               NP+ +   +      LN    + L VG   ++ T  +    I      ER   ++R
Sbjct: 62  KDFVNPELSKSQIHN-KLTLNTMSIMILGVGCFPIMWTCISTWMSI-----GERQGIKVR 115

Query: 205 ANVIKKTMHQDAEFFDNNKV--GDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGM 262
             ++   + Q   ++D N+   GD  ++L      +  S  +  +  F+  +     I  
Sbjct: 116 TKILNNYLTQSMTWYDLNEQLQGDF-TQLHRCVEELRSSSAEASAVTFQNCIAIIALIAT 174

Query: 263 MISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQS 322
               S  L+  +L  TP + + +  F  +I+  +      T    ++  E    I+ ++ 
Sbjct: 175 SFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSAQIFTETIQNIQLIKL 234

Query: 323 FVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSL 382
              + K++ ++  +I        Q     +   S+   L  + F+    +GS ++  G L
Sbjct: 235 NNLQLKKLMKFQTSISKCNKFFIQMCLYVSLNTSILRTLTLLMFVQGFWFGSTMIRKGHL 294

Query: 383 SIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPN 442
            I ++          GS I         + +G  A  ++ +  D                
Sbjct: 295 KIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVDFLDEADDPLEINSAPITLI 354

Query: 443 KGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTT 502
              I F+N+SF+YP+R +  I   ++      +   IVG SG GKST+++LLL++Y    
Sbjct: 355 NSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYK 414

Query: 503 GQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGL--------VEKPTQDE 554
           G I +D  +I  ++ K+L  ++ IV+Q+  L + TIR+NI +G+          +P  +E
Sbjct: 415 GDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNE 474

Query: 555 -VRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEAT 613
            +++        +F+   PN  DT++G  G  LSGGQ+QR+A+ARA ++ P ILILDEA 
Sbjct: 475 RLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRDPPILILDEAV 534

Query: 614 SALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
           SALDV     +     KL +S   TII + H L+ I   + + V+ + G + E GK KEL
Sbjct: 535 SALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GRIIEHGKRKEL 591

Query: 674 YADPGSELSKLLHEKATRSERQQNTAEDQEID 705
             DP +E  KL+   A ++    N   D E D
Sbjct: 592 ITDPNTEFHKLV---AIQNNNNLNEDFDLETD 620

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  192 bits (488), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 147/532 (27%), Positives = 270/532 (50%), Gaps = 28/532 (5%)

Query: 172  SLVGVSL-LVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD--NNKVGDLI 228
            SL+ +S+ ++     + +  ++   SE  +  LR  V++   +   E+F    NK  ++ 
Sbjct: 753  SLIVLSVAIIDAFCTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVS 812

Query: 229  SRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF 288
            +   +D   +   +T+ ++     ++  + G+   +    +LS   + + P +++ +  +
Sbjct: 813  ALALNDLRDLRTLVTEFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVY 872

Query: 289  GRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSA 348
            G  ++    D + A   L     E    +KT++    +     RY+   + + ++G++ +
Sbjct: 873  GAALQKCETDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRS 932

Query: 349  FINAKFFSLTAVLGDMSFLVVLAYGSYLVLHG---SLSIGDLTAYMMYTEYTGSSIFG-- 403
             I     ++T  L      ++  YG  LV+ G   S  + ++   +++T  T +++    
Sbjct: 933  VITGCGIAITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQI 992

Query: 404  --------LSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSY 455
                     +T+   I++ A A     ++ +R   IS T  K  +     +  K+++F+Y
Sbjct: 993  PEVTRGQRAATYIYRILKEAAATREHQDMHNRTLPISNTSEKDTM-----VLVKDLTFAY 1047

Query: 456  PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKV 515
            P   S  ++++L+  + + ++V +VG SG GKSTI SLL + Y+     I+VDG D+S+ 
Sbjct: 1048 PATPSKHVYEHLNLNLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEW 1107

Query: 516  SSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQD-EVRSITKKCFCHNFITKFPNS 574
             + SLR  +S+V+Q   L++GTIR+N+TYGL E+ T + ++  I K    ++F+++ PN 
Sbjct: 1108 DTNSLRNQISVVEQSANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNG 1167

Query: 575  YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKS 634
             DTI+     LLSGGQ QR+ IARAL+K   ILILDE TSALD  S   I     K + +
Sbjct: 1168 IDTIVDRD--LLSGGQAQRLCIARALVKPHRILILDECTSALDALSTNIIIDIVRKGIPN 1225

Query: 635  KSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
                II+I H    +R  E+V++L N G++ E G F EL     SE  K L+
Sbjct: 1226 T--LIIAITHDEHMMRSCESVLLLKN-GAIVEQGSFVEL-MQQDSEFKKCLN 1273

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 153/619 (24%), Positives = 285/619 (46%), Gaps = 76/619 (12%)

Query: 110 KRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYE 169
           ++D+KLL T ++L +++   G+ +P I  I+   +  I+SN              LN  +
Sbjct: 12  EKDYKLL-TVVTLTTIAS--GL-IPAITSILTGRVFDILSN------------ISLNDRQ 55

Query: 170 F---ISLVGVSLLVGTAANYGRVILLRV----LSERVVARLRANVIKKTMHQDAEFFDNN 222
           F   + L  +S+++  AA++  + +       L E    R+R N++   + +   ++D N
Sbjct: 56  FSHQLVLRSMSVMILGAASFPVMWIFITSWMHLGEVQGDRIRINMLGSYLSKSWTWYDGN 115

Query: 223 K---VGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTP 279
               +G+  ++LS     V +S ++  +   ++ +     IG     S  L+  +L  TP
Sbjct: 116 GKRLLGEF-TQLSRCIEEVRQSSSESAAITLQSFVSVLSLIGTSFYYSWSLTLIILCSTP 174

Query: 280 PVMLSASYFGRLIRNNSRDLQ-EATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIR 338
            +   A YF +L  N   DL+ + T    ++          V+ + A+ +EI +++ ++ 
Sbjct: 175 IITAIAIYFAKLT-NKYTDLENKETSYAAELLTWSMRFNDMVKFYTAQNEEISKFDTSVT 233

Query: 339 HIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTG 398
              ++  ++   +A   S+   L    F+    +G+ ++    L I D+           
Sbjct: 234 RCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGATMIRRNKLDINDV----------- 282

Query: 399 SSIFGLSTFYSEIMQGAGAASRLFELT---------DRIPSISPTLGKKFV------PNK 443
                ++ F+S +M GA  +  + ++T          ++       GK  +      P K
Sbjct: 283 -----ITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQAALKCPPK 337

Query: 444 GE---IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
           G    I F N+SF YP R SN   +N+S ++++G    I+G SG GKST+A LLLR+Y  
Sbjct: 338 GNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAKLLLRFYEE 397

Query: 501 TTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK-------PTQD 553
            +G I VD   I  ++ + L  ++++V+Q   L + T+R+NI  G   +         ++
Sbjct: 398 YSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEPARMESIEE 457

Query: 554 EVRSITKKC---FCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
             R + K C     +  +    +  DT++G  G  LSGGQ+QR+A+ARA ++   I+I D
Sbjct: 458 RERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLRNTPIMIFD 517

Query: 611 EATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670
           E+ SALDV     +        + K  T I + H LS I  ++ + ++ + G V E G  
Sbjct: 518 ESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-GRVCEYGYQ 574

Query: 671 KELYADPGSELSKLLHEKA 689
           ++L     S  S+    +A
Sbjct: 575 EDLLKSETSYFSRFYQHQA 593

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  188 bits (478), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 167/552 (30%), Positives = 262/552 (47%), Gaps = 45/552 (8%)

Query: 144 LKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARL 203
            KQ++ N +    D P +A           + ++++   AA +G  +L   L   V AR+
Sbjct: 127 FKQVVDNMNVEWSD-PSVALP-------GAIMLTVVCYGAARFG-AVLFGELRNAVFARV 177

Query: 204 RANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSL---TQKVSDGFKAMLCGSVGI 260
             N I+       E F +    DL   LS     ++R++   T+ +S    AM+   + I
Sbjct: 178 GQNAIRNV---SMETFRHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPI 234

Query: 261 GMMISI-----SPQLSAFLLFLTPPVMLSASYFGRLIRNNS------RDLQEATGSLTKV 309
              IS+     + Q  A    +T   ML  S F    R  +      R+  +A      V
Sbjct: 235 TFEISVVCGILTYQFGASFAGITFTTMLLYSIF--TFRTTAWRTKFRREANKADNKAASV 292

Query: 310 AEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI----FNVGKQSAFINA-KFFSLTAVLGDM 364
           A +     + V++F  E+   ++Y  ++         V +  AF+N+ +    T  L  M
Sbjct: 293 ALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLNSGQNLIFTTALTAM 352

Query: 365 SFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL 424
            ++     G   ++ GSL++GDL             +  L + Y E+ Q       LF L
Sbjct: 353 MYM-----GCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFNL 407

Query: 425 TDRIPSI-SPTLGKKFVPNKG--EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVG 481
            +    I +P+  K    N G  +I F+NV+F Y  R   +I +N SF I AG    +VG
Sbjct: 408 RNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYDPR--RKILQNASFVIPAGWKTAVVG 465

Query: 482 PSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN 541
           PSG GKST+  L+ R+Y+P  G+I V+G DI +    SLRR + +V Q+  L + TI +N
Sbjct: 466 PSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQDTPLFNDTIWEN 525

Query: 542 ITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALI 601
           + +G ++   Q+  RSI +K      + + P   +TI+G  G ++SGG+KQR+AIAR L+
Sbjct: 526 VKFGRIDADDQEVTRSI-EKAHLAPLVYRLPGGLNTIVGERGLMISGGEKQRLAIARVLL 584

Query: 602 KKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGND 661
           K  +I+  DEATSALD  +E A+  T        S T + IAHRL TI  ++ +IVL  +
Sbjct: 585 KNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTIADADKIIVL-EE 643

Query: 662 GSVAEVGKFKEL 673
           G   E G   EL
Sbjct: 644 GRPREEGTHHEL 655

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  187 bits (475), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 155/552 (28%), Positives = 255/552 (46%), Gaps = 36/552 (6%)

Query: 174 VGVSLLVGTAANYGRVILLRV-------LSERVVARLRANVIKKTMHQDAEFFDNNKVGD 226
           V +++L   AA +G V+ + +       +++  + ++     +  M  D  +  + + G 
Sbjct: 153 VTLTVLSYGAARFGAVLFVELRNAVFSNVAQSAITKVSLQTFQHLMKLDLGWHLSRQTGG 212

Query: 227 LISRLSSD----AYVVSRSLTQKVSDGFK-AMLCGSVGIGMMISISPQLSAFLLFLTPPV 281
           L   +       +YV+S  +   +   F+ +M+CG +      S +    + +L  +   
Sbjct: 213 LTRAMDRGCKGISYVLSAMVFHIIPITFEISMVCGILTYQFGASFAAITFSTMLLYSIFT 272

Query: 282 MLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI- 340
             + ++  R      RD  +A      VA +     + V+ F  E+    +Y+ ++    
Sbjct: 273 FRTTAWRTRF----RRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYR 328

Query: 341 ---FNVGKQSAFIN-AKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEY 396
                V +  AF+N  +    T  L  M ++         V+ GSL++GDL         
Sbjct: 329 DSQIKVSQSLAFLNTGQNLIFTTALTAMMYMACNG-----VMQGSLTVGDLVLINQLVFQ 383

Query: 397 TGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSI--SPTLGKKFVPNKGEIEFKNVSFS 454
               +  L + Y ++ Q       LF+L     +I  SP      +    +I F+NV+F 
Sbjct: 384 LSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFG 443

Query: 455 Y-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
           Y P R   +I  N+SF I AG    IVGPSG GKSTI  L+ R+Y P  G+I V G DI 
Sbjct: 444 YDPER---RILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIR 500

Query: 514 KVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPN 573
            +   SLR+ + +V Q+  L + TI +N+ +G +   + DE+    +K      +   P 
Sbjct: 501 DLDLLSLRKAIGVVPQDTPLFNDTIWENVKFGNISS-SDDEILRAIEKAQLTKLLQNLPK 559

Query: 574 SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMK 633
              T++G  G ++SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+ +T  +   
Sbjct: 560 GASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFS 619

Query: 634 SKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKL--LHEKATR 691
           S S T + +AHRL TI  ++ +IVL   GSV E G    L A  GS    L  + E  T 
Sbjct: 620 SNSKTSVYVAHRLRTIADADKIIVL-EQGSVREEGTHSSLLASQGSLYRGLWDIQENLTL 678

Query: 692 SERQQNTAEDQE 703
            ER + +   Q 
Sbjct: 679 PERPEQSTGSQH 690

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  189 bits (480), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 142/512 (27%), Positives = 252/512 (49%), Gaps = 13/512 (2%)

Query: 185  NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQ 244
            N+ ++ LL  +SE+ V +LR N+++  + +D  +   NK  ++ +   +D   +    + 
Sbjct: 778  NFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNVTSI 837

Query: 245  KVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATG 304
             +S      +  SVG+   I I  +L+   L L P  +   + +G  ++ +    + A  
Sbjct: 838  LLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKTAVS 897

Query: 305  SLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDM 364
             L  +  E   G+KT++    E     RY    +++    ++ + +     ++T+ L  +
Sbjct: 898  QLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCLVIL 957

Query: 365  SFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLF-E 423
               ++  YG  LV+ G      L        +T  S  GL +      +G  A + +F  
Sbjct: 958  LQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFVFGM 1017

Query: 424  LTDRIP---SISPTLGK---KFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNV 477
            L + +P   + S  L K        +  +  + ++F+YP     QI+KN + +I+ G+ V
Sbjct: 1018 LEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRINQGTKV 1077

Query: 478  CIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGT 537
             IVG SG GKST+  L+   Y      +F+DG DI      +LR+ +++V+Q+P   +GT
Sbjct: 1078 AIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRFFNGT 1137

Query: 538  IRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIA 597
            IR+N+ YGL    T +E+  +  +    NF+   P   +T +  +  L+SGGQ QR++I 
Sbjct: 1138 IRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQRLSIV 1195

Query: 598  RALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIV 657
            RAL+++PT+LILDE TSALD  +  AI       +    IT+I I H    ++  + ++V
Sbjct: 1196 RALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKMCDRIVV 1253

Query: 658  LGNDGSVAEVGKFKELYADPGSELSKLLHEKA 689
            L N G+VAE G F +L+   G EL +++   A
Sbjct: 1254 LKN-GAVAEDGSFDDLFRARG-ELHRMVTTTA 1283

 Score =  122 bits (306), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 145/632 (22%), Positives = 265/632 (41%), Gaps = 49/632 (7%)

Query: 111 RDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEF 170
           +D+ LL+T I++  +   +   +  + G V D ++Q+      T  +   +    +L   
Sbjct: 19  KDYGLLITMITMTIIWGTVPAVVAVLTGRVFDVMQQLAQMKYNTQAEFLHVLLVRSLE-- 76

Query: 171 ISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN----NKVGD 226
              +G   LV     +  +    +L ER   R+R  +++  + +  +++D     N +  
Sbjct: 77  ---LGSVGLVQIPVQWIAITSWMLLGERQSLRIRRELLRSYLAKPMQWYDKIDDINGMYT 133

Query: 227 LISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSAS 286
           + +R   +A     S  +     F++ +   +        S +L+   L   P + L   
Sbjct: 134 ITNRCVEEA---RASCAEASGVLFQSAVTALILAVTAFKFSAKLTVVTLAGAPLLALLTV 190

Query: 287 YFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI---RHIFNV 343
            F + ++  +    E T S +       +    V+ F  +  E++++N A+   +  F  
Sbjct: 191 VFSKFVQKYAALENEQTSSASSTLSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVR 250

Query: 344 GKQSAFIN---AKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSS 400
               + IN    +F SL      M F+    YGS L+    +    +      +    SS
Sbjct: 251 TLICSSINQAAMRFLSL------MMFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSS 304

Query: 401 IFGLSTFYSEIMQGAGAASRLFELTDRIPSISPT-------LGK--KFVPNKGEIEFKNV 451
           I  + +    + +G  A  ++ E  +  P   P        +G          EI F  V
Sbjct: 305 INAMLSKVVLLQKGKVACRQIAEAVNVEPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQV 364

Query: 452 SFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQD 511
           SF+YP R   +    +S          IVG SG GKST+ +LLL++Y+   G I V+  +
Sbjct: 365 SFNYPARPDTKALDGVSLTFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTN 424

Query: 512 ISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKC---FCHNFI 568
           +  +    L +++++V+Q   L +GT+ +NIT  L  KP      ++ + C        +
Sbjct: 425 LRGIDRSWLLQNITLVEQSCTLFNGTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLV 482

Query: 569 TKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
              P    T +G  G  +SGGQ+QR+A+ARA+++   +LILDEA SALD+     +    
Sbjct: 483 FDLPEGLHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVI 542

Query: 629 GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEK 688
                 K  T I + H LS +   ++ + +   G V E G   EL ++P S    L    
Sbjct: 543 RSWRADK--TTIILTHELSHV-LDDDYLYMMEHGQVIEQGYKSELLSNPNSRFRAL---- 595

Query: 689 ATRSERQQNTAEDQEIDPEETINIENSTPESD 720
                R QN+  ++ ++   +  IEN   + D
Sbjct: 596 ----NRLQNSKNERALEERRSFAIENKLEQED 623

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  188 bits (478), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 150/529 (28%), Positives = 260/529 (49%), Gaps = 15/529 (2%)

Query: 167  LYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD--NNKV 224
            L +F  +V +  L    + + ++  L    E  +  LR     K +     +F   NNK 
Sbjct: 704  LLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISWFSKSNNKA 763

Query: 225  GDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLS 284
              L + L +D   +   +T+ +S     +L  S+G+   I+I  +LS   + + P V++ 
Sbjct: 764  PILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIAIIPLVVVL 823

Query: 285  ASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVG 344
               +G ++       + +  +L  +  E   G+KT+QS   +Q   K++N  I+ +   G
Sbjct: 824  TGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLLEKNG 883

Query: 345  KQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGL 404
               A       +LT +L  +   ++  YG  LVL G  +   L   +    +T  ++  L
Sbjct: 884  TYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVTVASL 943

Query: 405  STFYSEIMQGAGAASRLFELT--DRIPSISP-----TLGKKFVPNKGEIEFKNVSFSYPT 457
             T   +I +G  + S + ++   D   +I P     T    + PN+  IE  N+SF+Y  
Sbjct: 944  VTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVIEVSNLSFTYAQ 1003

Query: 458  RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517
              + +   N++ ++ +     IVG SG GKST+ +L+   Y+ + G I +   DI+K S+
Sbjct: 1004 VHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINKWST 1063

Query: 518  KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577
            K L + ++++QQ PVL   TIR+N+ YGL E    + + ++ +     +FI    N  D+
Sbjct: 1064 KELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNGLDS 1123

Query: 578  ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637
             L    +LLSGGQ QR+ +AR +++ P +LILDE TSALDV S   IN   G   +S + 
Sbjct: 1124 KLDD--SLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS--RSLAP 1179

Query: 638  TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
              I ++H+  TI+  + +  L  DG+VA +G ++EL  +   E  KLL+
Sbjct: 1180 VTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEEL-MENNWEFRKLLN 1226

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/409 (28%), Positives = 189/409 (46%), Gaps = 23/409 (5%)

Query: 260 IGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKT 319
           IG     S  L+  +   TP +++ A  F + I   +    E   + ++ A E+ + +  
Sbjct: 165 IGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYT----EKENTESECAAERLAWMLK 220

Query: 320 VQSFV----AEQKEIKRYNHAIRHIFNVG-KQSAFINAKFFSLTAVLGDMSFLVVLAYGS 374
              FV     +  EI  Y H I        K S FI+A    L  +   M F+    +GS
Sbjct: 221 NIEFVRLHNGDDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLM-FVQGFWFGS 279

Query: 375 YLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS---- 430
            ++  G L+I  +          GS I         + +G  A  RL ++ DR P     
Sbjct: 280 SMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTPRESLA 339

Query: 431 -ISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
            I    G   +P    I F NVSF YP R ++++F  ++F I       ++GPSG GKST
Sbjct: 340 FIDAISGIDLLP----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKST 395

Query: 490 IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI--TYGLV 547
           +  L+L +Y+   G I +   DI  ++   +  ++++V Q P L + TIR+NI       
Sbjct: 396 LFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWT 455

Query: 548 EKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTIL 607
             P++ E+  I K     N I + P+  DT +G  G  LSGGQ Q++A+ARA  +  +IL
Sbjct: 456 NLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSIL 515

Query: 608 ILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVI 656
           +LDE  SA+D+     +     +    K+  II+  H L  IR ++N++
Sbjct: 516 LLDEPLSAVDMRQRIVLMENIKRWRNGKTTVIIT--HDLEFIRNTDNIL 562

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  186 bits (473), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 151/541 (27%), Positives = 262/541 (48%), Gaps = 45/541 (8%)

Query: 178  LLVGTAA-----NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVGDLISR 230
            +++G AA     N+ +  LL   SE  +  LR  ++ K   ++  +F  ++NK  ++ + 
Sbjct: 766  IVLGVAAADGFFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITAL 825

Query: 231  LSSDAYVVSRSLTQKVSDGFKAML----CGSVGIGMMISISPQLSAFLLFLTPPVMLSAS 286
            + +D     R L   VS+   AM       ++G+   +    +LS   + + P +++ ++
Sbjct: 826  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSA 881

Query: 287  YFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQ 346
             +G +++    D + +   L     +  + IKT++   AE      Y+   + +  +  +
Sbjct: 882  IYGGILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYK 941

Query: 347  SAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL---HGSLSIGDLTAYMMYTEYTGSSIFG 403
             A       S+T ++      ++  YG  LVL   + S  + +    +++T  + +S+ G
Sbjct: 942  RAIATGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVG 1001

Query: 404  LSTFYSEIMQGAGAASRLFELTD-------------RIPSISPT--LGKKFVPNKGEIEF 448
                  +I +G  AAS ++ + D             R   IS     G + +P    I  
Sbjct: 1002 Q---IPDISRGQRAASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIP---IISI 1055

Query: 449  KNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVD 508
            +N+SF+YP+  +  IFK++   +     + IVG SG GKST+A LL R YN     I +D
Sbjct: 1056 RNLSFAYPSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIID 1115

Query: 509  GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFI 568
            G D++  +  SLR+ +S+V+Q+P    G+IRDN+TYG + +  + E+  + K    ++F+
Sbjct: 1116 GTDVNDWNLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFV 1175

Query: 569  TKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
               P   DT +  +  LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN   
Sbjct: 1176 ASLPQGLDTRVDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIV 1233

Query: 629  GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEK 688
             K      +  + I H    +R   ++ VL + G V E G F  LY   G EL +++  K
Sbjct: 1234 RK--GPPGLLTLVITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLYNKEG-ELFRIVCNK 1289

Query: 689  A 689
            +
Sbjct: 1290 S 1290

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 144/566 (25%), Positives = 260/566 (45%), Gaps = 68/566 (12%)

Query: 195 LSERVVARLRANVIKKTMH-QDAEFFDNNK--VGDLISRLSSDAYVVSRSLTQKVSDGFK 251
           + ER   R+RA +++  +  +   ++D N+  +GD  ++++     +  S  +  +  F+
Sbjct: 100 IGERQGFRVRAQLLEAYLETKPMGWYDANETLLGDF-TQVNRCVEELRSSSAEASAITFQ 158

Query: 252 AMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAE 311
            ++     IG     S  L+  +L  +P + + A  F RLI   ++     T +  ++  
Sbjct: 159 NLVAICALIGTSFYYSWSLTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFT 218

Query: 312 EQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVV-- 369
              +  + V+ +  +  E +++   I     +   + FI +  + + A  G + FL +  
Sbjct: 219 WSMNAAQLVRLYCTQPLERQKFQEII-----LSCNTFFIKSCLY-VAANAGILRFLTLTM 272

Query: 370 ----LAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT 425
                 +GS ++  G L+I D+                ++ F+S IM G+   S L ++ 
Sbjct: 273 FVQGFWFGSTMIRKGKLNINDV----------------ITCFHSCIMLGSTLNSTLHQIV 316

Query: 426 ---------DRIPSISPTLGKKFVPNKGE------------IEFKNVSFSYPTRASNQIF 464
                     +I ++  +  K+   N  E            + F+NVSF+YP+R S  + 
Sbjct: 317 VLQKGEVALQKIMALLESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVL 376

Query: 465 KNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHM 524
           +N++ K  +G    IVG SG GKSTI++LLL +Y+   G I ++G++   +  K L  ++
Sbjct: 377 QNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNI 436

Query: 525 SIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSI---------TKKCFCHNFITKFPNSY 575
           ++V+Q   L + T++ NI  G        +  +I          +       I   P+  
Sbjct: 437 TVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGL 496

Query: 576 DTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSK 635
           +T++G  G  LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K K
Sbjct: 497 ETLIGSGGVSLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK 556

Query: 636 SITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQ 695
             T I + H LS I   +++ V+  +G V E G   EL AD  +  SK  + +   S+ +
Sbjct: 557 --TTIILTHELSQIESDDHLYVM-QEGRVVESGIQSELLADSATTFSKWYYLQNDFSDAK 613

Query: 696 Q--NT-AEDQEIDPEETINIENSTPE 718
              NT  E++ I   E+ N +  TP+
Sbjct: 614 TIINTETEEESIYTTESFNSQLETPK 639

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  184 bits (467), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 153/536 (28%), Positives = 252/536 (47%), Gaps = 35/536 (6%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF-- 219
            +F L  + F+ L GV+   G   N+ +  LL   SE  +  LR  +++K   ++  +F  
Sbjct: 757  SFYLAKWSFVVL-GVAAADGIF-NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSG 814

Query: 220  DNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAML----CGSVGIGMMISISPQLSAFLL 275
            +NNK  ++ + + +D     R L   VS+   AM       ++G+   +    +LS   +
Sbjct: 815  ENNKAAEISALVMNDL----RDLRSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCI 870

Query: 276  FLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNH 335
             + P +++ +  +G  ++    D + +   L     +  + IKT++   AE      Y+ 
Sbjct: 871  SMFPLIIIFSVIYGSSLQTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHD 930

Query: 336  AIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTE 395
                +  +  + A       S+T ++      ++  YG  LV+    +   + A      
Sbjct: 931  MKTKMEGIASKRAIATGFGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLL 990

Query: 396  YTGSSIFGLSTFYSEIMQGAGAASRLFELTD-------------RIPSISPTLGKKFV-- 440
            +T  S   L     +I +G  AAS ++ + D             R+  IS   G  +   
Sbjct: 991  FTIMSCTTLVGQIPDISRGQRAASWIYRILDEAECTLEIEDNNGRVLGIS---GGTYYGN 1047

Query: 441  PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
             NK  +  +N++F+YP+  +  I+K +   +  G  V IVG SG GKST+  LL   Y  
Sbjct: 1048 SNKPIVSIQNLTFAYPSAPNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYAC 1107

Query: 501  TTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITK 560
              G I +DG D++  +  SLRR +S+V+Q+P L  G+IRDN+TYG + +    E+    K
Sbjct: 1108 KVGCIEIDGTDVNDWNLTSLRREISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALK 1167

Query: 561  KCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                ++F+   P S DT +  +  LLSGGQ QR+ IARAL++K  ILILDE TSALD  S
Sbjct: 1168 YVGIYDFVASLPQSLDTRIDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVS 1225

Query: 621  EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD 676
               IN    K     ++  + I H    +R   +V+V   DG + E G F  LY D
Sbjct: 1226 SRIINDIVKK--GPPALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLYND 1278

 Score =  177 bits (448), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 152/551 (27%), Positives = 264/551 (47%), Gaps = 38/551 (6%)

Query: 195 LSERVVARLRANVIKKTMHQDA-EFFDNNK--VGDLISRLSSDAYVVSRSLTQKVSDGFK 251
           + ER   R+R+ +++  + +   E++D N+  +GD  ++++     +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 252 AMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAE 311
            ++     IG     S  L+  +L  +P + L A  F R+I   ++     TG   ++  
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLT 218

Query: 312 EQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVV-- 369
              +  + V+ +  +  E K++   + +       + FI + F+ L A  G + FL +  
Sbjct: 219 WSMNAAQLVRLYCTQPLERKKFEEIVSNC-----NTFFIKSCFY-LAANAGVLRFLTLTM 272

Query: 370 ----LAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT 425
                 +GS ++  G L+I D+          G+++         + +G  A  ++  L 
Sbjct: 273 FVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLL 332

Query: 426 DRIP--SISPTLGKKFVP----NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCI 479
           +  P  + S T+ + + P      G++ F+NVSF+YP+R +  I +N   K   G    I
Sbjct: 333 ENGPKRNTSNTI-ELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFI 391

Query: 480 VGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIR 539
           VG SG GKSTI++LLL++Y+   G I ++G++I  +  KSL  ++++V+Q   L + T++
Sbjct: 392 VGKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLK 451

Query: 540 DNITYGL------VEKPTQDEVRSITKKC---FCHNFITKFPNSYDTILGPHGTLLSGGQ 590
           +NI  G        +  T D    I + C        I   P+  +TI+G  G  LSGGQ
Sbjct: 452 NNILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQ 511

Query: 591 KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIR 650
           +QR+AIARA I+   IL LDEA SALD+     +        K K  T I + H+LS I 
Sbjct: 512 QQRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGK--TTIILTHQLSQI- 568

Query: 651 RSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH--EKATRSERQQNT-AEDQEIDPE 707
            +++ + L  DG V E G   EL  D  +  SK  H  E    ++   NT  E++ I   
Sbjct: 569 EADDYLYLMQDGKVIESGIQSELLVDSTTTFSKWYHLQEDYFDAKTVVNTKTEEKSISTM 628

Query: 708 ETINIENSTPE 718
           E+ N +  TP+
Sbjct: 629 ESFNSQLKTPK 639

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  182 bits (462), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 154/530 (29%), Positives = 259/530 (48%), Gaps = 36/530 (6%)

Query: 178  LLVGTAANYGRVILLRVL-----SERVVARLRANVIKKTMHQDAEFF--DNNKVGDLISR 230
            +++G AA    + LL+       SE  +  LR + ++K  +   E+   DNNK  +L + 
Sbjct: 753  IVMGIAAADSGLTLLKEFILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSAL 812

Query: 231  LSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGR 290
            L +D   +  S +  +S     ++  SVG+   I    +LS   + + P +++ +  +G 
Sbjct: 813  LMNDLRDLRTSTSNFISFVSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGI 872

Query: 291  LIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFI 350
            L++    + +     L  V  E  +G+KT++    E       +H  +  FNV KQ+A +
Sbjct: 873  LLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIE-------DH-FKAKFNVLKQTAKL 924

Query: 351  NAKFFSLTAVLG-------DMSFLVVLAYGSY-LVLHGSLSIGDLTAYMMYTEYTGSSIF 402
              +  ++    G        MS   +L Y +  LV+HG  +   +        +T  +  
Sbjct: 925  MGQRRAIVTGFGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCN 984

Query: 403  GLSTFYSEIMQGAGAASRLFELTDRI--PSISPTLGKKFVP-----NKGEIEFKNVSFSY 455
             L     +I +G  AAS+++ + + I       T G + VP         I F ++SF+Y
Sbjct: 985  NLVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFNDLSFAY 1044

Query: 456  PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKV 515
            PT  + +I K+LS +I +G  + IVG SG GKST+ +++ R Y   +  +FVD  D++  
Sbjct: 1045 PTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDW 1104

Query: 516  SSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSY 575
            +   LR  +++V+Q+P L  GTIR+N+ YG        +V ++ K    ++F    P   
Sbjct: 1105 ALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGL 1164

Query: 576  DTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSK 635
            +T +     LLSGGQ QR+ IARAL+++P ILILDE TSALD  S   IN    +     
Sbjct: 1165 ETKI--DSGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIINEIIRE--GPP 1220

Query: 636  SITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
            ++  ISI H    +R    V VL + G + E+G  ++L    G +L KL+
Sbjct: 1221 TMLTISITHDEQMVRACNKVAVL-DQGHIVEMGNREDLLRQKG-QLWKLV 1268

 Score =  168 bits (425), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 144/504 (28%), Positives = 237/504 (47%), Gaps = 42/504 (8%)

Query: 194 VLSERVVARLRANVIKKTMHQDAEFFDNNKV--GDL------ISRLSSDAYVVSRSLTQK 245
           +L ER   R+R  +I   + +  +++D+N    GDL      +  L S +   S +LT K
Sbjct: 88  LLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDLTQTNRCVEELRSSSAEAS-ALTWK 146

Query: 246 VSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGS 305
                 A+   S      +++     A      P ++L A +F RLI   S      T  
Sbjct: 147 NLVTILALTVTSFYYSWSLTLVTMCGA------PVIVLCAIFFSRLIHIYSEKENSHTAI 200

Query: 306 LTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIF-NVGKQSAFINA-----KFFSLTA 359
            +++        + V+    +  E++ +  A++    N  K   + +A     KF +LT 
Sbjct: 201 SSQLLSWSMEAAQLVRLSCMQLVEVQNFQLAVKKCSKNFMKMCLYASANTAILKFLTLTI 260

Query: 360 VLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAAS 419
                 F+    +GS ++    L I D+          G++I G       + +G     
Sbjct: 261 ------FVQAFWFGSTMIRKHKLRIEDVITCFQSCVLLGATINGTLHQIVILQKGKVGVI 314

Query: 420 RLFELTDRIPSISPTL--GKKFVPNKG---EIEFKNVSFSYPTRASNQIFKNLSFKIDAG 474
            + E   +   +       ++F  + G   +IE +NV F+YP+R +    KN+S  +  G
Sbjct: 315 NVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVG 374

Query: 475 SNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLM 534
               +VG SG GKS++ +LLL+ Y+   G I +DG DI  +  KS+ +++++V+Q   L 
Sbjct: 375 KITYVVGKSGSGKSSLGNLLLKLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLF 434

Query: 535 SGTIRDNITYGLVEKPTQDEVRSITKKCFCH-----NFITKFPNSYDTILGPHGTLLSGG 589
           + T+R+NI +G   K T + VR  + K  C      NFI   P   DT++G  G   SGG
Sbjct: 435 NDTLRNNILFG--SKETDELVRDESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGG 492

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTI 649
           Q+QRIAIARA ++   IL+LDEA SALD+   G +     +  +S+  TII + H LS I
Sbjct: 493 QQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLLMNAI-RNWRSEKTTII-LTHDLSEI 550

Query: 650 RRSENVIVLGNDGSVAEVGKFKEL 673
              +++I L  DG V E G+ + L
Sbjct: 551 -GPDDMIYLLEDGEVVEQGQQRNL 573

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  182 bits (461), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 142/511 (27%), Positives = 238/511 (46%), Gaps = 32/511 (6%)

Query: 195 LSERVVARLRANVIKKTMHQDAEFFD--NNKVGDL--ISRLSSDAYVVSRSLTQKVSDGF 250
           L ER    +R  ++ + + +  E++D  +  +GD   ++R   +    S   +      F
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCHDKLLGDFTQVNRCVEELRSSSAEASAITFQNF 159

Query: 251 KAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA 310
            AML     IG     S  L+  +L   P ++L A  F  +I   +      TG   ++ 
Sbjct: 160 VAML---ALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLL 216

Query: 311 EEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVL 370
               +  + V+ +  +  EI  +   +    ++  +S F  +   S+   L    F+   
Sbjct: 217 NWSMNSAQLVKLYCTQAYEIHSFKELVGQCNDLFIKSCFYVSANTSILRFLSLSMFVQGF 276

Query: 371 AYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL---TDR 427
            +G+ +V  G LSI D+          GS++         + +G  A  ++ +    + R
Sbjct: 277 WFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISFSQR 336

Query: 428 IPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGK 487
            PS+ P        + GEI F+N+SF+YPTR    + K++S     G +  I+G SG GK
Sbjct: 337 SPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSGSGK 396

Query: 488 STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLV 547
           ST+A+LLL++YN   G I +   ++ K++   L  ++++V+Q   L + T+R+N+  G+ 
Sbjct: 397 STLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLLLGIS 456

Query: 548 ---EKPTQDEV------RSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIAR 598
              +K  QD++      +   +       I + P+  DTI+G  G  LSGGQ+QR+AIAR
Sbjct: 457 NSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRVAIAR 516

Query: 599 ALIKKPTILILDEATSALDVESEGAI-----NYTFGKLMKSKSITIISIAHRLSTIRRSE 653
           A IK  ++LILDEA SALD+     I     N+  GK       T I + H LS +   +
Sbjct: 517 AYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGK-------TTIILTHDLSQLDYDD 569

Query: 654 NVIVLGNDGSVAEVGKFKELYADPGSELSKL 684
            + V   DG V E G  + L  D  +  SKL
Sbjct: 570 FLYVF-EDGEVKESGYQQALLQDEKTIFSKL 599

 Score =  181 bits (459), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 155/539 (28%), Positives = 256/539 (47%), Gaps = 33/539 (6%)

Query: 168  YEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDL 227
            + FI L G+S      +N+ +  +L   SE  +  LR   +   M++  ++F  +K  + 
Sbjct: 767  WSFIVL-GISA-ADAISNFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWF--SKEENK 822

Query: 228  ISRLSSDAYVVSRSLTQKVSDGFKAM----LCGSVGIGMMISISPQLSAFLLFLTPPVML 283
             S LS+      R L   VS+   AM    +   VG+   +    +LS   + + P ++L
Sbjct: 823  SSELSALLLNDLRDLRSLVSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIIL 882

Query: 284  SASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNV 343
             +  +G  ++      + A   L     E  + IKT++   A +  IK Y     ++  +
Sbjct: 883  VSGIYGSTLQRYETMYKTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKI 942

Query: 344  GKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFG 403
              + +       S+T  +      ++  YG  LV  G  S   +        +T  S   
Sbjct: 943  AHKRSIATGFGISITNTIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTS 1002

Query: 404  LSTFYSEIMQGAGAASRLFELTD-------------RIPSISPTLGKKFVPNKGEIEFKN 450
            L +   +I +G  AAS L+ + D             R   I  +     VP    I  KN
Sbjct: 1003 LVSQIPDISRGQRAASWLYRILDESDDNKESVDSGSRSADIIISGNTNSVP---LISIKN 1059

Query: 451  VSFSYPTRASNQIFKNLSFKIDAGS-NVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDG 509
            + FSYP+  + +I+KN++  + +    + IVG SG GKST+  LL + Y      I++DG
Sbjct: 1060 LRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDG 1119

Query: 510  QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFIT 569
             D+++  +  LR+ +S+V+Q P L  GT+RDN+ YG +   ++ E+  + K    + FI 
Sbjct: 1120 TDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIE 1179

Query: 570  KFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
              P   D+ +     L+SGGQ QR+ IARAL++KPTILILDE TSALD  S   IN    
Sbjct: 1180 NLPMGLDSRIDTK--LVSGGQAQRLCIARALLRKPTILILDECTSALDAASAHLIN---- 1233

Query: 630  KLMKSKSITIISIAHRLS-TIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
             L+K+   T+++I    S  +  + N + +  DG +AE G F EL  +  SEL ++++E
Sbjct: 1234 NLVKNGLPTVLTIVITHSKQMMEACNSLAVIKDGRLAEQGNFAELMKN-NSELRRIINE 1291

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  179 bits (453), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 149/537 (27%), Positives = 265/537 (49%), Gaps = 32/537 (5%)

Query: 168  YEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVG 225
            + FI L GV++  G  +N+ +  +L   SE  +  LR   ++  +++D  +F  D NK  
Sbjct: 760  WSFIVL-GVAVADG-VSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSS 817

Query: 226  DLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSA 285
            +L + L +D   +   +++ +S     M+   +G+   +    +LS   L + P ++  +
Sbjct: 818  ELSALLLNDLRDLRSLVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFS 877

Query: 286  SYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGK 345
            + +G +++      + +  +L     E  +GIKT++S  AE   IK Y+    ++  +  
Sbjct: 878  AVYGTMLQKYETTYKTSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAH 937

Query: 346  QSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLS---IGDLTAYMMYTEYTGSSIF 402
            + +       S+T ++      ++  YG  LV  G  S   + +    +++T  T +S+ 
Sbjct: 938  KRSIATGFGISVTNMITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLV 997

Query: 403  GL----------STFYSEIM-QGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNV 451
                        +TF   I+ +G  +    FE   +   ++P    K  P    I+ +N+
Sbjct: 998  NQIPDISRGQRSATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNP---LIKIQNL 1054

Query: 452  SFSYPTRASNQIFKNLSFKIDAGS-NVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQ 510
            +F+YP+  +  ++++L+ ++ A    + +VG SG GKST+  LL + Y      I++DG 
Sbjct: 1055 TFAYPSETNVNVYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGT 1114

Query: 511  DISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITK 570
            D++     +LR  +S+V+Q+P L  GT+R+N++YG+       E+  + K    + F+  
Sbjct: 1115 DVNDWGLMNLRTQISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVES 1174

Query: 571  FPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGK 630
             P   DT +     LLSGGQ QRI IARAL++KP ILILDE TSALD  S   I      
Sbjct: 1175 LPFGLDTRIDTK--LLSGGQAQRICIARALLRKPKILILDECTSALDALSANIII----D 1228

Query: 631  LMKS--KSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
            ++K+   ++  I I H    +R    + VL N G + E G FKEL    G EL K++
Sbjct: 1229 IVKNGPPALLTIVITHSEKMMRACNTIAVLKN-GKIIEKGGFKELVNGNG-ELKKII 1283

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 132/517 (25%), Positives = 236/517 (45%), Gaps = 43/517 (8%)

Query: 195 LSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDG----- 249
           L ER    +R  ++++ + +   ++D+N        LS D   ++R + +  S       
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASA 155

Query: 250 --FKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLT 307
             F+ ++     IG     S  L+  +L   P ++  A +F  +I   +      TG   
Sbjct: 156 IIFQNLVSILALIGTSFYYSWSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAA 215

Query: 308 KVAEEQFSGIKTVQSFVAEQKEIKRYNHA--------IRHIFNVGKQSAFINAKFFSLTA 359
           ++A      I+ V+ +  + +E++ +           I+    V   +A +  +F SL+ 
Sbjct: 216 QLANWAMDSIQLVKLYCTQFREVRNFRELTSNCNDLFIKCCLYVSANTALL--RFLSLSM 273

Query: 360 VLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAAS 419
                 F+    +G+ +V  G L I ++          GS++         + +G  A  
Sbjct: 274 ------FIQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALK 327

Query: 420 RLFE-LTDRIP--SISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSN 476
           ++   L+  +   +  P    +       I F N++FSYP+R S+ + KN+S   +    
Sbjct: 328 KILGFLSTSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKF 387

Query: 477 VCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSG 536
             I+G SG GKST+++LLL++Y+   G I V G D+ +++   L  ++++V+Q   L + 
Sbjct: 388 TFIIGKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFND 447

Query: 537 TIRDNITYGLVEKPTQDEVRSITKK----C---FCHNFITKFPNSYDTILGPHGTLLSGG 589
           T+R+NI  G+ +   +D   SI +K    C        +   P+  +TI+G  G  LSGG
Sbjct: 448 TLRNNILLGVSKDQLEDH-ESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGG 506

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTI 649
           Q+QR+AIARA ++   ILILDEA SALD+     +     +    K  T I + H LS I
Sbjct: 507 QQQRVAIARAFMRNKPILILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQI 564

Query: 650 RRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
              +   V+  +G V E G  K+L     S  + +L+
Sbjct: 565 EPDDYTYVI-QEGEVKENGYQKDLKQKKTSVFNHMLN 600

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  178 bits (451), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 137/528 (25%), Positives = 256/528 (48%), Gaps = 21/528 (3%)

Query: 173  LVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVGDLISR 230
            ++ ++L  GT  N+ ++ +L   SE  +  LR  +++    +  E++   +NK  ++ + 
Sbjct: 728  VLAIALADGTF-NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISAL 786

Query: 231  LSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGR 290
              +D   +   +T+ +S     +    +G+   I+   +LS   + + P +++ +  +G 
Sbjct: 787  ALNDLRDLRTLVTEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGT 846

Query: 291  LIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFI 350
            +++N     + A   L  +  E  + IKT++        +  Y+   + +  + K+   +
Sbjct: 847  VLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIV 906

Query: 351  NAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSE 410
                 S+   +      ++  YG  LVL G  +   +        +T ++   L +   +
Sbjct: 907  TGLGLSMLTTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQIPD 966

Query: 411  IMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGE--------IEFKNVSFSYPTRASNQ 462
            + +G  AAS +  + D         G+       E        IE +N++F YP      
Sbjct: 967  VSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVN 1026

Query: 463  IFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRR 522
            ++++L+ KI++G  + +VG SG GKST+  LL + Y+    +I ++G DI+  S   LR 
Sbjct: 1027 VYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRA 1086

Query: 523  HMSIVQQEPVLMSGTIRDNITYGLVEKP--TQDEVRSITKKCFCHNFITKFPNSYDTILG 580
             + +V+Q+P L  GTIR+NITYG+ EK   ++ EV+ + +    H F+   P + DT++ 
Sbjct: 1087 EICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVD 1146

Query: 581  PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSK---SI 637
                LLSGGQ QR+ I R L++KP +LILDE TS+LD ++   I     K + +K    I
Sbjct: 1147 IG--LLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTT-QIVIALIKDLNTKLGWDI 1203

Query: 638  TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
              I I H    ++    ++VL + G V E G+F +L+  PG  L  +L
Sbjct: 1204 LTIVITHNRQMMQCCSRLVVL-DVGRVVEDGQFDDLH-QPGRILHSIL 1249

 Score =  164 bits (415), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 139/507 (27%), Positives = 243/507 (47%), Gaps = 41/507 (8%)

Query: 195 LSERVVARLRANVIKKTMHQDAEFFD--NNKVGDL------ISRLSSDAYVVSRSLTQKV 246
           L ER   R+R+ ++++ + +  E++D   N  GD       +  L S +   S ++T + 
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYDLKENLAGDFTQLNRCMEELRSGSAEAS-AVTYQN 151

Query: 247 SDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSL 306
                A++C S         S QL+  +L  +P +++ A+ F R I+  +    + T + 
Sbjct: 152 CVAIIALICVS------FYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAA 205

Query: 307 TKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF 366
             +        +TV+    + KEIK++   +           FI    F+  A +G + F
Sbjct: 206 ADLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKC-----NDYFIRTSLFT-AANIGILRF 259

Query: 367 LVV------LAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQ-GAGAAS 419
           L +        +GS ++  G L+I D+     Y+     SI   +  +   +Q G  A +
Sbjct: 260 LTLSMFVQGFWFGSTMIRKGKLNISDVIT-CFYSCLMLGSILNTTLHHVIFIQKGQVALA 318

Query: 420 RLFELTDRIPSI-SPTL-GKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNV 477
           ++ +  +  P + S TL     V +  +I   N++F+YP+R +  + KN+S KI +    
Sbjct: 319 KIQKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTT 378

Query: 478 CIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGT 537
            IVG SG GKSTI +L++++Y    G I V  +DI  V    L +++++V+Q   L + T
Sbjct: 379 FIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDT 438

Query: 538 IRDNITYGLVEKPTQDEVR-----SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQ 592
           +++NI  G   K T   +      SI       + I+  P+  +T LG  G  LSGGQ+Q
Sbjct: 439 LKNNILLG--SKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQ 496

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRS 652
           R+A+ARA ++   ILILDEA SALD+     +     K+ ++K  T I + H L+ I  +
Sbjct: 497 RVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNK--TTIILTHDLNQINDN 554

Query: 653 ENVIVLGNDGSVAEVGKFKELYADPGS 679
           + + +  N+  + E G  K L  D  +
Sbjct: 555 DYIYLFENN-EIKENGFKKTLMNDENT 580

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  177 bits (449), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 141/527 (26%), Positives = 246/527 (46%), Gaps = 22/527 (4%)

Query: 172  SLVGVSL-LVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNK-----VG 225
            SL+ +S+ L+ +   + +   L    E  +  LR    K   +++  +F++ +     V 
Sbjct: 776  SLIVLSVALLDSTFTFLKCFTLSKCGENWIRALRLRAFKNISNRELAWFNSEQNSTSNVS 835

Query: 226  DLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSA 285
             L+     D   ++      V+       CG +     ++   +LS   + L P  +L  
Sbjct: 836  SLVINDLRDLRALASEFLAAVTTLVVVSFCGLI---WALASGWKLSLVCISLIPAFILFT 892

Query: 286  SYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGK 345
              +G L++    + + A  S+          IKT++    E++ IK Y          G+
Sbjct: 893  GAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKLAGR 952

Query: 346  QSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLS 405
            + A       +L+  L  ++  ++L YG  LV+ G  S   +   +    +T  +   L 
Sbjct: 953  KRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCMSLI 1012

Query: 406  TFYSEIMQGAGAASRLFELTDRIPSIS-------PTLGKKFVPNKGEIEFKNVSFSYPTR 458
                EI +G  AA+ LF + D     +         L  +   N+  I  K++ FSY   
Sbjct: 1013 AQIPEISRGQRAATYLFRILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSYSFL 1072

Query: 459  ASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSK 518
             +  +++ L+  + AG  V +VG SG GKST+  L+ R Y   +G I+ DG D+++    
Sbjct: 1073 NNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEW 1132

Query: 519  SLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTI 578
            +LR+ +++V+Q P L  G+I DN+TYGL     + E+R + +     +F+   P    + 
Sbjct: 1133 ALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGLQSF 1192

Query: 579  LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSIT 638
            +     +LSGGQ QR+AI RAL++KP +L+LDE TSALD +  G I   F +   S+S T
Sbjct: 1193 IDTD--VLSGGQLQRLAIVRALLRKPQLLVLDECTSALDAQ-HGFIMSEFVR-QGSQSTT 1248

Query: 639  IISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
             + + H    +R    ++   N G++ E G F+ LY+  G EL K+L
Sbjct: 1249 TLVLTHSEQMMRACNRILTFAN-GNIIEDGSFERLYSQKG-ELFKIL 1293

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 136/508 (26%), Positives = 233/508 (45%), Gaps = 29/508 (5%)

Query: 195 LSERVVARLRANVIKKTMHQDAEFFD-NNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAM 253
           L ER   RLR  +++  + +   ++D N ++    ++L+     +  S  +  +  F+ +
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDFTQLNRCVEELRSSSAESSAIVFQNV 158

Query: 254 LCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQ 313
           +  +  +G  +  S  L+  ++  +P V+  A +F R +   ++     T S        
Sbjct: 159 VTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWS 218

Query: 314 FSGIKTVQSFVAEQKEIKRYNHAI---RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVL 370
               K V+    + +E+ R+   +   R  FN  K S F +  + S+   L    F+   
Sbjct: 219 LDAAKMVRLLGTQDRELARFEACVQKCRQHFN--KMSLFSSLNY-SVLRFLTLCMFVQGF 275

Query: 371 AYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS 430
            YG+  +  G L  GD+           S++   ST +  I+   GA   L ++   + S
Sbjct: 276 WYGNSRINIGKLKPGDVVTCFSSCVLLASTLN--STLHQIIILQKGAVG-LQKIMAFVNS 332

Query: 431 ISPTLGKK-----------FVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCI 479
              +  +K               +  I F+NV F+YPTR  + + K +S    +G    +
Sbjct: 333 RDASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFV 392

Query: 480 VGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIR 539
           +G SG GKSTI +LLL +Y   +G I V+GQD+ +++   L R++ +V+Q   L + T+ 
Sbjct: 393 IGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETLA 452

Query: 540 DNITYGLVEKPTQDEVRSITKKC---FCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAI 596
           +N+T G  E    D+   + + C      N I       +T +G  G  LSGG++QR+A+
Sbjct: 453 NNVTIG--EAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVAL 510

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVI 656
           ARA  +   ILILDEA SA D   +  +     K    K  T I + H LS I  ++ V 
Sbjct: 511 ARAYFRNAPILILDEALSAQDRIHKSLLMEAIRKWRADK--TTIILTHELSDILDTDYVY 568

Query: 657 VLGNDGSVAEVGKFKELYADPGSELSKL 684
           V+ +DG + E G    L ++P SE S L
Sbjct: 569 VM-SDGQIREHGYKSGLLSNPKSEFSNL 595

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} similar
            to uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1271

 Score =  176 bits (447), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 149/531 (28%), Positives = 262/531 (49%), Gaps = 29/531 (5%)

Query: 172  SLVGVSL-LVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD--NNKVGDLI 228
            SL+ +S+  V   + + +  +L   SE  + RLR + + K   +  ++F    N   +L 
Sbjct: 748  SLIVISISAVDGISTFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELN 807

Query: 229  SRLSSDAYVVSRSLTQKVSDGFKAM----LCGSVGIGMMISISPQLSAFLLFLTPPVMLS 284
            S + +D     R L    S+   A+       S+G+   +    +LS   + L P  +L 
Sbjct: 808  SLMMNDL----RDLRGLASEFLSAITTLVFVASIGLIWALVSGWKLSLVCISLFPAFILF 863

Query: 285  ASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVG 344
            +  +G L++      +     L     E    +KT++    +Q     +   +  +  V 
Sbjct: 864  SGIYGSLLQVYETAYKTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVC 923

Query: 345  KQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGL 404
            K+ +       ++T  L  +   ++  +G  LV+ G  S+  +        ++  +   L
Sbjct: 924  KKRSVAVGFGIAVTNALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSL 983

Query: 405  STFYSEIMQGAGAASRLFELTDRIPSIS-----PTLGKKFVPNKGE---IEFKNVSFSYP 456
                 EI +G  AA+ +F++ +   S+      P+  + F    G    I+  N+SF++ 
Sbjct: 984  INQVPEISRGQRAATYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFS 1043

Query: 457  TRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS 516
            +   N+IF +LS +I     V IVG SG GKST++ LL R Y   +G++++ G DI+K  
Sbjct: 1044 SAPMNKIFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWD 1103

Query: 517  SKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYD 576
              +LRR +SIV+Q+P    GT+R+N+ YGL    +  E+RS+ K     +F+   PN  +
Sbjct: 1104 EYALRRTISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLN 1163

Query: 577  TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKS-- 634
            T +  H  L+SGGQ QR++IAR L+++P I+ILDE TSALD  +  AI     +L+++  
Sbjct: 1164 TRV--HDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAI----AELIRTVL 1217

Query: 635  KSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
            K++T+I I H    ++  + V+VL   G V E G + EL+   G EL +++
Sbjct: 1218 KNVTVIVITHSEQLMQICDRVLVL-KKGKVKEEGSYAELFESRG-ELYRIV 1266

 Score =  169 bits (429), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 149/251 (59%), Gaps = 6/251 (2%)

Query: 444 GEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTG 503
           G+IEF++VSF+YPTR  + + KN+S KI +G+   IVG SG GKST+ASLLL+ Y   TG
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 504 QIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK-PTQDEVRSITKKC 562
           +I     +I  +    L  ++++V+Q   L +GT++DN+T  +V K  +  EV+   +  
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLT--IVNKYASCTEVKQACQFA 472

Query: 563 FCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
             +  +   PN  DT+LG HG  LSGGQ+QR+A+ARA ++   +LILDE+ SALD+ S  
Sbjct: 473 LLNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRE 532

Query: 623 AINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELS 682
            I        K K  T I + H  + I+  E V ++ ++G+V E G   +L  +P S  +
Sbjct: 533 LIVEAIRHWRKGK--TTIILTHEYTQIKDDEYVYLM-SEGTVVESGFKYDLLENPDSYFA 589

Query: 683 KLLHEKATRSE 693
           +L   + TR E
Sbjct: 590 QLNSLQETRYE 600

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  175 bits (443), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 150/533 (28%), Positives = 242/533 (45%), Gaps = 55/533 (10%)

Query: 182  TAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD--NNKVGDLISRLSSDAYVVS 239
            +A  + +  +L    E  +  LR N  +  M +D  +F   NN   ++ S + +D     
Sbjct: 786  SAFTFLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL---- 841

Query: 240  RSLTQKVSDGFKAM-------LCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLI 292
            R L    S+   A+       LCG +     +    +LS   + L P  +L +  +G L+
Sbjct: 842  RDLRALASEFLAALSTLAVVSLCGLL---WALVAGWKLSLVCISLIPMFVLFSGIYGGLL 898

Query: 293  RNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNH--------AIRHIFNVG 344
            +N     +     L     +    +KT++    E K  + Y          A +     G
Sbjct: 899  QNYEARYKTCIAELENELYKAIRCMKTIKCLQMENKVARSYEMLEVTSKGAARKRAMGTG 958

Query: 345  KQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGL 404
               A  NA  F   ++L        L +G  LV+ G  + G +   +    +T  +   L
Sbjct: 959  FGVASSNALTFITQSIL--------LYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTL 1010

Query: 405  STFYSEIMQGAGAASRLFEL------------TDRIPSISPTLGKKFVPNKGEIEFKNVS 452
             +   EI +G  AA+ LF+L             +R   I  T  K+ +     I  K++ 
Sbjct: 1011 MSQVPEISRGQRAATYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTL-----ISIKHLK 1065

Query: 453  FSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDI 512
            FSY    +  ++KNLS K+D G  V ++G SG GKST+ SLL R Y    G I +DG DI
Sbjct: 1066 FSYSNINNPMVYKNLSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDI 1125

Query: 513  SKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFP 572
            ++   K+LR  +++V+Q+P+  SG+I +N+TYGL+ K + +EV  +        F+   P
Sbjct: 1126 NQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTP 1185

Query: 573  NSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLM 632
                +++     LLSGGQ QR+AI RAL++KP +L+LDE TSALD      I   F K  
Sbjct: 1186 KRLHSVIDTQ--LLSGGQVQRLAIVRALLRKPQLLVLDECTSALDAR-HSFIMSEFVKHH 1242

Query: 633  KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
               + T++ + H    +R    ++   N G + E G    L+   G EL ++L
Sbjct: 1243 LYHTTTLV-VTHSEQMMRSCHRILTF-NKGEIVEEGSIDNLFNQKG-ELYRIL 1292

 Score =  161 bits (408), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 166/648 (25%), Positives = 289/648 (44%), Gaps = 52/648 (8%)

Query: 111 RDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFT-VDDVPEIAFGLNLYE 169
           RDW LL+  IS+ SV+  I   +P +  I++  +  ++  P     D V  +   L +  
Sbjct: 24  RDWWLLMI-ISICSVAYGI---VPAVTSILMGAVFNLLQKPVIQQFDSVNTLMRDLTIRT 79

Query: 170 FISLVGVSLLVGTAA---NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD-NNKVG 225
              L+      G A+    +  +     L ER   RLR  +++    +   ++D N ++ 
Sbjct: 80  MAILI-----TGIASIPFCWLSIYAWMSLGERQGFRLRRKLLRSYFEKSMAWYDINEQIS 134

Query: 226 DLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSA 285
              ++L+     +  S  +  +  F+ ++     +G  +  S  L+  ++  +P V+  A
Sbjct: 135 GEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLTLVIMANSPLVIGFA 194

Query: 286 SYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI-FNVG 344
            Y  R +    +     T     +     +  K V+    +  EI ++  ++     N  
Sbjct: 195 IYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLKCRMNFN 254

Query: 345 KQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGL 404
           K S F +  + S+   L    F+    YG+  +  G+L  GD+           S I   
Sbjct: 255 KMSLFSSLNY-SILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCF------SSCILLA 307

Query: 405 STFYSEIMQ------GAGAASRLFEL--TDRIPSISPTLGKKFVP---NKGEIEFKNVSF 453
           ST  S + Q      GA    ++ E   +D +      +    +P    + +I F+NVSF
Sbjct: 308 STLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFENVSF 367

Query: 454 SYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
           +YP+R+ + + KNL+ K+  G    IVG SG GKSTI++LLL+ Y P +G I V+  DI 
Sbjct: 368 AYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIR 427

Query: 514 KVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPN 573
           +++ + L R +++V+Q   L   +I++NI     E      +    +       I     
Sbjct: 428 EINQQDLFRSITLVEQNSPLFEDSIKNNIQLTSDEHRDDGRLSQACQAAMLEGVIRDLAK 487

Query: 574 SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMK 633
             DTI+G  G  LSGG++QR+A+ARA ++   ILILDEA SA D   +  +        K
Sbjct: 488 GLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEAIRFWRK 547

Query: 634 SKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH--EKATR 691
            +  T I + H L+ I   ++ ++L  DG+V E G+  +L +D  S+ S LLH  +    
Sbjct: 548 GR--TTIILTHELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTSKFS-LLHAFQLCDE 603

Query: 692 SERQQNTAEDQ------------EIDPEETINIENSTPESDITQELLE 727
            E + +T  D              +D EE  + E  +P ++ T  +LE
Sbjct: 604 IEDEASTITDSNRLSLGAKLEPIRVDVEELYS-EMGSPSTEKTYSVLE 650

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
           YKL209C (REAL)
          Length = 1316

 Score =  173 bits (438), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 151/560 (26%), Positives = 248/560 (44%), Gaps = 57/560 (10%)

Query: 192 LRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFK 251
           LR+ S+ + A L    +K     D    D  ++   +  L S +   S    Q +     
Sbjct: 131 LRIRSQLLEAYLEKKPMKWYDVNDTLLGDFTQINRCVEELRSSSAEASAITFQNL----- 185

Query: 252 AMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAE 311
             +C  +G     S S  L+  +L  +P +   A  F R++   S+   E T    ++  
Sbjct: 186 VAICALLGTSFYYSWS--LTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFA 243

Query: 312 EQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVV-- 369
              +  + V+ +  +  E K++   I     +   + FI +  F + A  G + FL +  
Sbjct: 244 WSMNAAQLVRLYCTQPLERKKFQRII-----LSCNTFFIKSCLF-VAANAGILRFLTLTM 297

Query: 370 ----LAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT 425
                 +GS ++  G L+I D+          GS++         + +G  A  ++  L 
Sbjct: 298 FVQGFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLL 357

Query: 426 DRIPSISPTLGKKFVPNKGEIE------------FKNVSFSYPTRASNQIFKNLSFKIDA 473
           +  P  +P       PN+ E+             F NVSFSYP+R S  + +N S K  A
Sbjct: 358 ENGPKCNP-------PNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPA 410

Query: 474 GSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVL 533
           G    IVG SG GKST++SLLL++Y+   G I ++G++I  +  K L +++++V+Q   L
Sbjct: 411 GQFTFIVGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTL 470

Query: 534 MSGTIRDNITYGLVE---------KPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGT 584
            + T+R NI  G  E             + ++   +       I   P+  +T++G  G 
Sbjct: 471 FNDTLRKNILLGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGV 530

Query: 585 LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            LSGGQ+QR+A+ARA I+   IL LDEA SALD+     +        K K  T I + H
Sbjct: 531 TLSGGQQQRVAMARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGK--TTIILTH 588

Query: 645 RLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEI 704
            L  +  S++ + L  +G V E G   EL AD  S  SK    +   S+ +  T  + EI
Sbjct: 589 ELGQV-ESDDHLYLMQEGKVIESGTQSELLADSTSTFSKWYCLQKDYSDTK--TIVNSEI 645

Query: 705 DPE-----ETINIENSTPES 719
           D +     E+ N    TP++
Sbjct: 646 DEKSLNSTESFNSHLETPKT 665

 Score =  167 bits (424), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 147/534 (27%), Positives = 259/534 (48%), Gaps = 31/534 (5%)

Query: 177  SLLVGTAA-----NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVGDLIS 229
             +++G AA     N+ +  LL   SE  +  LR  V++K   +   +F  ++NK  ++ +
Sbjct: 790  CIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSA 849

Query: 230  RLSSDAYVVSRSLTQKVSDGFKAMLCGS-VGIGMMISISPQLSAFLLFLTPPVMLSASYF 288
             + +D   + RSL  +      + +  S +G+   ++   +LS   + + P +++ ++ +
Sbjct: 850  LVLNDLRDL-RSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFSAIY 908

Query: 289  GRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSA 348
            G +++ +  D + +   L     +  + IKT++   AE      Y+     +  +  + A
Sbjct: 909  GSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRA 968

Query: 349  FINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFY 408
                   S+T ++      ++  YG  LV+    +   +        +T  S   L +  
Sbjct: 969  IATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQI 1028

Query: 409  SEIMQGAGAASRLFELTDR--------------IPSISPTLGKKFVPNKGEIEFKNVSFS 454
             +I +G  AAS ++ + D               I  I  T  +K       +  +N++F+
Sbjct: 1029 PDISRGQRAASWIYRILDEKQVTLEIEDNNARSIGIIGETYHEK--QTTPMLSIQNLTFA 1086

Query: 455  YPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISK 514
            YP+  S  I+KN++  +  G  + IVG SG GKST+  LL R Y+   G I +DG D++ 
Sbjct: 1087 YPSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVND 1146

Query: 515  VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS 574
             +   LRR +S+V+Q+P+L +GTIRDN+TYG + +  + E+    K    ++F+   P  
Sbjct: 1147 WNLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLG 1206

Query: 575  YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKS 634
              T +  +  LLSGGQ QR+ IARAL++KP ILILDE TSALD  S   I     K    
Sbjct: 1207 LGTRIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIKEIVKK--GP 1262

Query: 635  KSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEK 688
             ++  + I H    +R  +++ V   DG V E G F  LY + G E+ +++ EK
Sbjct: 1263 PALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLYNNCG-EMFRIVSEK 1314

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  168 bits (425), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 155/529 (29%), Positives = 254/529 (48%), Gaps = 85/529 (16%)

Query: 198  RVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDG-FKAMLCG 256
            R   ++  N++   +H    FFD   VG +++R S D   V + L   +    F  + C 
Sbjct: 1069 RASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCA 1128

Query: 257  SVGIGMMISISPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVA---- 310
            S+ I ++  I+P+      FLT  V++   YF  G+     SR+L+    S+TK      
Sbjct: 1129 SI-IFLITVITPR------FLTVAVIVFVLYFFVGKWYLTASRELKRL-DSITKSPIFQH 1180

Query: 311  -EEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF--- 366
              E   G+ T+++F  E++ I    + I             N  FF L+  +   SF   
Sbjct: 1181 FSETLVGVCTIRAFGDERRFILENMNKIDQN----------NRAFFYLSVTVKWFSFRVD 1230

Query: 367  ----LVVLAYGSYLVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGA 417
                 +VLA GS+++L+       L+   LT  +++T+        L   YS       +
Sbjct: 1231 MIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNS 1286

Query: 418  ASRLFELT--DRIPSISPTLGKKFV------PNKGEIEFKNVSFSYPTRASNQIFKNLSF 469
              RL E +  ++   +    G+  +      P  GEIE +N+S  Y       + +N+SF
Sbjct: 1287 VERLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLP-PVIRNVSF 1345

Query: 470  KIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQ 529
            K+D  S + IVG +G GKSTI + L R   P TG I +DGQDISK+   +LRR ++I+ Q
Sbjct: 1346 KVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQ 1405

Query: 530  EPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFIT------------KFPNSYDT 577
            +P+L +GTI+ N     V+   + + + I K     N I+            +F ++++ 
Sbjct: 1406 DPILFAGTIKSN-----VDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNK 1460

Query: 578  ILGPH------GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES----EGAINYT 627
             L  H      G  LS G++Q + IAR+L+++P I++LDEATS++D +S    +G I   
Sbjct: 1461 FLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSE 1520

Query: 628  FGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD 676
            F K       TI++IAHRL ++   + +IV+ + G V E  +  EL  D
Sbjct: 1521 FNK------STILTIAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKD 1562

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 132/519 (25%), Positives = 225/519 (43%), Gaps = 49/519 (9%)

Query: 224 VGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAF-----LLFLT 278
           +G +I+ +S D++ VS  L   +    +A++   V +G++ +    +SAF     +L + 
Sbjct: 445 LGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNF-LGVSAFAGISIILVMF 502

Query: 279 PPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIR 338
           P   L A+  G+  +   +   +    L     E    I+ V+ F  E+  I    + I+
Sbjct: 503 PLNFLLANLLGKFQKQTLKCTDQRISKL----NECLQNIRIVKYFAWERNII----NEIK 554

Query: 339 HIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTG 398
            I     +S    +  +S+T+ L  ++    L  G    +   +   DL A + +T  + 
Sbjct: 555 SIRQKELRSLLKKSLVWSVTSFLWFVT--PTLVTGVTFAICTFVQHEDLNAPLAFTTLSL 612

Query: 399 SSIFG-----LSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSF 453
            ++       LS   S I Q   +  R+ +   R+            P+K +IEFKN + 
Sbjct: 613 FTLLKTPLDQLSNMLSFINQSKVSLKRISDFL-RMDDTEKYNQLTISPDKNKIEFKNATL 671

Query: 454 SYPTRASN-QIFK--NLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDG- 509
           ++    S+   FK   L+ K   G    I+G +G GKS +   LL   N  +G I V   
Sbjct: 672 TWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSL 731

Query: 510 ---QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHN 566
               D+     + L    +   Q   L++ T+++NI +       +D    +   C    
Sbjct: 732 EPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFD--NFYNEDRYNKVIDACGLKR 788

Query: 567 FITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-- 624
            +   P    T +G  G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I  
Sbjct: 789 DLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYE 848

Query: 625 NYTFGKLMKSKSITIISIAHRLS-TIRRSENVIVL-----GNDGSVAEV---GKFKELYA 675
           N   G LMK++  T I + H +S T+R +   IVL      N G++ E+   G FKE Y 
Sbjct: 849 NCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGLFKEKYV 906

Query: 676 DPGSELSKLLHEKATRSERQQNTAEDQEIDP-EETINIE 713
              S  S  ++EK     +     + Q+I+P  E IN +
Sbjct: 907 QLSSRDS--INEKNANRLKAPRKNDSQKIEPVTENINFD 943

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  167 bits (422), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 134/496 (27%), Positives = 234/496 (47%), Gaps = 22/496 (4%)

Query: 191  LLRVLSERVVARLRANVIKKTMHQDAEFF--DNNKVGDLISRLSSDA----YVVSRSLTQ 244
            +L V SE  +  LR   + +  +QD  +F  D NK  ++ + + +D     Y+VS  L+ 
Sbjct: 813  ILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLVSGFLSA 872

Query: 245  KVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATG 304
              +     +   ++G+        +LS   +   P  +     +G +++    D + A  
Sbjct: 873  VTT----LIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIYGGVLQKYETDYKTAVA 928

Query: 305  SLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDM 364
             L     E   GIKTV+    E     +Y      + +  ++ A +     +L+  L   
Sbjct: 929  ELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVALSNALVIG 988

Query: 365  SFLVVLAYGSYLVLHGSLSIGDLT---AYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRL 421
               ++  YG  LV+ G  +  +L      +++T  T S++      +S   + A    R+
Sbjct: 989  VQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFSRGRRAATYVFRI 1048

Query: 422  FELTDRIPSISPTLGKKFVPNKGE----IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNV 477
                    SI      + +         I  ++++F+YP+    +++K LS  I+ G N+
Sbjct: 1049 LNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEVYKKLSLTINFGENL 1108

Query: 478  CIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGT 537
             IVG SG GKST+  +L   Y      +F+D  DI K +  SLR+H+S+V+Q+     G+
Sbjct: 1109 AIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKHISMVEQKAKFFDGS 1168

Query: 538  IRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIA 597
            IRDN+ YGL    T  ++  +       +F+ + P   +T +  +  L+SGGQ QRI+I 
Sbjct: 1169 IRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN--LISGGQAQRISIG 1226

Query: 598  RALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIV 657
            RAL+++P +LILDE TS+LD ++  AI    G  +    IT I I H  + + +S N I+
Sbjct: 1227 RALLRQPKLLILDECTSSLDAKNAQAIASLVGSSL--YGITTIVITHN-TQMMKSCNRIL 1283

Query: 658  LGNDGSVAEVGKFKEL 673
               +G ++E G F+EL
Sbjct: 1284 FFKNGRISEEGTFQEL 1299

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 140/584 (23%), Positives = 248/584 (42%), Gaps = 89/584 (15%)

Query: 194 VLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRS---LTQKVSDGF 250
           +L ER   R+R  ++   + +   ++D N+       L  D   + R    L    ++  
Sbjct: 101 LLGERQGFRVRRRLLGAYLSKTMAWYDTNE------NLEGDFTQIHRGVEELRSSAAESS 154

Query: 251 KAMLCGSVGIGMMIS----ISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSL 306
                 +V +  +++     S  L+  +L  TP ++  A  F +L+   +      T   
Sbjct: 155 AVTFLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEKYTELENTETSHA 214

Query: 307 TKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIR----HIFNVGKQSAFINAKFFSLTAVLG 362
             +        + ++ F  EQ E+++++ +++       N+ K +A   A    L+ ++ 
Sbjct: 215 ASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAANQASLRGLSLIM- 273

Query: 363 DMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLF 422
              F+    +G+ ++  G L+ G +          G+++         + +G  A  ++ 
Sbjct: 274 ---FVQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVIMQKGKVALQKIL 330

Query: 423 ELTDR---------------IPS------ISPTLGKKFVPNKGEIEFKNVSFSYPTRASN 461
            + +                 PS      +SP   K       +I F+NVSFSYP+R + 
Sbjct: 331 SMVESESDALRGRRGETFEIFPSPISGMFVSPVFPK-------QITFENVSFSYPSRPNE 383

Query: 462 QIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLR 521
               N+S          IVG SG GKST+++LLL+ Y+   G I V   DI       L 
Sbjct: 384 YALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLL 443

Query: 522 RHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKC---FCHNFITKFPNSYDTI 578
            ++++V+Q   L + ++ +N+   L  K       SI + C        +   P+   T+
Sbjct: 444 ENITLVEQSCTLFNDSLLNNLL--LTAKDDNKNEASIKRACQMALLEKLLFDLPDGLSTV 501

Query: 579 LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-----NYTFGKLMK 633
           +G +G  LSGGQ+QR+A+ARA+++   +LILDE+ SALD+     +     N+  GK   
Sbjct: 502 IGSNGISLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLLMEVIRNWRAGK--- 558

Query: 634 SKSITIISIAHRLSTIRRSENVIVLGNDGSVAE-----------VGKFKELY-----ADP 677
               T I + H LS I   ++ + L  DG V E            G+F EL+     +DP
Sbjct: 559 ----TTIILTHELSHI-LDDDYLYLMEDGKVGEHGYKRDLLSYTSGRFTELHNAVIPSDP 613

Query: 678 GS-ELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESD 720
            + E S   HEKA R   ++ T     I  EE+   +N+    D
Sbjct: 614 SAIEAS---HEKAIRLNTEETTGSG--IVSEESEEEDNTVVSYD 652

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 151/544 (27%), Positives = 264/544 (48%), Gaps = 42/544 (7%)

Query: 173  LVGVSLLVGTAA----NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLI 228
             VG+  L+G A+    N   +ILL   + R   +L  N+    ++   +FF+   +G ++
Sbjct: 1006 FVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRIL 1065

Query: 229  SRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISIS-PQLSAFLLFLTPPVMLSASY 287
            +R S+D   V  +L       FK++    + + ++I+IS P    F LFL    M+   Y
Sbjct: 1066 NRFSADIDTVDSTLQMVFMVFFKSIFSYLITV-ILITISMPLFLVFCLFL----MVIYIY 1120

Query: 288  FGRLIRNNSRDLQEATG----SLTKVAEEQFSGIKTVQSF----VAEQKEIKRYNHAIRH 339
            + +L    SR+L+  T      +  +  E   G+  ++++    + +    +R    I  
Sbjct: 1121 YQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERVQFNINC 1180

Query: 340  IFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGS 399
            +F+    + +++ +  ++ A++  ++ ++ L   S +     L+ G +   M Y     +
Sbjct: 1181 VFDYRSTNRWLSIRLQTIGALMVLITGMLSL---STISSSKPLTAGMVGLLMSYVLQVTT 1237

Query: 400  SIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF-----VPNKGEIEFKNVSFS 454
            S+  +      I  G  +  R+ E  + +PS +  +   +      P+KG I+FKN S  
Sbjct: 1238 SLMWIVRSSVMIETGIVSVERIMEYCE-LPSEAEQIVDDYRPASNWPSKGAIQFKNYSTR 1296

Query: 455  YPTRAS-NQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
            Y  RA+ + + KN+S  I+ G  V IVG +G GKST+   L R   P  G I +DG DIS
Sbjct: 1297 Y--RANLDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDIS 1354

Query: 514  KVSSKSLRRHMSIVQQEPVLMSGTIRDNIT-YGLVEKPTQDEVRSITK-----KCFCHNF 567
            K+    LR H++I+ Q+     GT+R N+  + +      D   +++      K      
Sbjct: 1355 KIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEES 1414

Query: 568  ITKFP-NSYDTI-LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
             ++ P N Y  + +   G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++DVE++  I 
Sbjct: 1415 GSELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKIIQ 1474

Query: 626  YTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
             T  +    +  TII+IAHR+ T+  S+ ++VL   G V E      L AD  S L   L
Sbjct: 1475 ATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPASLLADK-STLFYQL 1530

Query: 686  HEKA 689
             EKA
Sbjct: 1531 CEKA 1534

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 118/521 (22%), Positives = 222/521 (42%), Gaps = 74/521 (14%)

Query: 210 KTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSL--TQKVSDGFKAMLCGSVGIGMMISIS 267
           K  H   E F     GD+++ +S D   + R    +Q +      M+   + + +++  +
Sbjct: 379 KLSHSAKEEFST---GDILNYISVDVLKIQRFFENSQSIIGAPIQMVIVLISLYLLLGKA 435

Query: 268 PQLSAFLLFLTPPV--MLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVA 325
                  +F+  P+  MLS     R ++   +   +   +  K   E  + +K+++ +  
Sbjct: 436 TVGGLIPMFIMMPINAMLS-----RKVKGLFKTKMQYNDARIKTTSEMLNSMKSIKLYAW 490

Query: 326 EQKEIKRYNHAIRH---IFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSL 382
           E+  +KR ++ IR+   + N+ K     N  +F+   V      LVV    S   ++  +
Sbjct: 491 EKPMLKRLSY-IRNDLELANLKKIGIATNLIYFAWNCVP-----LVVTC--STFAIYSLI 542

Query: 383 SIGDLTAYMMYTEYT-----GSSIFGLSTFYSEIMQGAGAASR-----LFELTDRIPSIS 432
           +   LT  +++   +       +I+ +    S+I++   +  R     L E  DR  S  
Sbjct: 543 TDNPLTPELVFPSLSLFNILNDAIYTIPATISQIIETNVSIGRVKKFLLGEELDR--SFI 600

Query: 433 PTLGKKFVPNKGEIEFKNVSFSYPTRASNQI----------------FKNLSFKIDAGSN 476
             +  K   +   +E  N +F + ++AS Q                  K++ F   A  N
Sbjct: 601 EEIADKHDESPFAVEILNATFLWKSKASLQAGDGTDEETSIGSTVVALKDIDF-FRAKKN 659

Query: 477 V--CIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQ--QEPV 532
           V  C+VG  G GK+T+   +L       GQ+         +  K + R  S+    QE  
Sbjct: 660 VLTCVVGRVGSGKTTLLKSIL-------GQLPCTSGSQKAIPPKLIIRGESVAYCPQEAW 712

Query: 533 LMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQ 592
           +M+ +I++NI +G   +  +       K C         P+  +T++G  G  LSGGQK 
Sbjct: 713 IMNDSIKENILFG--HRYDETFYNLTVKACELRPDFKILPDGDNTLVGEKGITLSGGQKA 770

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTF----GKLMKSKSITIISIAHRLST 648
           R+++ARA+  +  I +LD+  SA+D     +I +        L+K+K+I + +  + +S 
Sbjct: 771 RLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKAIILTT--NDISV 828

Query: 649 IRRSENVIVLGNDGSVAEVGKFKELYADPGSE--LSKLLHE 687
           +  S+ + VL  DG + E   + E   D   +  L KLL E
Sbjct: 829 LEHSDRIYVL-QDGRIIEESTYAEAIEDNDVKPFLYKLLKE 868

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  160 bits (406), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 156/573 (27%), Positives = 268/573 (46%), Gaps = 91/573 (15%)

Query: 163  FGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNN 222
            + L +Y  I L G +  VG+   +   I     S ++ A L    + K +H    FFD  
Sbjct: 1160 YYLIMYFMIGLTGAT--VGSLKTFLTYIFGINASRKIFAML----LNKVIHSKLRFFDTT 1213

Query: 223  KVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVM 282
             +G +++R S D   V + LT  ++  F + +     I ++  I+PQ      F    ++
Sbjct: 1214 PIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTIILISWITPQ------FFVVAIL 1267

Query: 283  LSASYF--GRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKRYNH 335
            +S  Y+  G      SR+L+    S+TK        E   G+ T+++F  E + +K    
Sbjct: 1268 ISIMYYLVGYFYMAGSRELKR-LDSITKSPIYQHFSETLVGVTTIRAFGDEMRFLKE--- 1323

Query: 336  AIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL-HGSLSIGD-------- 386
               ++F + +     N  FF L      +SF + +  GS++V   G   + D        
Sbjct: 1324 ---NLFKIDEN----NKPFFYLWVANRWLSFRIDMI-GSFVVFGAGVFILADIKNIDSGM 1375

Query: 387  ----LTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRL----------FELTDRIPSIS 432
                LT  + +TE        L  FYSE+     +  R+          +++ D I    
Sbjct: 1376 AGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTP 1431

Query: 433  PTLGKKFVPNKGEIEFKNVSFSYPTRASN--QIFKNLSFKIDAGSNVCIVGPSGRGKSTI 490
            PT+     P++G+IE  ++S  Y   A+N  ++ KN+SF ++  S V +VG +G GKSTI
Sbjct: 1432 PTVW----PDEGKIEVNDLSLRY---AANLPRVIKNVSFTVEPNSKVGVVGRTGAGKSTI 1484

Query: 491  ASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT------- 543
             + L R+ +P +G I +D  DI+ +    LRR ++I+ Q+P L +GT++ N+        
Sbjct: 1485 ITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPTLFAGTLKFNLDPYDEYND 1544

Query: 544  ---------YGLVE-KPTQDEVRSITKKCFCH-NFITKFPNSYDTILGPHGTLLSGGQKQ 592
                       LV  +    E  +++ +   H N   +F +  + I    G  LS GQ+Q
Sbjct: 1545 KDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLDLSNEITEGGGN-LSQGQRQ 1603

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTF-GKLMKSKSITIISIAHRLSTIRR 651
             I +AR+L++ P IL+LDEAT+++D ES+  +  T  G+   S   TI++IAHRL ++  
Sbjct: 1604 LICLARSLLRNPKILLLDEATASIDYESDARLQATIRGEFGNS---TILTIAHRLRSVID 1660

Query: 652  SENVIVLGNDGSVAEVGKFKELYADPGSELSKL 684
             + ++V+ + G V E      L  +  SE  K+
Sbjct: 1661 YDKILVM-DAGEVIEYDHPYSLLLNRNSEFYKM 1692

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 110/235 (46%), Gaps = 10/235 (4%)

Query: 440 VPNKGE-IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYY 498
           V N+G+ + F N + S+ T  S    +NL+     G    ++G +G GK+++   LL   
Sbjct: 752 VDNEGKKLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEM 811

Query: 499 NPTTGQIFV---DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEV 555
           +   G+I V   + +     +S      ++   Q   L++ T+R+NI +       ++  
Sbjct: 812 HICQGRIIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFN--SSFDENRY 869

Query: 556 RSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
             + + C              T +G  G  LSGGQKQRI++ARAL      L+LD+  SA
Sbjct: 870 HKVVEACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSA 929

Query: 616 LDVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
           +D  +   I  N   G LM  +  T I ++H ++   R+  ++V+  DG V + G
Sbjct: 930 VDSHTASWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 982

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  160 bits (406), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 140/519 (26%), Positives = 243/519 (46%), Gaps = 55/519 (10%)

Query: 202  RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
            R+   ++ K +H    F D+  +G +++R S D   V + LT  +   F  ++     I 
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 262  MMISISPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVA-----EEQF 314
            ++  I+PQ      FL   V++   Y+  G    N SR+L+    S+TK        E  
Sbjct: 1201 LITFITPQ------FLFVAVLVCVLYYLVGYFYINTSRELKRIE-SITKSPIYQHFSETL 1253

Query: 315  SGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGS 374
            +G+ T+++F     EI+   H +  I    K   ++      L   +  +  L++   G 
Sbjct: 1254 TGVATIRAF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSGV 1310

Query: 375  YLVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIP 429
            +++L+       ++   LT  + +TE        L  FYS +     +  RL E  D +P
Sbjct: 1311 FILLNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMD-VP 1365

Query: 430  SISPTLG----KKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGR 485
                  G        P +G+IE K++S  Y      ++ K +SF I+  + V IVG +G 
Sbjct: 1366 QEPYNEGTITTSTNWPTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGRTGA 1424

Query: 486  GKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT-Y 544
            GKSTI + L R+  P TG I +DG DI+ +  ++LRR ++I+ Q+P L +GTIR N+  +
Sbjct: 1425 GKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPF 1484

Query: 545  GLVEKPTQDEVRSITKKCFCHN----------------FITKFPNSYDTILGPHGTLLSG 588
            G  + P ++  R + +     +                 + KF N  + I    G  LS 
Sbjct: 1485 G--KYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLNLENEI-TEGGNNLSQ 1541

Query: 589  GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLST 648
            GQKQ + +ARAL++ P +++LDEAT+++D  S+  I  T   +      T+++IAHRL +
Sbjct: 1542 GQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRS 1599

Query: 649  IRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
            +   + ++V+ + G V E  +   L  D  S    +  +
Sbjct: 1600 VIDYDKILVM-DAGEVIEYDQPYTLLLDKNSHFYSMCEQ 1637

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 111/236 (47%), Gaps = 9/236 (3%)

Query: 438 KFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRY 497
           K  P+  ++ F+N + ++     +   K+L      G    ++GP+G GK+++   LL  
Sbjct: 705 KVAPDGNKLAFENATIAWSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGE 764

Query: 498 YNPTTGQIFV---DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDE 554
               +G+I V   D +    + S  +   ++   Q   L++ T+R+NI +       +D 
Sbjct: 765 MQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNILF--YSPYNEDR 822

Query: 555 VRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
            + +   C        F     T +G  G  LSGGQKQRI++ARAL      L+LD+  S
Sbjct: 823 YKEVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLS 882

Query: 615 ALDVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
           A+D  +   I  N   G LM+ ++  ++S  H ++   ++  ++V+  +G +   G
Sbjct: 883 AVDSHTAAWIYDNCITGPLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRG 936

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  160 bits (406), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 148/562 (26%), Positives = 268/562 (47%), Gaps = 68/562 (12%)

Query: 174  VGVSLLVGTA-ANYG--RVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISR 230
            + +  L+G A A  G  +V++   L  +   ++  +++KK MH    FFD+  +G +++R
Sbjct: 1109 LSIYFLIGIAQALLGSLKVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPIGRIMNR 1168

Query: 231  LSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF-- 288
             S D   + + L   V   F +++     I ++  I+PQ      FL+  ++++  Y+  
Sbjct: 1169 FSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFITPQ------FLSVAILVTGLYYLI 1222

Query: 289  GRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAE----QKEIKRYNHAIRH 339
            G      SR+ +    S+TK        E   G+ T+++F  E    Q+ + + +   R 
Sbjct: 1223 GYFYLAASREFKRF-DSITKSPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDENNRP 1281

Query: 340  IFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLV-----LHGSLSIGDLTAYMMYT 394
             F +   + +++ +   + A       LVV   GS+++     +   ++   LT  + +T
Sbjct: 1282 FFYLWVANRWLSFRIDMVGA-------LVVFGSGSFIIWNIKNIDAGMAGISLTYAISFT 1334

Query: 395  EYTGSSIFGLSTFYSEIMQGAGAASRLFELT--DRIPSISPTLGKK-FVPNKGEIEFKNV 451
            E        L   YS +     +  RL E    ++ P    T       P +G+IE  ++
Sbjct: 1335 E----GALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDL 1390

Query: 452  SFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQD 511
            S  Y      ++ KN++F +   + + IVG +G GKSTI + L R+ +P TG I +D  D
Sbjct: 1391 SLRY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNID 1449

Query: 512  ISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT-YG------------LVEKPTQDEVRSI 558
            I+ ++   LRR ++I+ Q+P L +GTI+ N+  YG             V    +D   +I
Sbjct: 1450 ITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNI 1509

Query: 559  TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
              +      + KF N  + I    G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D 
Sbjct: 1510 ETESISSQNVNKFLNLNNEI-SEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDY 1568

Query: 619  ESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPG 678
             S+  I  T  K   S   TI++IAHRL ++   + ++V+       + G+ KE Y  P 
Sbjct: 1569 NSDAKIQETIRKEFNSS--TILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHP- 1617

Query: 679  SELSKLLHEKATRSERQQNTAE 700
               S LL++K+      +N+ E
Sbjct: 1618 --YSLLLNKKSIFYNMCENSGE 1637

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 115/240 (47%), Gaps = 13/240 (5%)

Query: 441 PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
           P   ++EFKN + S+ + A +   K+L+     G    ++GP+G GK+++   LL     
Sbjct: 704 PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKI 763

Query: 501 TTGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR- 556
             G+I V   D  +   V        ++   Q   L++ T+R+NI   L   P  +E R 
Sbjct: 764 MEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNI---LFNSP-YNEARY 819

Query: 557 -SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
            S+ + C              T +G  G  LSGGQKQR+++ARA+      ++LD+  SA
Sbjct: 820 TSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSA 879

Query: 616 LDVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
           +D  +   I  N   G LM  +  T I ++H ++   ++ +++V+  DG V + G   EL
Sbjct: 880 VDSHTALWIYDNCITGPLMDGR--TCILVSHNIALTLKNADLVVILEDGKVKDQGDPMEL 937

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 147/544 (27%), Positives = 265/544 (48%), Gaps = 50/544 (9%)

Query: 172  SLVGVSLLVGTAA--NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLIS 229
            SL+GV    G+AA  N   +++L   S R   +L  ++ K  +     FF+   VG +I+
Sbjct: 1025 SLIGV----GSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIIN 1080

Query: 230  RLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFG 289
            R SSD   V  SL    S  FK++L   V + ++    P    F +FL    +   +++ 
Sbjct: 1081 RFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGIYIYYQTFYI 1140

Query: 290  RLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEI----KRYNHAIRHIFNVGK 345
             L R   R +  +   +  +  E  +G   + ++   ++ I    ++  + I  +FN   
Sbjct: 1141 VLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRS 1200

Query: 346  QSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLS 405
             + +++ +  ++ A +   + ++ LA  +      S  +G L +Y +  E TGS  + + 
Sbjct: 1201 TNRWLSVRLQTIGATIVLATAMLTLATMNTKKQLSSGMVGLLMSYSL--EVTGSLTWIVR 1258

Query: 406  TFYSEIMQGAGAASRLFELTDRIPSISPTLG-----KKFVPNKGEIEFKNVSFSYPTRAS 460
            T    I     +  R+ E  + +PS + ++       K  P++G IEFK+ S  Y     
Sbjct: 1259 TTVM-IETNIVSVERIVEYCE-LPSEAQSINPEKRPDKNWPSRGSIEFKDYSTKYRENL- 1315

Query: 461  NQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSL 520
            + + K+++ KI+    V IVG +G GKST++  L R   PT G+I +DG +IS +    L
Sbjct: 1316 DPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISDLGLFDL 1375

Query: 521  RRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKF--------- 571
            R H++I+ Q+     GT++ N+      + ++DE++   +       + K          
Sbjct: 1376 RSHLAIIPQDAQAFEGTVKTNL--DPFNRYSEDELKKAVELAHLKPHLEKMLENEPSDSE 1433

Query: 572  -----PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
                  +  D  +  +G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E++  I  
Sbjct: 1434 ESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMETDKIIQD 1493

Query: 627  TFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
            T  +  K +  TI++IAHR+ T+  S+ +IVL ++GSV E       +  P    SKLL 
Sbjct: 1494 TIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKE-------FDSP----SKLLS 1539

Query: 687  EKAT 690
             KA+
Sbjct: 1540 NKAS 1543

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 124/489 (25%), Positives = 221/489 (45%), Gaps = 65/489 (13%)

Query: 286 SYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRH---IFN 342
           ++  R ++  S+          K   E  + IK+++ +  E+  +KR NH +R+   + N
Sbjct: 451 AFLSRKVKKLSKTQMRYKDMRIKTITELLNAIKSIKLYAWEEPMMKRLNH-VRNDMELKN 509

Query: 343 VGKQSAFINAKFFSLTAVLGDMSFLVVLA-YGSYLVLHGS-LSIGDLTAYMMYTEYTGSS 400
             K     N  +F+   V      +V  + +G + + + S LS   +   +       S+
Sbjct: 510 FRKIGIVSNLIYFAWNCV----PLMVACSTFGLFSLFNDSPLSPAIVFPSLSLFNILNSA 565

Query: 401 IFGLSTFYSEIMQGAGAASRL--FELTDRIPS-----ISPTLGKKFVPNKGEIEFKNVSF 453
           I+ + +  + I++ + +  RL  F L+D I       I P++ ++ +P    IE  N++F
Sbjct: 566 IYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTLP---VIEMNNITF 622

Query: 454 SYPTR---ASNQI------------------FKNLS-FKIDAGSNVCIVGPSGRGKSTIA 491
            + ++   AS+Q+                   KN+  F+   G+ VCIVG  G GKST  
Sbjct: 623 LWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKSTFL 682

Query: 492 SLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI--VQQEPVLMSGTIRDNITYGLVEK 549
             +L       GQ+         +  K + R  S+    QE  +M+ ++++NI +G   K
Sbjct: 683 KAIL-------GQLPCMSGSKESIPPKLIIRSSSLAYCSQESWIMNASVKENILFG--HK 733

Query: 550 PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
             +       K C     +   P+  +T++G  G  LSGGQK R+++ARA+  +  I +L
Sbjct: 734 FDKAYYDLTIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLL 793

Query: 610 DEATSALDVE-SEGAINYTF-GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEV 667
           D+  SA+D E S+  I Y   GK    K+ TII   + +S ++ S+ +  L N G + E 
Sbjct: 794 DDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQ 852

Query: 668 GKFKELY--ADPGSELSKLLHEKATR----SERQQNTAEDQEIDPEETIN---IENSTPE 718
           G +  +    +  S+L KLL E  +     +E   +T    E D +E +    +E+ T +
Sbjct: 853 GNYDSVMNRENSTSKLKKLLEEFDSPIDKGNENDTHTGHRSESDIDEPLQLKVVESETED 912

Query: 719 SDITQELLE 727
             IT   LE
Sbjct: 913 EVITDSELE 921

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 155/555 (27%), Positives = 251/555 (45%), Gaps = 66/555 (11%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F       L   T + +  +  + VLS + +  LRA  +K+ +H    + D 
Sbjct: 964  SFYMGLYSFFVFFSYIL---TTSQFTLLCCIGVLSSKWL-NLRA--VKRILHTPMSYLDT 1017

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISIS-PQLSAFLLFLTPP 280
              +G +++R + D   +   LT+ V           VG+ +M  I  P  +  + FL   
Sbjct: 1018 TPLGRILNRFTKDTDSLDNELTESVR-MLLYQFANIVGVCIMCIIYLPWFAIAIPFLFVG 1076

Query: 281  VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340
             +L A ++    R   R        +     E   G+ T++S+ +E + I + +  I  +
Sbjct: 1077 FVLIADHYQSSGREIKRLEAIQRSFVYNNFNEVLGGMDTIKSYRSENRFIAKSDFLIDKM 1136

Query: 341  FNVGKQSAFIN---AKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
               G     +    A F  + AV    + ++ L   +      + S+G L  Y++     
Sbjct: 1137 NEAGYLVVAVQRWVAIFLDVIAVC--FALIITLLCVTRAFPISAASVGVLLTYVLQLP-- 1192

Query: 398  GSSIFGLSTFYSEIMQGAGAASRL--------FELTDRIPSISPTLGKKFVPNKGEIEFK 449
               + G+    ++      +A RL         E   R P +SP    +  P KGEI F+
Sbjct: 1193 -GLLNGVLRSLTQTENDMNSAERLVTYATELPLEADYRKPEVSPP---EEWPTKGEIHFE 1248

Query: 450  NVSFSY----PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
            NV FSY    PT     + KNLS  I +G  + I G +G GKSTI S L R    ++G++
Sbjct: 1249 NVDFSYRPGLPT-----VLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKM 1303

Query: 506  FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN----------------ITYGLVEK 549
             +D  DIS +    LRR ++I+ Q+PVL  GTIR N                +  G +E+
Sbjct: 1304 IIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQ 1363

Query: 550  PTQDEVRSIT-KKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI 608
               +E+++    +   H+ + KF    D ++   G   S G++Q +A+ RAL+++  ILI
Sbjct: 1364 KELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGERQLLALTRALVRQARILI 1421

Query: 609  LDEATSALDVESEGAINY----TFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSV 664
            LDEATS++D E++G I       FG        TI+ IAHRL TI   + ++VL   G V
Sbjct: 1422 LDEATSSVDYETDGKIQARIVEEFGH------CTILCIAHRLKTILTYDRILVL-EKGEV 1474

Query: 665  AEVGKFKELYADPGS 679
            AE    K L+A   S
Sbjct: 1475 AEFDTPKTLFAQEDS 1489

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 110/212 (51%), Gaps = 22/212 (10%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F +L+F+I  G  + +VGP G GK+++ +    + N  +G+I ++G              
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQINGD------------- 695

Query: 524 MSIVQQEPVLMSGTIRDNITYGL-VEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH 582
             ++   P + + +++DNI +G    K   DEV    + C   + +   P    T +G  
Sbjct: 696 -LLLCGYPWIQNASVKDNIIFGSPYNKAKYDEV---IRVCSLKSDLDILPAGDLTEIGER 751

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIIS 641
           G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  F  L+K K  T I 
Sbjct: 752 GITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDK--TRIL 809

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
             H+LS + R+  VIVLGNDGS  ++G  +EL
Sbjct: 810 ATHQLSLLERASRVIVLGNDGSF-DIGTVEEL 840

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 258/545 (47%), Gaps = 43/545 (7%)

Query: 166  NLYEFISLVGVSLLVGTAANYGR-VILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKV 224
            ++++F+++  +  L   A N  R +I+L   S R    L  ++ K  +    +FF+   +
Sbjct: 1000 DVWKFVAVYALIGLGSAAFNIFRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPI 1059

Query: 225  GDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLS 284
            G +I+R SSD   V  +L    S  F+++L     I  +I +S  +  FLLF    +M+ 
Sbjct: 1060 GRVINRFSSDIDSVDVNLQNVFSIFFRSILDY---ILTVILVSVAMPWFLLF-NALIMII 1115

Query: 285  ASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQS-FVAEQKEIKRYNHAIRHIF-N 342
              Y+ +L    SR+L+     LT +A   +S I ++ S  +  Q  I  YNH+    F N
Sbjct: 1116 YFYYEKLYIVQSRELKR----LTSIA---YSPIISLMSETLGGQMVISAYNHSKMFKFMN 1168

Query: 343  VGKQSAFINAKFF------SLTAVLGDMSFLVVLAYG--SYLVLHGSLSIGD--LTAYMM 392
            + +    +N  F        L+  L  +   ++L  G  +   L  S  IG   +   M 
Sbjct: 1169 IERVQYNLNVLFTFRSTNRWLSIRLQSIGAFIILCTGLLALTTLRTSSPIGSGLIGLLMS 1228

Query: 393  YTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFV----PNKGEIEF 448
            Y     S++  +     +I     +  R+ E     P     +    V    P +G IEF
Sbjct: 1229 YVLQVTSALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIEF 1288

Query: 449  KNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVD 508
            KN + +Y    S  + KN+S  I+    V IVG +G GKST++  L R      G IF+D
Sbjct: 1289 KNYTTTYRANLS-PVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFID 1347

Query: 509  GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFI 568
            G DIS++    LR +M+I+ Q+     GT+R N+     +K T  E+ ++ +       +
Sbjct: 1348 GVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNL--DPFQKHTDVELWNVIELSHLKPHV 1405

Query: 569  TKFP---------NSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
             +           +  D  +  +G+ LS GQ+Q + +ARAL+ +  +L+LDEAT+A+DVE
Sbjct: 1406 LRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVE 1465

Query: 620  SEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGS 679
            ++  I  T     K +  TI++IAHRL TI  ++ ++VL + G V E    K L +D  +
Sbjct: 1466 TDKIIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVL-DAGGVKEFDSPKNLLSDEST 1522

Query: 680  ELSKL 684
               +L
Sbjct: 1523 LFYQL 1527

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 156/336 (46%), Gaps = 60/336 (17%)

Query: 431 ISPTLGKKFVPNKGE--------IEFKNVSFSYPTRA---------------SNQI-FKN 466
           +S  L + F+   G+        +E +N +F + ++A               + Q+  KN
Sbjct: 584 LSEELDRSFIEQTGKPANEYIPAVEIENATFLWKSQAQLINSENDDSEANIETTQVALKN 643

Query: 467 LS-FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI-FVDGQDISKVSSKSLR-RH 523
           +  F     S  C++G  G GK+T+   +L       GQ+  + G   S     S+R   
Sbjct: 644 IDHFTASPKSLTCVIGKVGSGKTTLLKAIL-------GQLPCISGSKESISPKLSIRGES 696

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHG 583
           ++   QE  +M+ TI++NI +G   K  +         C         P+   T++G  G
Sbjct: 697 IAYCPQEAWIMNDTIKENILFG--HKFDETYYTLTVAACELLADFDILPDGDQTLVGEKG 754

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-----SEGAINYTFGKLMKSKSIT 638
             LSGGQK R+++ARA+  +  I +LD+  SA+D        E  ++   G L+++K  T
Sbjct: 755 ISLSGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNK--T 811

Query: 639 IISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY----ADPGSELSKLLHE-KATRSE 693
           +I   + +S ++ S+ +  L N G + E G + ++     +D  S++S LL +   + ++
Sbjct: 812 VILSTNTVSVLKHSQLIYALEN-GIIVERGNYNDIIESANSDDESKISALLKQFDVSLAK 870

Query: 694 RQQN----TAEDQEIDPEETINIENSTPESDITQEL 725
           R+ +    T++ Q   P++      ST +SD+ +++
Sbjct: 871 RESSNLSLTSKSQTAIPQD------STTKSDLIEDV 900

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  157 bits (398), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 147/546 (26%), Positives = 255/546 (46%), Gaps = 58/546 (10%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F    G    + T++ +    LL  +  R    L    + + +H    + D 
Sbjct: 949  SFYMGLYSFFVFAGY---LFTSSQF---TLLCAIGIRASKWLNLKAVHRILHTPMSYLDT 1002

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGS---VGIGMMISIS-PQLSAFLLFL 277
              +G +++R + D    + SL  ++++  + ML  +   VG+ +M  I  P  +  + FL
Sbjct: 1003 TPLGRILNRFTKD----TDSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAIAIPFL 1058

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
                 L   ++    R   R        +     E   G+ T++S+ +E++ + + ++ I
Sbjct: 1059 FIGFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSDYLI 1118

Query: 338  RHIFNVGKQSAFIN---AKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYT 394
              +   G  S  +    A F  L AV    + ++ L   +      ++S+G L  Y++  
Sbjct: 1119 NKMNEAGYLSVALQRWVAIFLDLVAVC--FALIITLLCVTRAFHISAVSVGVLLTYVLQL 1176

Query: 395  EYTGSSIFGLSTFYSEIMQGAGAASRL--------FELTDRIPSISPTLGKKFVPNKGEI 446
                  + G+    ++      +A RL         E   R P +SP    +  P++G+I
Sbjct: 1177 P---GLLNGVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSP---PENWPSEGKI 1230

Query: 447  EFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF 506
            EFK+V FSY       + K+L   I +G  + I G +G GKSTI S L R    + G+I 
Sbjct: 1231 EFKHVDFSYRP-GLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEIL 1289

Query: 507  VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN----------------ITYGLVEKP 550
            +D  DISK+    LRR ++I+ Q+PVL  GTIR N                +  G +E+ 
Sbjct: 1290 IDNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHDDDLLWDSLVRGGAIERA 1349

Query: 551  TQDEVRS-ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
              +++++    K   H  + KF    D ++   G   S G++Q +A+ RAL+++  +LIL
Sbjct: 1350 ALNKIKNQKVDKDGTHADMFKF--HLDQLVEEEGANFSLGERQLLALTRALVRQAKVLIL 1407

Query: 610  DEATSALDVESEGAINYTFGKLMKS-KSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
            DEATS++D E++G I     +++K     TI+ IAHRL+TI   + ++VL   G VAE  
Sbjct: 1408 DEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEFE 1463

Query: 669  KFKELY 674
            K K L+
Sbjct: 1464 KPKVLF 1469

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 104/207 (50%), Gaps = 22/207 (10%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F +++  I  G  + +VGP G GK++  + L  + N T G+I V+G              
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNGD------------- 673

Query: 524 MSIVQQEPVLMSGTIRDNITYGL-VEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH 582
             ++   P + + T+RDNI +G   +K   +EV    + C     +   P    T +G  
Sbjct: 674 -LLLCGYPWIQNATVRDNILFGSPYDKKKYEEV---LRCCSLEADLDILPAGDSTEIGER 729

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIIS 641
           G  LSGGQK RI +AR + KK  I + D+  SA+D    +  ++  F  L+K++  T I 
Sbjct: 730 GITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNE--TRIL 787

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVG 668
             H+LS + R+  VIVLG DGS  E+G
Sbjct: 788 ATHQLSLLERASRVIVLGTDGSF-EIG 813

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  157 bits (397), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 140/509 (27%), Positives = 238/509 (46%), Gaps = 50/509 (9%)

Query: 203  LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVG--- 259
            L  N + + +H    + D   +G +++R + D   +   LT+ V      ++   VG   
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKDTDSLDNELTESVR-----LMLFQVGNIV 1001

Query: 260  --IGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGI 317
              I M I   P  +  + FL    +L A ++    R   R        +     E   G+
Sbjct: 1002 AVIVMCIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEVLGGM 1061

Query: 318  KTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLV 377
             T++S+  +    KR+     ++ N   ++ ++        ++  DM  ++     + L 
Sbjct: 1062 DTIKSYKGQ----KRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVAIIFALIIALLS 1117

Query: 378  LHGSLS-----IGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGA----GAASRL-FELTDR 427
            + G  S     +G L  Y++      +S+    T     M  A      A++L  E   +
Sbjct: 1118 VTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVNYATKLPLEAAYK 1177

Query: 428  IPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGK 487
             P +SP    +  P+KGEI F +V F+Y +     + K L+  I +G  + I G +G GK
Sbjct: 1178 KPELSPP---ESWPSKGEIRFLDVDFAYRS-GLPVVLKGLNLDIKSGEKIGICGRTGAGK 1233

Query: 488  STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN------ 541
            STI S L R    T+G+I +D  DIS +    LRR +SI+ Q+PVL  GTIR N      
Sbjct: 1234 STIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSN 1293

Query: 542  ----------ITYGLVEKPTQDEVRS-ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQ 590
                      I  G +EK + ++V+S +  +   H  + KF    D ++   G+  S G+
Sbjct: 1294 YDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSLGE 1351

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIR 650
            +Q +A+ RAL+++  ILILDEATS++D E++G I      + +  + TI+ IAHRL TI 
Sbjct: 1352 RQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRI--VEEFDNCTILCIAHRLKTIL 1409

Query: 651  RSENVIVLGNDGSVAEVGKFKELYADPGS 679
            + + ++VL   G +AE  +  +L++D  S
Sbjct: 1410 QYDRILVL-EKGVIAEFDQPFKLFSDKDS 1437

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 117/246 (47%), Gaps = 24/246 (9%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F NL F+I  G  + I GP G GKS++ +    + N T G+I V+G              
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNGD------------- 634

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHG 583
             +    P + + T++DNI +G      +++  ++ + C     +   P    T +G  G
Sbjct: 635 -LLFCGYPWIQNATVKDNILFG--SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIISI 642
             LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     L++ K  T I  
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRILA 749

Query: 643 AHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSE---RQQNTA 699
            H+LS I +++ VIVLG DGS  ++G   EL       L+ LL    T  E   R ++  
Sbjct: 750 THQLSLIEKADRVIVLGTDGSF-DIGTVDEL-KQRNQTLTNLLDYSTTERENENRDESPV 807

Query: 700 EDQEID 705
            D+E D
Sbjct: 808 ADEEND 813

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 157/558 (28%), Positives = 255/558 (45%), Gaps = 63/558 (11%)

Query: 168  YEFISLVGVSLLVGTAA----NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNK 223
            Y  +  +GV   +G       N   + +L   S R   +L   + K  M     FF+   
Sbjct: 989  YNLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTP 1048

Query: 224  VGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVML 283
             G +I+R SSD   V  +L    S  F+++L   + +   I ++  +  F L L   +++
Sbjct: 1049 TGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITV---ILVTFNMPLFFL-LNAGLLV 1104

Query: 284  SASYFGRLIRNNSRDLQEATG----SLTKVAEEQFSGIKTVQSFVAEQKEIKRYNH---- 335
               Y+       SR+L+  T      +  +  E  SG  T+ ++    ++I+R++H    
Sbjct: 1105 IYLYYQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYE 1160

Query: 336  ----AIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYG----SYLVLHGSLSIGDL 387
                +I   FN    + +++ +  S+ A       L+VL+ G    S L     LS G +
Sbjct: 1161 RIQFSINCFFNYRSSNRWLSVRLQSIGA-------LIVLSTGLLALSSLGTDHQLSSGLV 1213

Query: 388  TAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF-----VPN 442
               M Y     SS+  +      I     +  R+ E  D  P  +P + ++       PN
Sbjct: 1214 GLLMSYALQVTSSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPN 1272

Query: 443  KGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTT 502
            +G+IEFKN S SY     + + K+++  I  G  + +VG +G GKST++  L R   PT 
Sbjct: 1273 QGQIEFKNYSTSYRENL-DPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTA 1331

Query: 503  GQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR---SIT 559
            G I +D  DI+ +  + LR H++I+ Q+     GTIR N+     EK + D++     ++
Sbjct: 1332 GTISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNL--DPFEKFSDDDLWHAIELS 1389

Query: 560  KKCFCHNFITKFPNS-------------YDTILGPHGTLLSGGQKQRIAIARALIKKPTI 606
               F    I K  N               D  +   G+ LS GQKQ + +ARAL+ K  I
Sbjct: 1390 HLKFHLETIAKEINDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKI 1449

Query: 607  LILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            L+LDEAT+++DVE++  I  T  K    +  TI++IAHRL T+  S+ +IVL + G V E
Sbjct: 1450 LVLDEATASVDVETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL-DGGEVKE 1506

Query: 667  VGKFKELYADPGSELSKL 684
              K + L     S   KL
Sbjct: 1507 FDKPETLLEQKDSIFYKL 1524

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 127/252 (50%), Gaps = 21/252 (8%)

Query: 468 SFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIV 527
           +F++   S +C+VG  G GKSTI   +L       GQ+     +   +S +      ++ 
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCIL-------GQLPCISGNNDHLSPQFQINATTVA 691

Query: 528 Q--QEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTL 585
              QE  +M+ +++DNI +G   K  +   ++  K C     I   P+  +T++G  G +
Sbjct: 692 YCPQEAWIMNASVKDNILFG--HKYDEAFYKATIKACQLLPDIKVLPDGDETMVGEKGIV 749

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGK---LMKSKSITIIS 641
           LSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I     +   L+K KSI + +
Sbjct: 750 LSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKSIVLAT 809

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD-PGSELSKLLHEKATRSERQQNTAE 700
             + +S ++ S  + +L N  S+A+ G + ++  +   S+L  +LHE     E+    A 
Sbjct: 810 --NTISVLKHSTKIYLLENK-SIAQEGNYDDIMNNQQDSKLKNILHEFDL--EKPDTPAV 864

Query: 701 DQEIDPEETINI 712
            +  DP   IN+
Sbjct: 865 QEGTDPTSAINL 876

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 150/528 (28%), Positives = 247/528 (46%), Gaps = 88/528 (16%)

Query: 211  TMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVS-DGFKAMLCGSVGIGMMISISPQ 269
             +H    FFD   VG +++R S D   + + L   +    F  + C S+ + +++ I+P+
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQCSSILL-LIVVITPR 1140

Query: 270  LSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQS 322
                  F +  V++   Y+  G+     SRDL+    S+TK        E   G+ T+++
Sbjct: 1141 ------FFSVAVIVFILYYFVGKWYLKASRDLKR-IDSITKSPIFQHFSETLVGVCTIRA 1193

Query: 323  FVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAYGSY 375
            F  E++ I      I             N  FF L+  +   +F        +VL  GS+
Sbjct: 1194 FGDEKRFILENMEKIDQN----------NKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSF 1243

Query: 376  LVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT----- 425
            ++ +       L+   LT  +++T+    S   L   YS       +  RL E +     
Sbjct: 1244 ILFNIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEYSSIVQE 1299

Query: 426  -------DRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQ--IFKNLSFKIDAGSN 476
                   D I +++ +      P  G+IE +N+S  Y   ASN   + KN+ FK+D  S 
Sbjct: 1300 KYLGYDEDHIQALNDSSW----PKHGKIEVENLSLRY---ASNLPLVLKNVCFKVDPQSK 1352

Query: 477  VCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSG 536
            V IVG +G GKSTI + L R   P TG I +D QDISK+   +LRR ++I+ Q+PVL +G
Sbjct: 1353 VGIVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAG 1412

Query: 537  TIRDNI----------------TYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILG 580
            TI+ NI                   L+      +V ++ +    HN   KF N    I+ 
Sbjct: 1413 TIKSNIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHN---KFLNLQSEIV- 1468

Query: 581  PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF-GKLMKSKSITI 639
              G  LS G++Q + IAR+L+++  I++LDEATS++D +S+  I      K  KS   TI
Sbjct: 1469 EGGLNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQSIIRSKFNKS---TI 1525

Query: 640  ISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
            ++IAHRL ++   + ++V+ + G + E G   EL  +  S   ++  +
Sbjct: 1526 LTIAHRLRSVIYYDKILVM-DAGEIKEYGHPYELLKNERSTFYRMCRD 1572

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 137/294 (46%), Gaps = 24/294 (8%)

Query: 441 PNKGEIEFKNVSFSYPTRASNQIFK----NLSFKIDAGSNVCIVGPSGRGKSTIASLLLR 496
           P++ +IEFK  +  +     N I K    +L+     G    ++G +G GKS +   LL 
Sbjct: 659 PDRNKIEFKKANLVW-NENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLG 717

Query: 497 YYNPTTGQIFVDG----QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITY-GLVEKPT 551
             +  +G I + G     D+       L    +   Q   L+S TI++NI + G  +K  
Sbjct: 718 ELDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYDKS- 775

Query: 552 QDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
               + +   C  +  +   P    T +G  G  LSGGQKQRI++ARA+      ++LD+
Sbjct: 776 --RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDD 833

Query: 612 ATSALDVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
             SA+D  +   I  N   G+LMK++  T I + H +    R+ +  ++  DG V   G 
Sbjct: 834 CLSAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGT 891

Query: 670 FKELYADP--GSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESDI 721
            KEL        E+++L H+  T +++  N  ++  I   + + I+N+  E DI
Sbjct: 892 IKELQKKGIFKEEIAQLSHQD-TITKKTVNNLDENNIQRSKCV-IDNT--EYDI 941

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 131/493 (26%), Positives = 238/493 (48%), Gaps = 55/493 (11%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            +++K +H    FFD+  +G +++R S D   V + LT      F +++     + ++  I
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 267  SPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQE----ATGSLTKVAEEQFSGIKTV 320
            +PQ      FL   V+++  Y+  G      SR+L+     +   + +   E   G+ T+
Sbjct: 1242 TPQ------FLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTI 1295

Query: 321  QSFVAEQKEIKRYNHAI----RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYL 376
            ++F  E + I+   H I    R  F +   + ++  +      ++G    LVV   G ++
Sbjct: 1296 RAFGDESRFIQENLHKIDENNRPFFYLWVANRWLAMR----IDLIGS---LVVFGAGVFI 1348

Query: 377  VLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFE--LTDRIP 429
            +L+       ++   LT  + +TE        L   YS +     +  RL E  + ++ P
Sbjct: 1349 LLNIDHIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEP 1404

Query: 430  SISPTLGKKF-VPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKS 488
               P +      P  G +E  +VS  Y      ++ KN+SF ++  S V +VG +G GKS
Sbjct: 1405 YNQPIMTPPSDWPQHGRVEMSDVSLRYAP-GLPRVIKNVSFTVEPKSKVGVVGRTGAGKS 1463

Query: 489  TIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI------ 542
            TI + L R+ +P TG I +D  DIS +  + LRR ++I+ Q+P L +GTI+ N+      
Sbjct: 1464 TIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEY 1523

Query: 543  -------TYGLVEKPTQDEV--RSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQR 593
                       V   +Q+E+   +I         + KF +  ++ +   G  LS GQ+Q 
Sbjct: 1524 SDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLD-LNSEINEGGGNLSQGQRQL 1582

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSE 653
            + +AR+L++ P I++LDEAT+++D +S+  I  T  K  +    TI++IAHRL ++   +
Sbjct: 1583 VCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYD 1640

Query: 654  NVIVLGNDGSVAE 666
             ++V+ + G V E
Sbjct: 1641 KILVM-DQGEVKE 1652

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 118/538 (21%), Positives = 225/538 (41%), Gaps = 58/538 (10%)

Query: 170 FISLVGVSLLVGTAANYGRVILLR----VLSERVVARLRANVIKKTMHQDAEFFDNNKV- 224
           F   V  ++  G A  +GR + ++    ++SE     LR  V   +  Q  +  D  ++ 
Sbjct: 451 FFCRVFCAIFSGQALFFGRRVCIKMKAIIISEIYTKALRRQVAVNSNKQSTDEVDPQELN 510

Query: 225 -----------------GDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMM---I 264
                            G +I+ ++ DA+ VS  +   +    +A+    V I ++   +
Sbjct: 511 EEEHRDGDEESGTSANLGAIINLMAVDAFKVSE-ICAYLHAFVEAVAMSCVAIVLLYKLL 569

Query: 265 SISPQLSAFLLFLTPPVMLS-ASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSF 323
            +S  + A L+ +  PV     ++ G+L + +     +   +L     E F  I+ ++ F
Sbjct: 570 GLSAIIGALLIVVLMPVNFRLVTWLGQLQKKSLSYTDKRIQNLN----EAFQAIRIIKFF 625

Query: 324 VAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVL--AYGSYLVLHGS 381
             E      +   I+ I +V  +     +  ++L + +   +  +V   A+  Y+ +   
Sbjct: 626 SWEDN----FEKGIQAIRDVELKLLLQRSLIWALCSFVWYATPTIVTTSAFAFYIYVQKQ 681

Query: 382 LSIGDLTAYMMYTEYTGSSIF-----GLSTFYSEIMQGAGAASRLFELTDRIPSISPTLG 436
                LT  + +T  +  S+       LS   S ++Q   +  R+ E  +  P       
Sbjct: 682 ----TLTTPVAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRIQEFLEE-PDTDKYNQ 736

Query: 437 KKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLR 496
               P   ++ F+N + S+ +   +   +NL+     G    ++GP+G GK++I   LL 
Sbjct: 737 LSVAPGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLG 796

Query: 497 YYNPTTGQIFV---DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-TQ 552
                 G I V   D + +  + +  +   ++   Q   L++ T+R+NI   L   P ++
Sbjct: 797 EMKLLNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNI---LFNSPYSE 853

Query: 553 DEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEA 612
                + + C              T +G  G  LSGGQKQRI++AR+L      L+LD+ 
Sbjct: 854 ARYNDVIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDC 913

Query: 613 TSALDVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
            SA+D  +   I  N   G LM+ +  T I I+H ++   R+  ++VL  +G V E G
Sbjct: 914 LSAVDSHTASWIYDNCITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 150/552 (27%), Positives = 254/552 (46%), Gaps = 84/552 (15%)

Query: 178  LLVGTAANY---GRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSD 234
            L++G A +    G+ IL  V       ++   ++ K +H    FFD    G +++R S D
Sbjct: 1109 LIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRIMNRFSKD 1168

Query: 235  AYVVSRSLTQKVSDGFKAML-CGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF--GRL 291
               + + LT  +   F +++ C S  I ++  I+PQ      FL+  +++S  Y+  G  
Sbjct: 1169 IEAIDQELTPYIQGAFYSLIECLSTVI-LITFITPQ------FLSVAIVVSIMYYFIGYF 1221

Query: 292  IRNNSRDLQE----ATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQS 347
                SR+L+     +   + +   E   G+ T+++F  E + ++     I          
Sbjct: 1222 YMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDEN------- 1274

Query: 348  AFINAKFFSLTAVLGDMSF-------LVVLAYGSYLV-----LHGSLSIGDLTAYMMYTE 395
               N  FF L      ++F       LV+   G +++     L   ++   LT  + +TE
Sbjct: 1275 ---NKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILSNIDHLDSGMAGISLTYAISFTE 1331

Query: 396  YTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP-----NKGEIEFKN 450
                    L   YSE+     +  R+ E  +      P    K VP       G+IE  +
Sbjct: 1332 ----GALWLVRLYSEVEMNMNSVERVKEYME--IEQEPYNQHKEVPPPQWPQDGKIEVND 1385

Query: 451  VSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQ 510
            +S  Y      ++ KN+SF +DA S V IVG +G GKSTI + L R+  P TG I +D  
Sbjct: 1386 LSLRYAPNLP-RVIKNVSFSVDAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNI 1444

Query: 511  DISKVSSKSLRRHMSIVQQEPVLMSGTIRDN---------------------ITYGLVEK 549
            DIS V  + LRR ++I+ Q+P L SGTI+ N                     ++   +++
Sbjct: 1445 DISNVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQ 1504

Query: 550  PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
             T  EV + T      N + KF +  ++ +   G+ LS GQ+Q + +AR+L++ P I++L
Sbjct: 1505 GTVREVATDTSSADSEN-VNKFLD-LESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILL 1562

Query: 610  DEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
            DEAT+++D  S+  I  T  K  +    TI++IAHRL ++   + ++V+       + G+
Sbjct: 1563 DEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-------DAGE 1613

Query: 670  FKELYADPGSEL 681
             KE Y  P S L
Sbjct: 1614 VKE-YDHPYSLL 1624

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 110/233 (47%), Gaps = 9/233 (3%)

Query: 441 PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
           PN     F+N + S+     +   K+L+ +   G    ++GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 501 TTGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRS 557
             G++ V   D  +   V +      ++   Q   L++ T+++NI +    +  +   ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFN--SQFNETRYKA 806

Query: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           + + C              T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 618 VESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
             +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 143/516 (27%), Positives = 240/516 (46%), Gaps = 47/516 (9%)

Query: 202  RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
            +L +++          FF+   +G +++R S+D Y +   L +  S  F+  +  S  I 
Sbjct: 1018 QLHSSMTSSIFRAPMSFFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIV 1077

Query: 262  MMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGS----LTKVAEEQFSGI 317
            ++ S + Q     +FL  P+     Y+ +     SR+L+    +    L    +E   G+
Sbjct: 1078 VICSTTWQF----IFLIIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGV 1133

Query: 318  KTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINA-KFFSL-TAVLGDMSFLVVLAYGSY 375
             T++ F A+Q      N + R   N+      IN+ ++ +     LG +  L       +
Sbjct: 1134 STIRGF-AQQDRFIHINQS-RVDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIF 1191

Query: 376  LVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTL 435
             + +GSL+ G +   M Y      S+  +     ++     +  R+ E +  +PS +P +
Sbjct: 1192 RLKNGSLTAGMIGLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYS-HLPSEAPLI 1250

Query: 436  -----GKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTI 490
                   +  P+KG IEFKN S  Y     + + KN++ KI     V IVG +G GKS++
Sbjct: 1251 IENNRPSEEWPSKGAIEFKNYSTRYRPEL-DLVLKNINLKILPKEKVGIVGRTGAGKSSL 1309

Query: 491  ASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP 550
               L R    ++G I +DG +I+++    LR  +SI+ Q+  +  G+IR+NI       P
Sbjct: 1310 TLALFRIIEASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI------DP 1363

Query: 551  TQ----DEVRSITKKCFCHNFITKF---------------PNSYDTILGPHGTLLSGGQK 591
            TQ     E+ +  +       I K                 N  D  +   G+ LS GQ+
Sbjct: 1364 TQQFSEQEIWNALEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQR 1423

Query: 592  QRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRR 651
            Q I +ARAL+    +LILDEAT+A+DVE++  I +T     K +  TI++IAHR++TI  
Sbjct: 1424 QLICLARALLVPSNVLILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMD 1481

Query: 652  SENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
            S+ +IVL N G VAE  K + L  +  S    L +E
Sbjct: 1482 SDKIIVLDN-GEVAEFDKPEILLTNKNSLFYSLCYE 1516

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 128/522 (24%), Positives = 236/522 (45%), Gaps = 50/522 (9%)

Query: 225 GDLISRLSSDAYVVSRSLTQKV----SDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280
           GD+++ +S D   + + L+Q +    S  F+  LC  + +  ++  S  +  F+L +  P
Sbjct: 391 GDIVNLMSVDVQRL-QDLSQWINILWSGPFQLTLC-LISLYNLLGHSMWIGVFILGIMIP 448

Query: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQK-----EIKRYNH 335
           +    SY  R+ +   +D  +     T +  E  + IK+++ +  E+      E  R   
Sbjct: 449 I---NSYIMRIQKKLQKDQMKYKDERTGLVNEILNNIKSLKLYAWEKPFQEKLEFVRNEK 505

Query: 336 AIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTE 395
            ++++  +G  +A I  +F ++   L       +  +     L   L    LT + +   
Sbjct: 506 ELKNLKKIGVFNAMIAFQF-NIVPFLVSCCTFAIFVWVEDKPLTTDLVFPALTLFNLLNF 564

Query: 396 YTGSSIFGLSTFYSEIMQGAGAASRLFE-LTDRIPSISPTLGKKFVPNKGEIEFK---NV 451
              +    +S F    ++ + + SRL+  LT+            FV   GE   K   N 
Sbjct: 565 PLVAVPITISAF----IEASVSISRLYSYLTNEELQKDAIQRLPFVKQNGETTVKIGDNA 620

Query: 452 SFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF-VDG 509
           +F +  +   ++  KN++F+   G   CIVG  G GKS     +L       G +F V G
Sbjct: 621 TFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSIL-------GDLFRVKG 673

Query: 510 QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFIT 569
                    S+  +++ V Q   +M+GT++DNI +G    P   E     K C     ++
Sbjct: 674 -------FASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDPEFYE--KTIKACALTIDLS 724

Query: 570 KFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF 628
             P+   T++G  G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S+  I    
Sbjct: 725 ILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNVL 784

Query: 629 GK--LMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
           G   L+KSK  T I   +++  +  ++++ +L N G + E G + ++ A  GS LSKL+ 
Sbjct: 785 GAKGLLKSK--TRILTTNKIPVLSIADSITLLEN-GEITEQGTYFDVMATEGSSLSKLIT 841

Query: 687 EKATRSERQQNTAEDQEIDP---EETINIENSTPESDITQEL 725
           E   + +  ++ A    ++    E ++N E + P  D  +EL
Sbjct: 842 EYGKKKDSSESEAAKDNVNSESDESSVNRELTVPIEDELREL 883

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  154 bits (389), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 135/507 (26%), Positives = 244/507 (48%), Gaps = 69/507 (13%)

Query: 202  RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAML-CGSVGI 260
            ++  +++K ++H    FFD+  +G +++R S D   V + +   +   F  ++ C S+ I
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSI-I 1227

Query: 261  GMMISISPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVA-----EEQ 313
             ++  I+PQ      FL   + ++  Y+  G +  + SR+L+    S+TK        E 
Sbjct: 1228 VLITLITPQ------FLGVAIFIAVFYWFVGAVYISGSRELKRF-DSITKSPIYQHFSET 1280

Query: 314  FSGIKTVQSFVAEQK----EIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVV 369
             +GI TV+++  E +     +++ +   +  F +   + +++ +    T ++G     V+
Sbjct: 1281 LAGITTVRAYGDESRFMRENLEKIDENNKPFFYMWVSNRWLSFR----TQIIGA---FVI 1333

Query: 370  LAYGSYLVLH-GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT--D 426
            L  G + + +   +  G     + Y      +   L  FY +      +  R+ E    D
Sbjct: 1334 LGAGGFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNID 1393

Query: 427  RIP----SISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGP 482
            + P    ++ P       P  G+IE  +VS  Y      ++ KN+SF +D+ S V IVG 
Sbjct: 1394 QEPYNEGTVEPPADW---PENGKIEINDVSLRYAPNLP-RVIKNVSFTVDSKSKVGIVGR 1449

Query: 483  SGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI 542
            +G GKSTI + L R+  P TG I +D  DI  +  + LRR +SI+ Q+P L +GTIR N+
Sbjct: 1450 TGAGKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNL 1509

Query: 543  TYGLVEKPTQDEVRSITKKCFCHNFITK-------FPNSYDTI----------------L 579
                 +  TQ   + I     C N +++        P+S DT                 +
Sbjct: 1510 -----DPYTQYSDKEIFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNV 1564

Query: 580  GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITI 639
               G+ +S GQ+Q + +AR+L+ KP I++LDEAT+++D ES+  I  T      +   TI
Sbjct: 1565 SEGGSNISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRNEFGNS--TI 1622

Query: 640  ISIAHRLSTIRRSENVIVLGNDGSVAE 666
            ++IAHRL ++   + ++V+ + G V E
Sbjct: 1623 LTIAHRLRSVIDYDKILVM-DAGEVEE 1648

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 151/606 (24%), Positives = 257/606 (42%), Gaps = 113/606 (18%)

Query: 139 IVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLR----V 194
           I+L ++ Q +S+P  T  +V   A    +  FIS   V++  G A   GR I +R    +
Sbjct: 436 ILLKKILQYISDPTVTTKNV---ACCYIILMFISKCIVAVCEGQALFIGRRICIRMRSII 492

Query: 195 LSERVVARLRANVIKKT-----------------MHQDAEFFDNNKVGDLISRLSSDAYV 237
           +SE  +  LR  +I KT                 +  D E   +  VG +I+ ++ DA+ 
Sbjct: 493 ISEIYIKALRRQIITKTKKSTDEVDPEQLNEDSKIDGDEESTASANVGAIINLIAVDAFK 552

Query: 238 VSRSLTQKVSDGFKAMLCGSVGIGMMISISPQL-------SAFLLFLTPPVMLS-----A 285
           V+            A L   +G  +M  +S  L       +AF+  LT  V++      A
Sbjct: 553 VAE---------IGAYLHTFIGTIIMTFVSIYLLFNLLGSAAFIGALTIIVLIPVNYKIA 603

Query: 286 SYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIR----HIF 341
           ++ G L + N +   +    L     E F  I+ ++ F + +K  +   H IR    +I 
Sbjct: 604 NWLGNLQQKNLKTTDKRIQKLN----ETFQAIRIIK-FFSWEKNFENDIHKIREEELYIL 658

Query: 342 N----VGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
                V   S FI   FF    ++  +SF    AY  Y+ +       +LT+ +    +T
Sbjct: 659 LLRCLVWSFSTFI---FFISPTIVTSLSF----AY--YIFIQKQ----ELTSPV---AFT 702

Query: 398 GSSIFGL--------STFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF----VP-NKG 444
             S+F L        +   S ++Q   +  R+    D   +      KK+    VP  K 
Sbjct: 703 ALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQTFLDEPDT------KKYEQLTVPVEKN 756

Query: 445 EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQ 504
           ++ FKN + S+     +   +NL      G    ++GP+G GK+++   LL     T GQ
Sbjct: 757 KLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEGQ 816

Query: 505 IFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR--SIT 559
           I +   D      + S      ++   Q   L++ T+R+NI   L   P   +    +I 
Sbjct: 817 INIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNI---LFNSPYNKDRYDAAIV 873

Query: 560 KKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                 +F         T +G  G  LSGGQKQRI++ARAL      ++LD+  SA+D  
Sbjct: 874 AAGLKRDFEILAAGDL-TEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAH 932

Query: 620 SEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP 677
           +   I  N   G LM+ ++  ++S  H ++   ++ +++V+  +G VA+ G       DP
Sbjct: 933 TAAWIYDNCISGPLMEGRTCVLVS--HNIALTLKNASLVVMLKNGRVADQG-------DP 983

Query: 678 GSELSK 683
            + L+K
Sbjct: 984 VTLLNK 989

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  154 bits (388), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 145/537 (27%), Positives = 242/537 (45%), Gaps = 75/537 (13%)

Query: 187  GRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKV 246
            G+ IL  V       ++   ++ K +H    FFD    G +++R S D   + + LT  +
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 247  SDGFKAML-CGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQE-- 301
               F +++ C S  I ++  I+PQ      FL+  +++S  Y+  G      SR+L+   
Sbjct: 1181 QGAFYSLIECLSTVI-LITFITPQ------FLSVAIVVSILYYFVGYFYMAGSRELKRFE 1233

Query: 302  --ATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTA 359
              +   + +   E   G+ T+++F  E + ++   H I             N  FF L  
Sbjct: 1234 SISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDEN----------NKPFFYLWV 1283

Query: 360  VLGDMSF-------LVVLAYGSYLVLH-GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEI 411
                ++F       LV+   G +++ +  +L  G     + Y          L   YSE+
Sbjct: 1284 ANRWLAFRIDMIGSLVIFGAGLFILFNINNLDSGMAGISLTYAISFTEGALWLVRLYSEV 1343

Query: 412  MQGAGAASRLFELTD-------RIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIF 464
                 +  R+ E  +           I P       P  G+IE  ++S  Y      ++ 
Sbjct: 1344 EMNMNSVERVKEYMEIEQEPYNEHKEIPPPQW----PQDGKIEVNDLSLRYAPNLP-RVI 1398

Query: 465  KNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHM 524
            KN+SF +DA S + IVG +G GKSTI + L R+  P TG I +D  DIS V  + LRR +
Sbjct: 1399 KNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSI 1458

Query: 525  SIVQQEPVLMSGTIRDNIT----------------YGLV--EKPTQDEVRSITKKCFCHN 566
            +I+ Q+P L SGTI+ N+                   L+  E+  Q   R  + +    N
Sbjct: 1459 TIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTN 1518

Query: 567  F--ITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
               + KF +    I    G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I
Sbjct: 1519 SENVNKFLDLSSEI-SEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKI 1577

Query: 625  NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
              T  K  +    TI++IAHRL ++   + ++V+       + G+ KE Y  P S L
Sbjct: 1578 QETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHPYSLL 1624

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 110/234 (47%), Gaps = 11/234 (4%)

Query: 441 PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
           PN     F+N + S+     +   K+L+ +   G    ++GP+G GK+++   LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 501 TTGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-TQDEVR 556
             G++ V   +  +   V +      ++   Q   L++ T+++NI   L   P  +   +
Sbjct: 749 LNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNI---LFNSPFNEARYK 805

Query: 557 SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
           ++ + C              T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 617 DVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
           D  +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G
Sbjct: 866 DSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 146/586 (24%), Positives = 267/586 (45%), Gaps = 73/586 (12%)

Query: 144  LKQIMSNPDFTVDDVPEIA-------FGLNLYEFISLVGVSLLVGTAANYGRVILLRVLS 196
             K ++ +   +++ VP+         + L++Y  I L   SLL  + +     +L  VL 
Sbjct: 1081 FKSVIESQKSSINTVPDYERKPHSTFYYLSIYFLIGLTQ-SLLAASKS-----VLNFVLG 1134

Query: 197  ERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCG 256
             R   ++  +++ +T+H    FFD   +G +++R S D   V + LT  +   F  ++  
Sbjct: 1135 IRASRKIFESLLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYLEAAFFCLVQC 1194

Query: 257  SVGIGMMISISPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQE----ATGSLTKVA 310
               + ++  I+PQ      FL+  +++   Y+  G      SR+L+     +   + +  
Sbjct: 1195 IATMALITFITPQ------FLSVAILVGCLYYLVGYFYMAASRELKRFESISKSPIYQHF 1248

Query: 311  EEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF---- 366
             E   G+ T++++  E + +    H I             N  FF L      +SF    
Sbjct: 1249 SETLVGVATIRAYGDESRFMLENLHKIDEN----------NKPFFYLWVFNRWLSFRIDM 1298

Query: 367  ---LVVLAYGSYLV-----LHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAA 418
                V+   G +++     +   ++   LT  + +TE        L  FY+++     + 
Sbjct: 1299 IGAFVIFGAGVFILTNIKNIDSGMAGISLTYAISFTE----GALWLVRFYADVEMNMNSV 1354

Query: 419  SRLFELTD----RIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAG 474
             RL E  +           TL     P+ G+IE K++S  Y      ++ KN+SF ++  
Sbjct: 1355 ERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYAPNLP-KVIKNVSFVVEPK 1413

Query: 475  SNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLM 534
            + + IVG +G GKSTI + + R+ NP +G I +D  +I+ ++   LRR ++I+ Q+P L 
Sbjct: 1414 TKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPTLF 1473

Query: 535  SGTIR-----------DNITYGL--VEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGP 581
            +GTI+           D I   L  V   T++E+++   +        KF N  + I   
Sbjct: 1474 TGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLNLENEI-TE 1532

Query: 582  HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIIS 641
             G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  K       TI++
Sbjct: 1533 GGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKEFSQS--TILT 1590

Query: 642  IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
            IAHRL ++   + +IV+ + G V E      L  D  S    +  +
Sbjct: 1591 IAHRLRSVIDYDKIIVM-DAGEVKEYDHPYSLLLDKNSNFYSMCEQ 1635

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 115/231 (49%), Gaps = 15/231 (6%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           I FKNV+ ++     +   ++L+ +   G+   ++GP+G GK+++   LL       G+I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 506 FVDG----QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDE-VRSITK 560
            V      QD+  +    L   ++   Q   L++ T+R+NI   L   P  +E   ++  
Sbjct: 771 IVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNI---LFNSPYNEERYNAVID 826

Query: 561 KCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
            C     +     S  T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +
Sbjct: 827 ACGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHT 886

Query: 621 EGAI--NYTFGKLMKSKSITIISIAHRLS-TIRRSENVIVLGNDGSVAEVG 668
              I  N   G LM  +  T I ++H ++ T++ +E V++L N G V + G
Sbjct: 887 ALWIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVILEN-GRVKDQG 934

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 138/517 (26%), Positives = 243/517 (47%), Gaps = 60/517 (11%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            ++KK ++    FFD+   G +++R S D   +   L       F +++     I ++  I
Sbjct: 1163 LLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGYI 1222

Query: 267  SPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVAEEQFS----GIKTV 320
            +P    FL F    +++  SY+  G      SR+LQ           + FS    G+ T+
Sbjct: 1223 TP---VFLFF---AIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTI 1276

Query: 321  QSFVAEQK-------EIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYG 373
            ++F  E++       ++  +N    +++   +  AF           +  +   V+LA G
Sbjct: 1277 RAFGDERRFLADNLSKVDTHNRPFFYLWVTNRWLAF----------RIDFIGAFVILASG 1326

Query: 374  SYLVLH-GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT--DRIPS 430
             +++L+  SL  G     ++Y          L   YS +     +  RL E    ++ PS
Sbjct: 1327 IFILLNVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPS 1386

Query: 431  ISPTLGKKFVPNKGEIEFKNVSFSYPTRASN--QIFKNLSFKIDAGSNVCIVGPSGRGKS 488
                      P++G+IE  N+S  Y   ASN  ++ KN++F ++  S V IVG +G GKS
Sbjct: 1387 TGLYEPPPEWPDRGKIEVNNLSLRY---ASNLPKVIKNVTFTVEPQSKVGIVGRTGAGKS 1443

Query: 489  TIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI----TY 544
            TI + L R+ +P TG I +D  DI+ +  K LR+ ++I+ Q+PVL +GTI+ N+     Y
Sbjct: 1444 TIITALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEY 1503

Query: 545  G--------------LVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQ 590
                           + E+ T  ++ S +      N + KF +    I    G+ LS GQ
Sbjct: 1504 ADDRIFEALKRVNLIVQEELTPTDIPSSSSSLSFEN-VNKFLDLTSEI-TEGGSNLSQGQ 1561

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIR 650
            +Q + +AR+L++ P  ++LDEAT+++D  S+  I  T  +       TI++IAHRL +I 
Sbjct: 1562 RQLVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIREEFSGS--TILTIAHRLRSII 1619

Query: 651  RSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
              + V+V+ + G +AE      L  + GS   ++  +
Sbjct: 1620 DYDKVLVI-DSGELAEYDHPYTLLLNKGSLFYRMCED 1655

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 119/245 (48%), Gaps = 12/245 (4%)

Query: 437 KKFVPNKGEIEFKNVSFSYP-TRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLL 495
           ++    K  + F N +  +    A++   KNL+     G    IVGP+G GK+++   LL
Sbjct: 702 RQLTVKKDRLGFSNATIGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLL 761

Query: 496 RYYNPTTGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQ 552
              N + G+I+V   +  +   V +  +   +    Q   L++ T+R+NI   L   P +
Sbjct: 762 GEINLSEGKIYVPALNPREDLVVDADGMTDSIGYCSQSAWLLNDTLRNNI---LFSAPYE 818

Query: 553 -DEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
            +   ++   C     +        T +G  G  LSGGQKQR+++ARA+  +   ++LD+
Sbjct: 819 ANRYNAVIHACGLTRDLEILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDD 878

Query: 612 ATSALDVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
             SA+D  +   I  +   G LM+ ++  ++S    L T++ ++ V++L N    A+ G+
Sbjct: 879 CLSAVDSHTAQWIYKHCITGPLMEGRTCVLVSHNTAL-TLKNADWVVILENAKVTAQ-GE 936

Query: 670 FKELY 674
             EL+
Sbjct: 937 PLELF 941

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 143/525 (27%), Positives = 244/525 (46%), Gaps = 35/525 (6%)

Query: 166  NLYEFISLVGVSLLVGTAANYGR-VILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKV 224
            ++++F+ +     +   A N  R ++LL   + R  A+L   + K  +     FF+   V
Sbjct: 992  DVWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPV 1051

Query: 225  GDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLS 284
            G +I+R SSD   V  +L    +  F+++L  +V +   I IS  +  FL+ +   +++ 
Sbjct: 1052 GRIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTV---ILISYNMPWFLI-VNAVLLII 1107

Query: 285  ASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHA-------- 336
              Y+       SR+L+  T   T      FS      + +   K   R++          
Sbjct: 1108 YIYYQAFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAFKHFDRFDFINFNNVQFN 1167

Query: 337  IRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEY 396
            I   FN    + +++ +  ++ A +   + L+ L   S +     LS G +   M Y   
Sbjct: 1168 INCSFNFRSTNRWLSVRLQTIGAFIVLATALLAL---STINSERRLSPGMVGLLMSYALQ 1224

Query: 397  TGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS----ISPTLGKKFVPNKGEIEFKNVS 452
              SS+  +     +I     +  R++E  +  P     I     KK  P++GEI FKN S
Sbjct: 1225 VTSSLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYS 1284

Query: 453  FSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDI 512
              Y T+  +   K ++  I     + +VG +G GKST++  L R    T G I +DG DI
Sbjct: 1285 TKYKTKG-DLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDI 1343

Query: 513  SKVSSKSLRRHMSIVQQEPVLMSGTIRDNI----TYGLVEKPTQDEVRSITK---KCFCH 565
            SK+  K LR H+ I+ Q+     GT+R N+     Y   E     E+  +     + F  
Sbjct: 1344 SKMGLKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYSTEELWASIELSHLKPHIVEMFRK 1403

Query: 566  NFITKFPNSYDTIL----GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
               ++ P S + +L      +G  LS GQ+Q + ++RAL+    +L+LDEAT+A+D+E++
Sbjct: 1404 EDNSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETD 1463

Query: 622  GAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
              I  T    +K K  TI++IAHR+ T+  S+ +IVL + G V E
Sbjct: 1464 KIIQETIRSELKEK--TILTIAHRIDTVLDSDKIIVL-DAGQVKE 1505

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 78/272 (28%), Positives = 137/272 (50%), Gaps = 21/272 (7%)

Query: 425 TDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQI-FKNLS-FKIDAGSNVCIVGP 482
           +D++  +   +   F+    +I F   S       S+Q+  +N++ F+   G   CIVG 
Sbjct: 598 SDKVSPVVEIINATFLWKSPKILFSEGSDEESRIESSQVALENINGFQAKKGELTCIVGR 657

Query: 483 SGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI--VQQEPVLMSGTIRD 540
            G GKST+   +L       GQ+      +  +  K L R  ++    QEP +M+ +I+D
Sbjct: 658 VGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAYCPQEPWIMNASIKD 710

Query: 541 NITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARAL 600
           NIT+G   +  +    +  K C     +   P   +T++G  G  LSGGQK RI++ARA+
Sbjct: 711 NITFGF--RYDETYYNATIKACQLLPDLDILPERDNTLVGEKGISLSGGQKARISLARAV 768

Query: 601 IKKPTILILDEATSALDVE-SEGAINYTFGK---LMKSKSITIISIAHRLSTIRRSENVI 656
             +  + +LD+  SA+D E S+  +     K   L+++K  T++   + +S + RS+ + 
Sbjct: 769 YSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNK--TVVLTTNAISVLNRSQKIY 826

Query: 657 VLGNDGSVAEVGKFKELYADPG-SELSKLLHE 687
           +L   GS+ E G F E+ + P  S+L K++ E
Sbjct: 827 ML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDE 857

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 146/539 (27%), Positives = 254/539 (47%), Gaps = 47/539 (8%)

Query: 172  SLVGVSLLVGTAA--NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLIS 229
            SL+GV    G+AA  N   +++L   S R   +L  N+ K  +     FF+   VG +I+
Sbjct: 1025 SLIGV----GSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIIN 1080

Query: 230  RLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFG 289
            R SSD   V  SL    S  FK++L   V + ++    P    F +FL    +   +++ 
Sbjct: 1081 RFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVIYIYYQTFYI 1140

Query: 290  RLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEI----KRYNHAIRHIFNVGK 345
             L R   R +  +   +  +  E  +G   + ++   ++ I    ++  + I  +FN   
Sbjct: 1141 VLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRS 1200

Query: 346  QSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLS 405
             + +++ +  ++ A +   + ++ L   +      S  +G L +Y +  E TGS  + + 
Sbjct: 1201 TNRWLSVRLQTIGATIVLATAMLALTTMNTKKQLSSGMVGLLMSYSL--EVTGSLTWIVR 1258

Query: 406  TFYSEIMQGAGAAS-----RLFELTDRIPSISP-TLGKKFVPNKGEIEFKNVSFSYPTRA 459
            T    +M      S        EL     SI+P     +  P+KG IEFKN S  Y    
Sbjct: 1259 T---TVMIETNIVSVERIVEYCELPSEARSINPENRPDESWPSKGSIEFKNYSTKYRENL 1315

Query: 460  SNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKS 519
             + + K+++ +I     + IVG +G GKST++  L R   PT G I +D  +IS +    
Sbjct: 1316 -DPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLGLFD 1374

Query: 520  LRRHMSIVQQEPVLMSGTIRDNIT----YG---------------LVEKPTQDEVRSITK 560
            LR H++I+ Q+     GT+R N+     Y                 +EK   +E+R    
Sbjct: 1375 LRSHLAIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADG 1434

Query: 561  KCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                +  ++   N     +  +GT LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E+
Sbjct: 1435 AAEENGNVSDVLN---VKINENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMET 1491

Query: 621  EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGS 679
            +  I  T  +  K +  TI++IAHR+ T+  S+ +IVL ++G+V E     +L +D  S
Sbjct: 1492 DKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLSDKAS 1547

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 117/485 (24%), Positives = 216/485 (44%), Gaps = 64/485 (13%)

Query: 286 SYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRH---IFN 342
           +Y  R ++  S+   +      K   E  + IK+++ +  E+  ++R NH +R+   + N
Sbjct: 451 AYLSRKVKKLSKTQMKYKDLRIKTITEILNAIKSIKLYAWEEPMMERLNH-VRNDMELQN 509

Query: 343 VGKQSAFINAKFFSLTAV--LGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSS 400
             K     N  +F+   V  +   S   + +  S   L  ++    L+ + +      S+
Sbjct: 510 FRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFSDTPLSPAIVFPSLSLFNI----LNSA 565

Query: 401 IFGLSTFYSEIMQGAGAASRL--FELTDRIPS-----ISPTLGKKFVPNKGEIEFKNVSF 453
           I+ + +  + I++ + +  RL  F L+D I       I P++ ++ +P    IE  N++F
Sbjct: 566 IYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLP---VIEMNNITF 622

Query: 454 SYPTR--------------------ASNQI-FKNLS-FKIDAGSNVCIVGPSGRGKSTIA 491
            + ++                     S+QI  KN+  F+   G  VC+VG  G GKST  
Sbjct: 623 LWKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFL 682

Query: 492 SLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI--VQQEPVLMSGTIRDNITYGLVEK 549
             +L       GQ+         +  K + R  S+    QE  +M+ ++R+NI +G   K
Sbjct: 683 KGIL-------GQLPCMSGSKGSIPPKLIIRASSLAYCSQESWIMNSSVRENILFG--HK 733

Query: 550 PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
             +       K C     +   P+  +T++G  G  LSGGQK R+++ARA+  +  I +L
Sbjct: 734 FDKAYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLL 793

Query: 610 DEATSALDVE-SEGAINYTF-GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEV 667
           D+  SA+D E S+  + Y   GK    K+ TII   + +  ++ S+ +  L N G + E 
Sbjct: 794 DDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYALEN-GEIIEQ 852

Query: 668 GKFKELY--ADPGSELSKLLHE------KATRSERQQNTAEDQEIDPEETINIENSTPES 719
           G ++ +    +  S+L KLL E        ++S+ Q     + ++D    + +  S  E 
Sbjct: 853 GNYEGVMNRENTNSKLKKLLEEFDSPIDNGSKSDIQTEHRSESDMDEPLQLKVVESETED 912

Query: 720 DITQE 724
           +I  E
Sbjct: 913 EIATE 917

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 337 IRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEY 396
           I H+ NVG QS  I  +  +L + LGD  +  +L    YL L  +L I   T Y++Y + 
Sbjct: 77  ITHLINVGFQSTLILCQI-ALVSQLGDGIYPPILKRALYLNLLFNLGISLPTQYLVYFKS 135

Query: 397 T---GSSIF 402
           T   GS +F
Sbjct: 136 TYSMGSQLF 144

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  152 bits (384), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 135/502 (26%), Positives = 235/502 (46%), Gaps = 71/502 (14%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            V+KK ++    FFD+  +G +++R S D   V + LT  V   F +++     + ++  I
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 267  SPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVAEEQFS----GIKTV 320
            +P       FL   + +   Y+  G      SR+L+           + FS    GI T+
Sbjct: 1198 TPG------FLVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTI 1251

Query: 321  QSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAYG 373
            ++F  E++        + ++  + +     N  FF L      ++F        VV A G
Sbjct: 1252 RAFGDERR------FMLENLQKIDEN----NKPFFYLWVANRWLAFRIDMIGACVVFAAG 1301

Query: 374  SYLVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFE--LTD 426
             +++L+       L+   LT  + +TE        L   YS +     +  RL E  + +
Sbjct: 1302 VFILLNIKKLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMVIE 1357

Query: 427  RIPSISPTLGKKF-VPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGR 485
            + PS           P++G+IE  ++S  Y T    ++ KN+SF +D    V IVG +G 
Sbjct: 1358 QEPSNDGAFNPPIEWPDQGKIEVNDLSLRYATNLP-RVIKNVSFTVDPKCKVGIVGRTGA 1416

Query: 486  GKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYG 545
            GKSTI + L R+ +P TG I +D  DI+ +  K LR+ ++I+ Q+P L SGT++ N+   
Sbjct: 1417 GKSTIITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNL--D 1474

Query: 546  LVEKPTQDEVRSITKKCFCHNFIT-----KFPNSYDTI----------------LGPHGT 584
              ++ T +++    K+    N +T       P+S D                  +   G 
Sbjct: 1475 PYDEYTDEQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGA 1531

Query: 585  LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
             LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +       TI++IAH
Sbjct: 1532 NLSQGQRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIREEFGDS--TILTIAH 1589

Query: 645  RLSTIRRSENVIVLGNDGSVAE 666
            RL +I   + ++V+ + G V E
Sbjct: 1590 RLRSIIDYDKILVM-DAGEVRE 1610

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 120/234 (51%), Gaps = 11/234 (4%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           ++ +I F+N +F++  +  +   KNL+ +   G    ++G +G GK+++   LL   +  
Sbjct: 688 SRNKIAFENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLI 747

Query: 502 TGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSI 558
            G+++V   D  +   + S  +   ++   Q   L++ T+R+NI +      T+   +++
Sbjct: 748 EGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YKAV 805

Query: 559 TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            + C              T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+D 
Sbjct: 806 VEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDS 865

Query: 619 ESEGAI--NYTFGKLMKSKSITIISIAHRLS-TIRRSENVIVLGNDGSVAEVGK 669
            +   I  N   G LM+ +  T I ++H ++ T++ +E V+VL N G + + G+
Sbjct: 866 HTALWIYENCITGPLMQGR--TCILVSHNVALTLKNAEWVVVLDN-GRIKDQGE 916

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 140/501 (27%), Positives = 227/501 (45%), Gaps = 29/501 (5%)

Query: 201  ARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGI 260
            ARL   + K  +     FF+   VG +++R S+D Y V   L +  S  F  +      +
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTM 1074

Query: 261  GMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTV 320
             ++ SI+ Q   F+L L+   +    Y+ R  R   R        +    +E  +G+ TV
Sbjct: 1075 IVICSITWQFIFFILPLSVLYLFYQQYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTV 1134

Query: 321  QSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTA---------VLGDMSFLVVLA 371
            +SF    K+  R+ H      N  + + ++ A + S+ A          +G +  L    
Sbjct: 1135 RSF----KKQDRFIH-----INQSRINTYMCAYYLSINANRWLAFRLEFMGSIVILAAAV 1185

Query: 372  YGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTD---RI 428
               + +  G L+ G L   + Y      S+  +     E+     +  R+ E TD     
Sbjct: 1186 LSVFRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEA 1245

Query: 429  PSISPT-LGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGK 487
            P I PT    K  P  G+I+F++ S  Y     + I ++++  I     V IVG +G GK
Sbjct: 1246 PMIIPTSRPPKNWPANGDIKFEHFSTRYRPEL-DLILEDINLHIHPREKVGIVGRTGAGK 1304

Query: 488  STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLV 547
            S++   L R      G+I +D   I  +    LR  +SI+ Q+  +  GT R+NI     
Sbjct: 1305 SSLTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENI--DPC 1362

Query: 548  EKPTQDEVRSITKKCFC-HNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTI 606
             K T DE+ +  +      + +T      +T L   G+ LS GQ+Q + +ARAL+    I
Sbjct: 1363 NKFTDDEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKI 1422

Query: 607  LILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            L+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL + G +AE
Sbjct: 1423 LVLDEATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGRIAE 1479

Query: 667  VGKFKELYADPGSELSKLLHE 687
                  L  D  S    L +E
Sbjct: 1480 FDTPCNLLKDETSIFYSLCNE 1500

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 132/276 (47%), Gaps = 25/276 (9%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF-VDGQDISKVSSKSLRR 522
            KN++F+   G   CIVG  G GKS +   +L       G +F V G       S +L  
Sbjct: 634 LKNINFQARKGELSCIVGKVGTGKSALIQAML-------GDLFRVKG-------SATLHG 679

Query: 523 HMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH 582
            ++ V Q   +M+GTI+DNI +G   K   +      K C     +   P+   T +G  
Sbjct: 680 SVAYVSQVSWIMNGTIKDNILFGY--KYDAEFYEKTIKACALSLDLNTLPDGDQTFVGER 737

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIIS 641
           G  LSGGQK R+A+ARA+  K  +  LD+  +A+D   S+  + Y  G     K+ T I 
Sbjct: 738 GISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYVIGPTGLLKTKTRIL 797

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAED 701
             +++  +  ++++ +L N G + + G + ++ ++  S L KL+   A   +++    E+
Sbjct: 798 TTNKIHVLSVADSITLLDN-GVIVQQGSYDQVNSNKDSPLFKLI---ANFGKQKSQAIEN 853

Query: 702 QEIDPEETINIENSTPESDITQELLENPIKEAIMDV 737
            E   +    ++ S+  S + QE + +  K A  D+
Sbjct: 854 NE---DTVAEVKTSSSSSPLVQEDIIDWSKSASKDM 886

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  150 bits (380), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 135/504 (26%), Positives = 224/504 (44%), Gaps = 63/504 (12%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            ++ K MH    FFD+  +G +++R S D     + LT  +   F +++     + ++  I
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 267  SPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQE----ATGSLTKVAEEQFSGIKTVQS 322
            +PQ     LF+   V +   + G      SR+L+     +   + +   E   G+ T+++
Sbjct: 1188 TPQF----LFVAILVAVLYYFVGYFYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRA 1243

Query: 323  FVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAYGSY 375
            F  E + ++     I             N  FF L      +SF       LV+   G +
Sbjct: 1244 FGDESRFMRENLQKIDEN----------NRPFFYLWVANRWLSFRIDMIGALVIFGAGIF 1293

Query: 376  LVLH------GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTD--R 427
            ++L+      G   I  LT  + +TE        L   YS +     +  RL E  D  +
Sbjct: 1294 VLLNIDHIDSGKAGIS-LTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDVEQ 1348

Query: 428  IPSISPTLGKKF-VPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRG 486
             P     L      P +G IE  ++S  Y      ++ KN+SF +D  S V IVG +G G
Sbjct: 1349 EPYDQSILTPPVEWPQQGRIEVNDLSLRYAPNLP-KVIKNVSFTVDPRSKVGIVGRTGAG 1407

Query: 487  KSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT--- 543
            KSTI + L R+ +P TG I +D  DI+ +  + LRR ++I+ Q+P L +GTI+ N+    
Sbjct: 1408 KSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYD 1467

Query: 544  -------------YGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQ 590
                           LV +   D   +          I KF +    I    G  +S GQ
Sbjct: 1468 EYTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLDLSSEI-SEGGGNISQGQ 1526

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIR 650
            +Q + +AR+L++ P I++LDEAT+++D  S+  I  T  K       TI++IAHRL ++ 
Sbjct: 1527 RQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVI 1584

Query: 651  RSENVIVLGNDGSVAEVGKFKELY 674
              + ++V+       EV +F   Y
Sbjct: 1585 DYDKILVM----DAGEVKEFDHPY 1604

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 112/234 (47%), Gaps = 11/234 (4%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           +K +I F+N + ++     +   KNL+     G    I+GP+G GK+++   LL   +  
Sbjct: 692 DKKKIGFENATITWDAERPDFKLKNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHLV 751

Query: 502 TGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-TQDEVRS 557
           +G+I V   D  +   + +  +   M+   Q   L++ T+++NI   L   P  +    +
Sbjct: 752 SGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNI---LFNSPYNEGRYEA 808

Query: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           + + C      +       T +G  G  LSGGQKQRI++AR+L      ++LD+  SA+D
Sbjct: 809 VVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVD 868

Query: 618 VESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
             +   I  N   G LM+ +  T I ++H  +   R+  ++V   +G V   G+
Sbjct: 869 SHTASWIYDNCITGPLMEGR--TCILVSHNTALTLRNAELVVTMENGQVKNQGE 920

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 143/549 (26%), Positives = 251/549 (45%), Gaps = 54/549 (9%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + +Y F  + G  L +       +  LL  L  R    L    +++ +H    + D 
Sbjct: 898  SFYMGMYSFF-VFGAYLFMNL-----QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDT 951

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVG-----IGMMISISPQLSAFLLF 276
              +G +++R + D    + SL  ++++  + ML   VG     I M I   P  +  + F
Sbjct: 952  TPLGRILNRFTKD----TDSLDNELTESIRLML-SQVGNLIGVIVMCIVYLPWFAIAVPF 1006

Query: 277  LTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHA 336
            L    +L   ++    R   R        +     E   G+ T++++ ++++ + + ++ 
Sbjct: 1007 LLIIFVLICDHYQSTGREIKRLEAVQRSFVYNNFNEVLGGMDTIKAYGSQERFLAKTDYL 1066

Query: 337  IRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSL-----SIGDLTAYM 391
            I    N   ++ ++        A+L D   +V     + L +  +      S+G L  Y+
Sbjct: 1067 I----NKMNEAGYLIVAVQRWVAILLDSVAVVFALIITLLCVTRAFPISAGSVGVLLTYV 1122

Query: 392  MYTEYTGSSIFGLSTFYSEIMQGAG-----AASRLFELTDRIPSISPTLGKKFVPNKGEI 446
            +      ++I    T     M  A      A     E   R P +SP    +  P KG+I
Sbjct: 1123 LQLPGLLNTILRALTQTENDMNSAERLVTYATELPLEAAYRKPEVSP---PESWPEKGDI 1179

Query: 447  EFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF 506
            +F +V+F+Y       + KN++ KI+ G  + I G +G GKSTI S L R    + G+I 
Sbjct: 1180 DFIDVNFAYRP-GLPVVLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIV 1238

Query: 507  VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN----------------ITYGLVEKP 550
            +DG DI K+    LR+ ++I+ Q+PVL  GTIR N                I  G+VE+ 
Sbjct: 1239 IDGVDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERE 1298

Query: 551  TQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++++ + K    +++        D ++   G+  S G++Q +A+ RAL++   ILILD
Sbjct: 1299 NLNDIK-LEKPDENNSYSNMHKFHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILD 1357

Query: 611  EATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670
            EATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   G +AE  K 
Sbjct: 1358 EATSSVDYETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKP 1414

Query: 671  KELYADPGS 679
             EL+ D  S
Sbjct: 1415 WELFNDKNS 1423

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 113/230 (49%), Gaps = 22/230 (9%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F +L+ +I  G  + + GP G GK+++ + +  +   T+G++ V+G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQD-EVRSITKKCFCHNFITKFPNSYDTILGPH 582
             ++   P +++ T+RDNI +G    P ++     I + C     +   P    T +G  
Sbjct: 628 -LLLCGYPWILNATVRDNILFG---SPYEEARYNEIVEVCSLDADLKILPAGDRTEIGER 683

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIIS 641
           G  LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     ++K K  T I 
Sbjct: 684 GITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGK--TRIL 741

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATR 691
             H+LS I R++ +IV+G +GS  + G   EL     + +S L +   T+
Sbjct: 742 ATHQLSVIERADRIIVVGPNGSF-DFGTLDELKGRNQTLVSLLQYSSQTK 790

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 135/527 (25%), Positives = 256/527 (48%), Gaps = 79/527 (14%)

Query: 200  VARLRAN------VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAM 253
            VA +RA+      ++K  ++    FFD+  +G +++R S D   + + LT  +   F ++
Sbjct: 1123 VAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSL 1182

Query: 254  LCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQ 313
            +     I ++  I+PQ     L +   VML   +      + +R+L+           + 
Sbjct: 1183 IQCVSTIIVIAYITPQF----LIVAAIVMLLFYFVAYFYMSGARELKRLESMSRSPIHQH 1238

Query: 314  FS----GIKTVQSFVAEQK----EIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMS 365
            FS    GI T+++F  E++     +K+ +   R  F +   + +++ +   + A      
Sbjct: 1239 FSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRIELIGA------ 1292

Query: 366  FLVVLAYGSYLVLH--------GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGA 417
             L+VLA GS+++L+          +S+G         ++T  +++ +   YS +     +
Sbjct: 1293 -LIVLAAGSFILLNIKSIDSGLAGISLG------FAIQFTDGALW-VVRLYSNVEMNMNS 1344

Query: 418  ASRLFELT--DRIPS-ISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAG 474
              RL E T  ++ PS +   +     P  G+IE K++S  Y      ++ KN++F +D+ 
Sbjct: 1345 VERLKEYTTIEQEPSNVGALVPPCEWPQNGKIEVKDLSLRYAAGLP-KVIKNVTFTVDSK 1403

Query: 475  SNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLM 534
              V IVG +G GKSTI + L R+ +P TG I +D  DI+ +  K LR+ ++I+ Q+P L 
Sbjct: 1404 CKVGIVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLF 1463

Query: 535  SGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITK----FPNSYDTI------------ 578
            +GT++ N+      + ++ E+    K+    N ++      P++ D+             
Sbjct: 1464 TGTLKTNL--DPYNEYSEAEIFEALKRV---NLVSSEELGNPSTSDSTSVHSANMNKFLD 1518

Query: 579  ----LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKS 634
                +   G+ LS GQ+Q I +AR+L++ P +++LDEAT+++D  S+  I  T  +   +
Sbjct: 1519 LENEVSEGGSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSN 1578

Query: 635  KSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
               TI++IAHRL +I   + ++V+       + G+ KE Y  P S L
Sbjct: 1579 S--TILTIAHRLRSIIDYDKILVM-------DAGEVKE-YDHPYSLL 1615

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 115/238 (48%), Gaps = 11/238 (4%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           ++ ++  +N +F++     +   KNL+     G    IVGP+G GK+++   LL      
Sbjct: 695 SRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELL 754

Query: 502 TGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-TQDEVRS 557
            G++FV   +  +   V +  +   ++   Q   L++ T+R+NI   L   P  ++   +
Sbjct: 755 NGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNI---LFNAPYNENRYNA 811

Query: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           +   C              T +G  G  LSGGQKQR+++AR+L      L+LD+  SA+D
Sbjct: 812 VISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVD 871

Query: 618 VESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
             +   I  N   G LM+ ++  ++S  H ++   ++ + +++  +G V E G+  EL
Sbjct: 872 SHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVIIMENGRVKEQGEPVEL 927

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  149 bits (377), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 141/521 (27%), Positives = 233/521 (44%), Gaps = 73/521 (14%)

Query: 202  RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
            ++  +++   +H    FFD   +G +++R S D   V + LT  +   F  ++     + 
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 262  MMISISPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVAEEQFS---- 315
            ++  I+PQ      FL   + +   Y+  G      SR+L+           + FS    
Sbjct: 1219 LIAFITPQ------FLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLV 1272

Query: 316  GIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LV 368
            GI T++++  E++ +    H I             N  FF L A    +SF       LV
Sbjct: 1273 GIVTIRAYGDEKRFMLENLHKIDEN----------NKPFFYLWAFNRWLSFRIDMIGSLV 1322

Query: 369  VLAYGSYLVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFE 423
            V   G +++L+       L+   LT  + +TE    +   L  FY+++     +  RL E
Sbjct: 1323 VFGAGVFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKE 1378

Query: 424  LT--DRIP-----SISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSN 476
                D+ P       S  L     P  G+IE  N+S  Y      ++ KN++F ++    
Sbjct: 1379 YMEIDQEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP-KVIKNVTFVVEPNCK 1437

Query: 477  VCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSG 536
            V +VG +G GKSTI + L R+ +  TG I +D  DI+ V+   LRR ++I+ Q+P L SG
Sbjct: 1438 VGVVGRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSG 1497

Query: 537  TIRDNIT----------------YGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILG 580
            TIR N+                   L+ +       S          + KF N  + I  
Sbjct: 1498 TIRSNLDPYNEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKNEI-T 1556

Query: 581  PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITII 640
              G  LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  K  K    TI+
Sbjct: 1557 EGGNNLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRKEFKES--TIL 1614

Query: 641  SIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
            +IAHRL ++   + ++V+       + G+ KE Y  P S L
Sbjct: 1615 TIAHRLRSVCDYDKILVM-------DAGEVKE-YDHPYSLL 1647

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 116/248 (46%), Gaps = 18/248 (7%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           N   I F+N + ++  + S    ++L+     G    ++GP+G GKS++   LL   +  
Sbjct: 727 NGNRIAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLE 786

Query: 502 TGQIFV---DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQD-EVRS 557
            G I V   D +D   +    +   ++   Q   L++ T+R+NI   L   P  +    +
Sbjct: 787 NGNIIVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNI---LFNSPYNEARYNA 843

Query: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           + + C              T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 844 VVEACCLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVD 903

Query: 618 VESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
             +   I  N   G LM+++  T I ++H ++   R+  ++V+  DG V + G       
Sbjct: 904 SHTALWIYDNCITGPLMENR--TCILVSHNIALTLRNAELVVILEDGRVKDQG------- 954

Query: 676 DPGSELSK 683
           DP + L K
Sbjct: 955 DPVTILQK 962

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  149 bits (375), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 149/544 (27%), Positives = 249/544 (45%), Gaps = 53/544 (9%)

Query: 173 LVGV-SLL-VGTAA--NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLI 228
            VGV SLL VG+AA  N   +I+L   S R   +L  N+ K  +     FF+   VG +I
Sbjct: 449 FVGVYSLLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRII 508

Query: 229 SRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF 288
           +R SSD   V  SL    S  FK++L   V I ++    P    F +FL    +   +++
Sbjct: 509 NRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYYQTFY 568

Query: 289 GRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIF-NVGKQS 347
             L R   R +  +   +  +  E  +G   + +          YNH  R I+ N  K  
Sbjct: 569 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDA----------YNHYERFIYLNYDKIQ 618

Query: 348 AFINAKF----------FSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
           + I+  F            L  +   +     L   + +     LS G +   M Y+   
Sbjct: 619 SNIDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEV 678

Query: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIP---SISPT-LGKKFVPNKGEIEFKNVSF 453
            SS+  +      I     +  R+ E  +  P   SI+P     +  P++G IEFKN S 
Sbjct: 679 TSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYST 738

Query: 454 SYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
            Y     + + K+++  I     + IVG +G GKST++  L R   P+ G+I +D  +IS
Sbjct: 739 KYRENL-DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNIS 797

Query: 514 KVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKF-- 571
           ++    LR +++I+ Q+     GT+R N+      + ++DE++   +     + + K   
Sbjct: 798 ELGLFDLRSNLAIIPQDAQAFEGTVRTNL--DPFNRYSEDELKRAIELAHLKSHLEKMLG 855

Query: 572 ----------------PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
                            +  D  +  +G+ LS GQ+Q + +ARAL+    IL+LDEAT++
Sbjct: 856 NEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATAS 915

Query: 616 LDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
           +D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL + G+V E     +L +
Sbjct: 916 VDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLS 972

Query: 676 DPGS 679
           D GS
Sbjct: 973 DKGS 976

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 139/282 (49%), Gaps = 24/282 (8%)

Query: 459 ASNQI-FKNLS-FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS 516
            S+QI  KN+  F+   G  +C+VG  G GKST    +L       GQ+         ++
Sbjct: 77  GSSQIALKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLA 129

Query: 517 SKSLRRHMSI--VQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS 574
            K + R  S+    QE  +M+ ++R+NI +G   K  +       K C     +   P+ 
Sbjct: 130 PKLIIRASSLAYCSQESWIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDG 187

Query: 575 YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GKLM 632
            +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   GK  
Sbjct: 188 DETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTA 247

Query: 633 KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY--ADPGSELSKLLHEKAT 690
             K+ TII   + +S ++ S+ +  L N G + E G ++ +    +  S+L KLL E  T
Sbjct: 248 LLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEEFDT 306

Query: 691 ----RSERQQNTAEDQEIDPEETINIENSTPESDITQELLEN 728
                +E  + T +  E D EET+ ++    ES+   E+  N
Sbjct: 307 PIDNMNESDRRTDQSPERDEEETLQLK--VVESEAEDEVATN 346

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 149/544 (27%), Positives = 249/544 (45%), Gaps = 53/544 (9%)

Query: 173  LVGV-SLL-VGTAA--NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLI 228
             VGV SLL VG+AA  N   +I+L   S R   +L  N+ K  +     FF+   VG +I
Sbjct: 1020 FVGVYSLLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRII 1079

Query: 229  SRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF 288
            +R SSD   V  SL    S  FK++L   V I ++    P    F +FL    +   +++
Sbjct: 1080 NRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYYQTFY 1139

Query: 289  GRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIF-NVGKQS 347
              L R   R +  +   +  +  E  +G   + +          YNH  R I+ N  K  
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDA----------YNHYERFIYLNYDKIQ 1189

Query: 348  AFINAKF----------FSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
            + I+  F            L  +   +     L   + +     LS G +   M Y+   
Sbjct: 1190 SNIDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEV 1249

Query: 398  GSSIFGLSTFYSEIMQGAGAASRLFELTDRIP---SISP-TLGKKFVPNKGEIEFKNVSF 453
             SS+  +      I     +  R+ E  +  P   SI+P     +  P++G IEFKN S 
Sbjct: 1250 TSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYST 1309

Query: 454  SYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
             Y     + + K+++  I     + IVG +G GKST++  L R   P+ G+I +D  +IS
Sbjct: 1310 KYRENL-DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNIS 1368

Query: 514  KVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKF-- 571
            ++    LR +++I+ Q+     GT+R N+      + ++DE++   +     + + K   
Sbjct: 1369 ELGLFDLRSNLAIIPQDAQAFEGTVRTNL--DPFNRYSEDELKRAIELAHLKSHLEKMLG 1426

Query: 572  ----------------PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
                             +  D  +  +G+ LS GQ+Q + +ARAL+    IL+LDEAT++
Sbjct: 1427 NEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATAS 1486

Query: 616  LDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
            +D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL + G+V E     +L +
Sbjct: 1487 VDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLS 1543

Query: 676  DPGS 679
            D GS
Sbjct: 1544 DKGS 1547

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 116/462 (25%), Positives = 210/462 (45%), Gaps = 58/462 (12%)

Query: 308 KVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRH---IFNVGKQSAFINAKFFSLTAVLGDM 364
           K   E  + IK+++ +  E+  +K+ NH +R+   + N  K     N  +F+   V    
Sbjct: 473 KTITELLNAIKSIKLYAWEEPMMKKLNH-VRNDMELKNFRKIGIVSNLIYFAWNCV---- 527

Query: 365 SFLVVLA-YGSYLVLHGS-LSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRL- 421
             +V  + +G + + + + LS   +   +       S+I+ + +  + I++ + +  RL 
Sbjct: 528 PLMVTCSTFGLFSLFNDTPLSPSIVFPSLSLFNILNSAIYSVPSMINSIIETSVSMERLK 587

Query: 422 -FELTDRIPS--ISPTLGKKFVPNKGEIEFKNVSFSYPTR---ASNQI------------ 463
            F L+D +    I  T           +E  N++F + ++   AS+Q+            
Sbjct: 588 SFLLSDEVDDSFIERTNSPSSDSALPVLEMNNITFLWKSKEALASSQLENNSRTDEESIM 647

Query: 464 ------FKNLS-FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS 516
                  KN+  F+   G  +C+VG  G GKST    +L       GQ+         ++
Sbjct: 648 GSSQIALKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLA 700

Query: 517 SKSLRRHMSI--VQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS 574
            K + R  S+    QE  +M+ ++R+NI +G   K  +       K C     +   P+ 
Sbjct: 701 PKLIIRASSLAYCSQESWIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDG 758

Query: 575 YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GKLM 632
            +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   GK  
Sbjct: 759 DETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTA 818

Query: 633 KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY--ADPGSELSKLLHEKAT 690
             K+ TII   + +S ++ S+ +  L N G + E G ++ +    +  S+L KLL E  T
Sbjct: 819 LLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEEFDT 877

Query: 691 ----RSERQQNTAEDQEIDPEETINIENSTPESDITQELLEN 728
                +E  + T +  E D EET+ ++    ES+   E+  N
Sbjct: 878 PIDNMNESDRRTDQSPERDEEETLQLK--VVESEAEDEVATN 917

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 139/506 (27%), Positives = 234/506 (46%), Gaps = 66/506 (13%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            ++ K +H +  FFD+  +G +++R S D   V + L   +      ++  S  I ++  I
Sbjct: 1144 LLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTILLITYI 1203

Query: 267  SPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKT 319
            +P+      FL   ++++  Y+  G L    SR+L+    S+TK        E   G+ T
Sbjct: 1204 TPE------FLIIAILVAGLYYAIGVLYLAGSRELKR-FDSITKSPIYQHFSETLVGVTT 1256

Query: 320  VQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAY 372
            V+++  E + ++     I             N  FF L      ++F       LV+   
Sbjct: 1257 VRAYGDEARFMRENLKMIDEN----------NKPFFYLWVSNRWLAFRIDVVGALVIFGS 1306

Query: 373  GSYLVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL--T 425
            G +++L+       L+   L+  + +TE    S   L   YS +     +  RL E    
Sbjct: 1307 GVFVLLNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYMEV 1362

Query: 426  DRIPSISPTLG-KKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSG 484
            ++ P  S +L      P +G+IE  +VS  Y      ++ KN +F +D    V IVG +G
Sbjct: 1363 EQEPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP-RVIKNATFTVDPKMKVGIVGRTG 1421

Query: 485  RGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI-- 542
             GKSTI + L R+ +P TG I +D  DIS +  K LRR ++I+ Q+P L SGTI+ N+  
Sbjct: 1422 AGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNLDP 1481

Query: 543  -----------TYGLVEKPTQDEVRS--ITKKCFCHNFITKFPNSYDTILGPHGTLLSGG 589
                           V   T+ E+ S    ++        KF N  + I    G+ LS G
Sbjct: 1482 YDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNVNNEI-SEGGSNLSQG 1540

Query: 590  QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTI 649
            Q+Q + +AR+L++ P +++LDEAT+++D  S+  I  T          TI++IAHRL T+
Sbjct: 1541 QRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRNEFDDS--TILTIAHRLRTV 1598

Query: 650  RRSENVIVLGNDGSVAEVGKFKELYA 675
               + ++V+       EV +F   Y+
Sbjct: 1599 IDYDKILVM----DAGEVKEFDHPYS 1620

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 116/233 (49%), Gaps = 11/233 (4%)

Query: 443 KGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTT 502
           + +I FKN + ++     +   +N+      G    I+GP+G GK+++   LL   +   
Sbjct: 700 QNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLID 759

Query: 503 GQIFV---DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSIT 559
           G+I V   D ++  K+ +  L   ++   Q   L++ T+R+NI   L   P  +E  +  
Sbjct: 760 GEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNI---LFNSPYCEERYNAV 816

Query: 560 KKCFCHNFITKFPNSYD-TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +        +  N+ D T +G  G  LSGGQKQR+++ARAL      L+LD+  SA+D 
Sbjct: 817 VEASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDS 876

Query: 619 ESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
            +   I  N   G LM+++  T I ++H ++   R+ + +V   +G + E G+
Sbjct: 877 HTATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKLENGKIVEHGE 927

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  148 bits (374), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 240/519 (46%), Gaps = 86/519 (16%)

Query: 206  NVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVS-DGFKAMLCGSVGIGMMI 264
            N++   +H    FFD   +G +++R + D   V + LT  +    F  + C S+ I ++ 
Sbjct: 1083 NMLDLVLHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSI-IFLIT 1141

Query: 265  SISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKT 319
             I+P      L +   V +   + G      SR+L+    S+TK        E   G+ T
Sbjct: 1142 IITPHF----LIVAVVVFILYYFVGMWYLTASRELKR-IDSITKSPIFQHFSETLVGVCT 1196

Query: 320  VQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAY 372
            +++F  E++ I      + ++  + +     N  FF L+  +   +F        +VLA 
Sbjct: 1197 IRAFGDEKRFI------LENLDKIDQN----NRAFFYLSVAVKWFAFRVDIIGAFIVLAS 1246

Query: 373  GSYLVLH-GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT------ 425
            GS+++++ G++  G     + Y          L   YS       +  RL E +      
Sbjct: 1247 GSFILINIGNIDSGLAGISLTYAILFTDGALWLVRLYSTFEMSMNSVERLKEYSSIEQEN 1306

Query: 426  --DRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASN--QIFKNLSFKIDAGSNVCIVG 481
              D        L +   P  G+IE  N+S  Y   ASN   + KN+SF I+  S V IVG
Sbjct: 1307 YFDYNKDHIQELQQSSWPEHGQIEVDNLSLRY---ASNLPPVIKNVSFTIEPQSKVGIVG 1363

Query: 482  PSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN 541
             +G GKSTI + L R   P TG I +DG DIS++   +LRR ++I+ Q+P+L +GTI+ N
Sbjct: 1364 RTGAGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSN 1423

Query: 542  ITYGLVEKPTQDEVRSITKKCFCHNFIT-------------------KFPNSYDTILGPH 582
                 V+   + + + I K     N I+                   KF N   T +   
Sbjct: 1424 -----VDPCDEYDNKKIFKVLSQVNLISTGEMEAAQNMGDDSNTARNKFVN-LQTEITEG 1477

Query: 583  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES----EGAINYTFGKLMKSKSIT 638
            G  +S G++Q + IAR+L+++P I++LDEATS++D ES    +G I   F K       T
Sbjct: 1478 GQNISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS------T 1531

Query: 639  IISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP 677
            I++IAHRL ++   + V+V+       + G+ KE Y  P
Sbjct: 1532 ILTIAHRLRSVIDYDRVLVM-------DAGEIKE-YDHP 1562

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 146/302 (48%), Gaps = 29/302 (9%)

Query: 441 PNKGEIEFKNVSFSY-PTRASNQIFK----NLSFKIDAGSNVCIVGPSGRGKSTIASLLL 495
           P++ +IEFKN + ++      + IFK    N++F+I  G    I+G +G GKS +   LL
Sbjct: 661 PDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQI--GKLNLILGSTGSGKSALLMGLL 718

Query: 496 RYYNPTTGQIFVDG----QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPT 551
              +  +G I V G     D+       L    +   Q   L++ T+++NI +       
Sbjct: 719 GELHLISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFN----GA 773

Query: 552 QDEVR--SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
            D+VR   +   C     +   P    T +G  G  LSGGQKQRI++ARA+      ++L
Sbjct: 774 YDDVRYKEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLL 833

Query: 610 DEATSALDVESEGAI--NYTFGKLMKSKSITIISIAHRLS-TIRRSENVIVLGNDGSVAE 666
           D+  SA+D  +   I  N   G +M+++  T I + H +S TIR +   ++L N G V  
Sbjct: 834 DDCLSAVDSHTAVWIYENCITGPIMENR--TCILVTHNVSLTIREAYFAVILEN-GKVKN 890

Query: 667 VGKFKELYADP--GSELSKLLHEKATRSERQQNTAED-QEIDPEETINI-ENSTPESDIT 722
            G  K+L        E++++ + K  R+E+  N   D QE D ++T  + EN     D+ 
Sbjct: 891 QGTIKQLEKTGIFKEEIAQMSY-KGDRTEKSVNETSDLQESDSQKTKGVTENKESGEDLV 949

Query: 723 QE 724
           Q+
Sbjct: 950 QK 951

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 148/551 (26%), Positives = 250/551 (45%), Gaps = 82/551 (14%)

Query: 178  LLVGTAANY---GRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSD 234
            L++G A +    G+ IL  V       ++   ++ K +H    FFD    G +++R S D
Sbjct: 1109 LIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKD 1168

Query: 235  AYVVSRSLTQKVSDGFKAML-CGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF--GRL 291
               + + LT  +   F +++ C S  I ++  I+PQ      FL+  +++S  Y+  G  
Sbjct: 1169 IEAIDQELTPYIQGAFYSLIECLSTVI-LITFITPQ------FLSVAIVVSILYYFVGYF 1221

Query: 292  IRNNSRDLQE----ATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQS 347
                SR+L+     +   + +   E   G+ T+++F  E + ++     I          
Sbjct: 1222 YMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDEN------- 1274

Query: 348  AFINAKFFSLTAVLGDMSF-------LVVLAYGSYLV-----LHGSLSIGDLTAYMMYTE 395
               N  FF L      ++F       LV+   G +++     L   ++   LT  + +TE
Sbjct: 1275 ---NKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNINHLDSGMAGISLTYAISFTE 1331

Query: 396  YTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP-----NKGEIEFKN 450
                    L   Y+E+     +  R+ E  +      P    K VP       G+IE  +
Sbjct: 1332 ----GALWLVRLYAEVEMNMNSVERVKEYME--IEQEPYNQHKEVPPPQWPQDGKIEVND 1385

Query: 451  VSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQ 510
            +S  Y      ++ KN+SF +DA S + IVG +G GKSTI + L R+  P TG I +D  
Sbjct: 1386 LSLRYAPNLP-RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT----------------YGLV--EKPTQ 552
            DIS V  + LRR ++I+ Q+P L SGTI+ N+                   L+  E+  Q
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQ 1504

Query: 553  DEVRSITKKCFCHNF--ITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
               R         N   + KF +   + +   G+ LS GQ+Q + +AR+L++ P I++LD
Sbjct: 1505 GTTREADNDNSSTNSENVNKFLD-LSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLD 1563

Query: 611  EATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670
            EAT+++D  S+  I  T  K  +    TI++IAHRL ++   + ++V+       + G+ 
Sbjct: 1564 EATASIDYGSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-------DAGEV 1614

Query: 671  KELYADPGSEL 681
            KE Y  P S L
Sbjct: 1615 KE-YDHPYSLL 1624

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 141/306 (46%), Gaps = 23/306 (7%)

Query: 441 PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
           PN     F+N + S+     +   K+L+ +   G    ++GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 501 TTGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-TQDEVR 556
            +G++ V   +  +   V +      ++   Q   L++ T+++NI   L   P  +   +
Sbjct: 749 LSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNI---LFNSPFNEARYK 805

Query: 557 SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
           ++ + C              T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 617 DVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK----- 669
           D  +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G      
Sbjct: 866 DSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDML 923

Query: 670 ----FKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESDITQEL 725
               F E      S LS+  +  A  + +   +  +  +  E+ +++ N++P+ +  +  
Sbjct: 924 QRGLFGEDELVKSSILSR-ANSSANLATKSSTSLSNLAVAKEQQVSMNNNSPQFEAKK-- 980

Query: 726 LENPIK 731
           L+ P++
Sbjct: 981 LQKPLR 986

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 139/521 (26%), Positives = 239/521 (45%), Gaps = 83/521 (15%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAML-CGSVGIGMMIS 265
            ++ K +H    FFD    G +++R S D   + + LT  +   F +++ C S  I ++  
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVI-LITF 1199

Query: 266  ISPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQE----ATGSLTKVAEEQFSGIKT 319
            I+PQ      FL+  +++S  Y+  G      SR+L+     +   + +   E   G+ T
Sbjct: 1200 ITPQ------FLSIAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTT 1253

Query: 320  VQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAY 372
            +++F  E + ++     I             N  FF L      ++F       LV+   
Sbjct: 1254 IRAFGDEGRFMQENLQKIDEN----------NKPFFYLWVANRWLAFRIDMIGSLVIFGA 1303

Query: 373  GSYLVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT-- 425
            G +++ +       ++   LT  + +TE        L   YSE+     +  R+ E    
Sbjct: 1304 GLFILFNIDHIDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMKI 1359

Query: 426  -----DRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIV 480
                 ++   + P+      P  G+IE  ++S  Y      ++  N+SF +DA S + IV
Sbjct: 1360 EQEPYNQHKEVPPSQW----PQDGKIEVNDLSLRYAPNLP-RVINNVSFSVDAQSKIGIV 1414

Query: 481  GPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRD 540
            G +G GKSTI + L R+  P TG I +D  DIS V  + LRR ++I+ Q+P L SGTI+ 
Sbjct: 1415 GRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKT 1474

Query: 541  NIT----------------YGLV--EKPTQDEVRSITKKCFCHNF--ITKFPNSYDTILG 580
            N+                   L+  E+  Q  VR        ++   I KF +   + + 
Sbjct: 1475 NLDPYDEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSENINKFLD-LSSEVS 1533

Query: 581  PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITII 640
              G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  K  +    TI+
Sbjct: 1534 EGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TIL 1591

Query: 641  SIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
            +IAHRL ++   + ++V+       + G+ KE Y  P S L
Sbjct: 1592 TIAHRLRSVIDYDKILVM-------DAGEVKE-YDHPYSLL 1624

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 139/305 (45%), Gaps = 21/305 (6%)

Query: 441 PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500
           PN      +N + S+     +   K+L+ +   G    ++GP+G GK+++   LL     
Sbjct: 689 PNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 501 TTGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-TQDEVR 556
             G+I V   +  +   V +      ++   Q   L++ TI+ NI   L   P  +   +
Sbjct: 749 LNGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNI---LFNSPFNEARYK 805

Query: 557 SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
           ++ + C              T +G  G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 617 DVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK----- 669
           D  +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG + + G      
Sbjct: 866 DSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRIKDQGDPIDML 923

Query: 670 FKELYADPGSELSKLL---HEKATRSERQQNTAEDQEIDPEETINIENSTPESDITQELL 726
            K L+ +     S +L   +  A  + +   +  +     E+ I++ N++P+ + T+  L
Sbjct: 924 QKGLFGEDELVKSSILSRANSSANLATKSNTSLSNLPAVKEQKISVNNNSPQFESTK--L 981

Query: 727 ENPIK 731
           + P++
Sbjct: 982 QKPMR 986

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 142/533 (26%), Positives = 240/533 (45%), Gaps = 48/533 (9%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F        +       G+  +L V+       L    +K+ +H    + D 
Sbjct: 932  SFYMGLYSFFVFAAFIFM------NGQYTILCVMGIMASKWLNLKAVKRILHTPMSYIDT 985

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMM-ISISPQLSAFLLFLTPP 280
              +G +++R + D   +   LT+ +     +     VG+ +M I   P  +  + FL   
Sbjct: 986  TPLGRILNRFTKDTDSLDNELTESLR-LLTSQFANIVGVCVMCIVYLPWFAIAIPFLLVI 1044

Query: 281  VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340
             +L A ++    R   R        +     E   G+ T++++ ++++ + + +  I  +
Sbjct: 1045 FVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINKM 1104

Query: 341  FNVGKQSAFIN---AKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
               G     +      F  + A++   + +V L   +      + S+G L  Y++     
Sbjct: 1105 NEAGYLVVVLQRWVGVFLDMVAIV--FALIVTLLCVTRAFPISAASVGVLLTYVLQLPGL 1162

Query: 398  GSSIFGLSTFYSEIMQGA----GAASRL-FELTDRIPSISPTLGKKFVPNKGEIEFKNVS 452
             ++I    T     M  A      A+ L  E   R P ++P    +  P+KGEI  +NV 
Sbjct: 1163 LNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTP---PESWPSKGEIVLENVC 1219

Query: 453  FSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDI 512
            FSY       + KNL+  I++G  + I G +G GKSTI S L R    + G+I +D  DI
Sbjct: 1220 FSYRP-GLPVVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILIDDVDI 1278

Query: 513  SKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR-------SITK----- 560
            SK+    LRR ++I+ Q+PVL  GTIR N+     ++ T DE+        +I K     
Sbjct: 1279 SKLGLFDLRRKLAIIPQDPVLFRGTIRKNLDP--FDERTDDELWDALVRGGAIAKNDLSE 1336

Query: 561  -------KCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEAT 613
                   K   H  + KF    D  +   G+  S G++Q +A+ RAL+++  ILILDEAT
Sbjct: 1337 AKLQKPDKNGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEAT 1394

Query: 614  SALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            S++D E++G I      + +    TI+ IAHRL TI   + ++VL   G VAE
Sbjct: 1395 SSVDYETDGKIQARI--VEEFGDCTILCIAHRLQTIVNYDRILVL-EKGEVAE 1444

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 121/249 (48%), Gaps = 27/249 (10%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           FK+L+F+I  G  + I GP G GKS++ + +      T G+I V+G              
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNGD------------- 650

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHG 583
             ++   P + +  +RDNI +G      +++   + + C     +   P    T +G  G
Sbjct: 651 -LLMCGYPWIQNAPVRDNIIFG--SPFIKEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIISI 642
             LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     ++ +K  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 643 AHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQ 702
            H+LS I R+  VIVLG DG V ++G   EL A     L KLL   +      QN+ E++
Sbjct: 766 THQLSLIERASRVIVLGTDGQV-DIGTVDELKAR-NQTLIKLLQFSS------QNSKEEE 817

Query: 703 EIDPEETIN 711
           ++  E  IN
Sbjct: 818 DVPEEGIIN 826

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 143/537 (26%), Positives = 252/537 (46%), Gaps = 79/537 (14%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            ++ K +H    FFD+  +G +++R S D   + + L       F + +     I ++  I
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFI 1193

Query: 267  SPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKT 319
            +PQ      FL+  +++   Y+  G      SR+L+    S+TK        E   G+ T
Sbjct: 1194 TPQ------FLSVAIIVGMLYYMIGYFYLTGSRELKRL-DSITKSPIYQHFSETLVGVTT 1246

Query: 320  VQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAY 372
            +++F  E + ++       ++  + +     N  FF L      +SF       LVV   
Sbjct: 1247 IRAFGDESRFLRE------NLLKIDEN----NRPFFYLWVANRWLSFRIDVIGALVVFGS 1296

Query: 373  GSYLV-----LHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT-- 425
            G +++     +   ++   LT  + +TE        L  FYSE+     +  R+ E    
Sbjct: 1297 GIFILTNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTI 1352

Query: 426  DRIP----SISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVG 481
            ++ P     +S +      P +G IE  ++S  Y      ++ KN++F +D  + V +VG
Sbjct: 1353 EQEPYDEVQVSDSKVPADWPEEGRIEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVG 1411

Query: 482  PSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN 541
             +G GKSTI + L R+    TG I +DG DI+ V+   LRR ++I+ Q+P L SGTI+ N
Sbjct: 1412 RTGAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSN 1471

Query: 542  I-------------TYGLVEKPTQDEVRSITKK-----CFCHNFITKFPNSYDTILGPHG 583
            +                 V   T++E+ S T+            I +F +  ++ +   G
Sbjct: 1472 LDPYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLD-LESEIAEGG 1530

Query: 584  TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIA 643
            T  S GQ+Q I +AR+L++ P IL+LDEAT+++D +S+  +  T  +   S+S TI++IA
Sbjct: 1531 TNFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETI-RTEFSES-TILTIA 1588

Query: 644  HRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAE 700
            HRL ++   + ++V+G        G+ KE Y  P    S LL++ +      +N+ E
Sbjct: 1589 HRLRSVIDYDKILVMG-------AGEVKE-YDHP---YSLLLNKNSIFYSMCENSGE 1634

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 111/232 (47%), Gaps = 9/232 (3%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           NK +I FKN + ++     +   +NL+     G    I+GP+G GK+++   LL   N  
Sbjct: 697 NKNQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLL 756

Query: 502 TGQIFVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSI 558
            GQI V   +      V S      ++   Q   L++ T+R+NI +      T+    ++
Sbjct: 757 EGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YHNV 814

Query: 559 TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            + C              T +G  G  LSGGQKQRI++ARAL      ++LD+  SA+D 
Sbjct: 815 VEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDA 874

Query: 619 ESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
            +   +  N   G LM+ +  T I ++H ++   R+ +++V+  DG V + G
Sbjct: 875 HTALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVVMLEDGQVKDQG 924

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 145/536 (27%), Positives = 260/536 (48%), Gaps = 38/536 (7%)

Query: 173  LVGVSLLVGTAA----NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLI 228
             VGV  L+G A+    N   +++L   S R   +L  ++ K  +     FF+   VG +I
Sbjct: 1020 FVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRII 1079

Query: 229  SRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF 288
            +R SSD   V  +L    S  FK++L   V + ++    P    F +FL    +   +++
Sbjct: 1080 NRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFY 1139

Query: 289  GRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEI----KRYNHAIRHIFNVG 344
              L R   R +  +   +  +  E  +G   + ++   ++ I    ++  + +  +FN  
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFR 1199

Query: 345  KQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGL 404
              + +++ +  ++ A +   + ++ LA  +      S  +G L +Y +  E TGS  + +
Sbjct: 1200 STNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGMVGLLMSYSL--EVTGSLTWIV 1257

Query: 405  STFYSEIMQGAGAASRLFELTDRIP---SISP-TLGKKFVPNKGEIEFKNVSFSYPTRAS 460
             T  + I     +  R+ E  +  P   SI+P     +  P+KG IEFKN S  Y     
Sbjct: 1258 RTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYRENL- 1315

Query: 461  NQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSL 520
            + +  N++ KI+    V IVG +G GKST++  L R   PT G+I +DG DIS +    L
Sbjct: 1316 DPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDL 1375

Query: 521  RRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS------ 574
            R H++I+ Q+     GT++ N+      + ++DE++   ++      + K  +S      
Sbjct: 1376 RSHLAIIPQDAQAFEGTVKTNL--DPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDD 1433

Query: 575  -----------YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
                        D  +  +G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E++  
Sbjct: 1434 SNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKI 1493

Query: 624  INYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGS 679
            I  T  +  K +  TI++IAHR+ T+  S+ +IVL + GSV E     +L +D  S
Sbjct: 1494 IQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVREFDSPSKLLSDKTS 1546

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 127/520 (24%), Positives = 227/520 (43%), Gaps = 82/520 (15%)

Query: 251 KAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA 310
           KA++ G V + +M+ I+                  ++  R ++  S+   +      K  
Sbjct: 434 KAVIGGLVTMAIMMPIN------------------AFLSRKVKKLSKTQMKYKDMRIKTI 475

Query: 311 EEQFSGIKTVQSFVAEQKEIKRYNHAIRH---IFNVGKQSAFINAKFFSLTAVLGDMSFL 367
            E  + IK+++ +  E+  + R NH +R+   + N  K     N  +F+   V      +
Sbjct: 476 TELLNAIKSIKLYAWEEPMMARLNH-VRNDMELKNFRKIGIVSNLIYFAWNCV----PLM 530

Query: 368 VVLA-YGSYLVLHGS-LSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRL--FE 423
           V  + +G + +   S LS   +   +       S+I+ + +  + I++ + +  RL  F 
Sbjct: 531 VTCSTFGLFSLFSDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFL 590

Query: 424 LTDRIPS-----ISPTLGKKFVPNKGEIEFKNVSFSYPTR-------------------- 458
           L+D I       I P+  ++ +P    IE  N++F + ++                    
Sbjct: 591 LSDEIDDSFIERIDPSADERALP---AIEMNNITFLWKSKEVLTSSQSGDNLRTDEESII 647

Query: 459 ASNQI-FKNLS-FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS 516
            S+QI  KN+  F+   G  VC+VG  G GKST    +L       GQ+         + 
Sbjct: 648 GSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAIL-------GQLPCMSGSRDSIP 700

Query: 517 SKSLRRHMSI--VQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS 574
            K + R  S+    QE  +M+ ++R+NI +G   K  QD      K C     +   P+ 
Sbjct: 701 PKLIIRSSSVAYCSQESWIMNASVRENILFG--HKFDQDYYDLTIKACQLLPDLKILPDG 758

Query: 575 YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GKLM 632
            +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y   GK  
Sbjct: 759 DETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTA 818

Query: 633 KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY--ADPGSELSKLLHE--- 687
             K+ TII   + +S ++ S+ +  L N G + E G ++++    +  S+L KLL E   
Sbjct: 819 LLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYEDVMNRKNNTSKLKKLLEEFDS 877

Query: 688 ---KATRSERQQNTAEDQEIDPEETINIENSTPESDITQE 724
                  S+ Q     + E+D    + +  S  E ++  E
Sbjct: 878 PIDNGNESDVQTEHRSESEVDEPLQLKVTESETEDEVVTE 917

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  145 bits (365), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 132/484 (27%), Positives = 236/484 (48%), Gaps = 29/484 (5%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  S  F   +  S  IG++   + Q     +F+
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGVICVTTWQF----IFV 1098

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+ +   Y+ +     SR+L+    S+T+       +E   GI T++ +  +QK   +
Sbjct: 1099 IVPLGVFYIYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGIVTIRGY-GQQKRFSQ 1156

Query: 333  YNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL---HGSLSIGDLTA 389
             N   R   N+      +NA  + L   L  +  +++L   +  V+    G+L+ G +  
Sbjct: 1157 INQC-RVDNNMSAFYPSVNANRW-LAYRLELIGSIIILGAATLSVMRLKQGTLTAGMVGL 1214

Query: 390  YMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTL-----GKKFVPNKG 444
             + Y      S+  +     E+     +  R+ E  D + S +P +      ++  P +G
Sbjct: 1215 SLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAD-LKSEAPEIIEDHRPQETWPEEG 1273

Query: 445  EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQ 504
            +I+F++ S  Y     + + K+++F I     + IVG +G GKS++   L R    + G 
Sbjct: 1274 DIKFEHYSTRYRPEL-DLVLKDINFHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEGN 1332

Query: 505  IFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFC 564
            I +D  DIS +    LR  +SI+ Q+  +  GTIR+NI      + T +++  + +    
Sbjct: 1333 IIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPTNQYTDEQIWRVLELSHL 1390

Query: 565  HNFI-TKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
             + I T   +  DT L   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  
Sbjct: 1391 RDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAVDVETDKV 1450

Query: 624  INYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSK 683
            +  T     K +  TI++IAHR++TI  ++ ++VL N GS+ E  + K+L  +  S    
Sbjct: 1451 LQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLDN-GSIKEFDEPKKLLENKSSLFYS 1507

Query: 684  LLHE 687
            L  E
Sbjct: 1508 LCEE 1511

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 116/533 (21%), Positives = 231/533 (43%), Gaps = 75/533 (14%)

Query: 225 GDLISRLSSDAYV---VSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPV 281
           GD+++ +S D      +S+ +    S  F+ +LC  + +  ++  S  +   +L +  P+
Sbjct: 402 GDIVNLMSVDVQKLQDISQFINLLWSAPFQIVLC-LISLYKLLGHSMWVGVIILVIMMPL 460

Query: 282 MLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAE-----QKEIKRYNHA 336
               S+  +  +   +   +     T+V  E  + IK+++ +  E     + E  R N  
Sbjct: 461 ---NSFLMKTQKKLQKSQMQFKDERTRVISEILNNIKSLKLYAWETPYKAKLENVRNNKE 517

Query: 337 IRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEY 396
           ++++  +G   A ++ +F ++   L   S   V  Y     L   L    LT + +    
Sbjct: 518 LKNLTKLGCYMALMSFQF-NVVPFLVSCSTFAVFVYTEDRPLTTDLVFPALTLFNL---- 572

Query: 397 TGSSIFGLSTFYSEIMQGAGAASRLFEL----------TDRIPSISPTLGKKFVPNKGEI 446
               +  +    + +++ + +  RLF              R+P ++  +G   + N G+ 
Sbjct: 573 LHFPLMVIPNVLTALIECSVSVGRLFSFLTNEELQKDSVQRLPKVTE-IGDVAI-NVGD- 629

Query: 447 EFKNVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
              + +F +  +   ++  KN++F+   G   CIVG  G GKS +   +L       G +
Sbjct: 630 ---DATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALIQSIL-------GDL 679

Query: 506 F-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFC 564
           F V G         ++  +++ V Q   +M+GT++DNI +G   K   +      K C  
Sbjct: 680 FRVKG-------FATIHGNVAYVSQVAWIMNGTVKDNILFG--HKYDAEFYEKTIKACAL 730

Query: 565 HNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD------- 617
              ++   +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D       
Sbjct: 731 TIDLSVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHL 790

Query: 618 ---VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY 674
              V     + +T  K++ +  ++++S+A  +S          L  +G + + G + E+ 
Sbjct: 791 IEHVLGPNGLLHTKTKVLATNKVSVLSVADSVS----------LLENGEIVQQGSYDEIM 840

Query: 675 ADPGSELSKLLHEKATRSERQQNTAEDQEIDP-EETINI-ENSTPESDITQEL 725
            D  S+L+KL+ E   +S    N A    I P   + NI E + P  D  +EL
Sbjct: 841 KDGASQLNKLIMEYGKKS--NGNPASSNAITPASSSTNIREQTIPLEDELKEL 891

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  145 bits (365), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 145/562 (25%), Positives = 249/562 (44%), Gaps = 80/562 (14%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F    G   +      +  + ++ +++ +    L    +K+ +H    + D 
Sbjct: 933  SFYMGLYSFFVFGGYLFM---NIQFTMLCMMGIMASK---WLNLKAVKRILHAPMSYLDT 986

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMM-ISISPQLSAFLLFLTPP 280
              +G +++R + D   +   LT+ +     +     +G+ ++ I   P  +  + FL   
Sbjct: 987  TPLGRILNRFTKDTDSLDNELTENIR-LMMSQFANIIGVCVLCIVYLPWFAIAIPFLLLV 1045

Query: 281  VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340
             +L A ++    R   R        +     E   G+ T++++    K   RY   +  +
Sbjct: 1046 FVLIADHYQSAGREIKRLEAIQRSFVYNNLIEVLGGMDTIKAY----KSQDRYMTKMDFL 1101

Query: 341  FNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL-------HGSLS-IGDLTAYMM 392
             N   + +++        A+  DM   + +A+   + L       H S S +G L  Y++
Sbjct: 1102 INKMNEVSYMVVSVQRWVAIFLDM---IAVAFALIISLLCVTRQFHISPSAVGVLLTYVL 1158

Query: 393  Y--------------TEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKK 438
                           TE   +S   L T+ +E+ Q A      +   D  P+        
Sbjct: 1159 QLPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAYRKSDYSPPDNWPT-------- 1210

Query: 439  FVPNKGEIEFKNVSFSY----PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLL 494
                 GE+ F++VSF+Y    PT     + KN++  I  G  + I G +G GKSTI + L
Sbjct: 1211 ----NGEVIFEDVSFAYRPGLPT-----VLKNVNLSIAGGEKIGICGRTGAGKSTIMTAL 1261

Query: 495  LRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN------------- 541
             R    T+G+IF+DG D  K+    LRR +SI+ Q+PVL  GTIR N             
Sbjct: 1262 YRLNELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLW 1321

Query: 542  ---ITYGLVEKPTQDEVR-SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIA 597
               I  G +EK   ++++     K   +N + KF    D I+   G   S G++Q +A+ 
Sbjct: 1322 NSLIRGGAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALT 1379

Query: 598  RALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIV 657
            RAL+++  ILILDEATS++D E++G I        + +  TI+ IAHRL TI   + ++V
Sbjct: 1380 RALVRQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILV 1437

Query: 658  LGNDGSVAEVGKFKELYADPGS 679
            L   G VAE  K + L+ +  S
Sbjct: 1438 L-EKGEVAEFDKPEILFNNEKS 1458

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 112/211 (53%), Gaps = 20/211 (9%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F NL+F+I  G  + I GP G GKS++ + +  +   TTG++ ++G             H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHG 583
           M ++   P + + T+RDNI +G      +++ + + + C     I   P    T +G  G
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFG--SPYDREKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIISI 642
             LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  F + ++SK  T I  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 643 AHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
            H+LS I +++ VIVL  +GSV ++G  +EL
Sbjct: 779 THQLSLIEKADRVIVLSTNGSV-DIGTVEEL 808

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  145 bits (365), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 144/543 (26%), Positives = 249/543 (45%), Gaps = 44/543 (8%)

Query: 161  IAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD 220
            + F + +Y FISL    L     +N   ++LL V S +   +L   +    +     FF+
Sbjct: 1004 VLFYVGIYVFISLSAALL-----SNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFE 1058

Query: 221  NNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLF---L 277
               VG +I+R SSD   +  S+   +S    ++L   V   ++I I  Q+  FL+    L
Sbjct: 1059 TTPVGRIINRFSSDMNSLDDSVQYVMSFFLVSILDYLV---VVIIIGYQVPLFLIVNAVL 1115

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQK----EIKRY 333
                     Y+  L R   R +  +   +  +  E  +G   + +F    +     ++  
Sbjct: 1116 LVIYFYYQVYYVTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAFRHSDRFDYLNVENV 1175

Query: 334  NHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAY--GSYLVLHGSLSIGDLTAYM 391
               I  +FN    + +++ +  S+ A++   + L+ LA   G +     +LS G +   M
Sbjct: 1176 QFNINCLFNFRSTNRWLSIRLESIGALMILTTALLSLATKNGGH-----ALSTGMVGLLM 1230

Query: 392  MYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK----KFVPNKGEIE 447
             Y     + +  +     ++     +  R+ E  D  P   P +      K  P++G I 
Sbjct: 1231 SYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQGLIR 1290

Query: 448  FKNVSFSYPTRAS-NQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF 506
            FKN S  Y  RA+ + + ++L  +I     + IVG +G GKST++  L R   P+ G I 
Sbjct: 1291 FKNYSTRY--RANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTID 1348

Query: 507  VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHN 566
            +DG DISK+  K LR ++SI+ Q+     GT+R N+     E+ + +E+    +      
Sbjct: 1349 IDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNL--DPFEQYSDEEIWKALELSHLKP 1406

Query: 567  FITKF------PNSYDTIL----GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
             I K       P   + +L      +G+ LS GQ+Q + ++RAL+ +  IL+LDEAT+A+
Sbjct: 1407 HILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAV 1466

Query: 617  DVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD 676
            D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL + G V E      L A 
Sbjct: 1467 DSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKEFDSPSNLLAQ 1523

Query: 677  PGS 679
              S
Sbjct: 1524 KDS 1526

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 147/678 (21%), Positives = 298/678 (43%), Gaps = 83/678 (12%)

Query: 80  NTKEQESSTHTDGSNDKFELSDLKRLAR-LAKRDWKLLLTAISLLSVSCLIGMSLPKIIG 138
           N   +E + H + +  K   +  K L R + K   K +  AIS+  V   + +  P+++ 
Sbjct: 250 NLNVKEKANHLEVNWAKENWTGRKSLLRAIIKTFGKTIAVAISIEIVKDFMTILQPQLLR 309

Query: 139 IVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSER 198
           + + E     S     ++ V  +A GL L +FIS         T  +    I++      
Sbjct: 310 LFIQEFNVDYSRSHPALNAV-FVAIGLFLMKFIS---------TCLSNQFFIMIFEAGMG 359

Query: 199 VVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSL--TQKVSDGFKAMLCG 256
           +   L   + +K+++   E  ++   GD+++ +S D   + R    +Q++     A++  
Sbjct: 360 IRGALMTMLYRKSLNLSLEAKESKTAGDIMNLMSVDVLRIQRFFETSQELIGSPIALITT 419

Query: 257 SVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSG 316
            + +   +  S      ++ +  P+    SY  R ++   +       +  K   E  + 
Sbjct: 420 LISLYTFLGNSTAGGILVMAVMFPI---NSYLSRKVKTLIQQQMTYKDARIKTITELLNS 476

Query: 317 IKTVQSFVAEQKEIKRYNHAIRH---IFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYG 373
           +KTV+ +  E+  +KR +H +R+   + N  K S   N   F+   V       +++A  
Sbjct: 477 VKTVKLYAWEEPMLKRLDH-VRNDLELQNFKKISIITNLILFAWNCVP------ILVASS 529

Query: 374 SYLVLHGSLSIGDLTAYMMYTEYT-----GSSIFGLSTFYSEIMQGAGAASRLFELTDRI 428
           ++L+   ++ +  LT  +++   +        I+ +    +  ++   +  RL +     
Sbjct: 530 TFLIYALTMDV-PLTPQIVFPSLSLFDILNDCIYTIPRTITNFIETGVSLGRLKDFL--- 585

Query: 429 PSISPTLGKKFV-----PNKGE---IEFKNVSF------------SYPTRA---SNQI-F 464
             ++  + K F+     P+ G+   IE  N +F            SY   A   S+Q+  
Sbjct: 586 --LAKEIDKSFIEFESLPSDGKVPVIEVHNATFLRKIPNDSTDDESYDEEAAVESSQVAL 643

Query: 465 KNLS-FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRR- 522
           KN+  F++  G  VC+VG  G GKST    LL       GQ+       S  S     R 
Sbjct: 644 KNIDGFQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRA 696

Query: 523 -HMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGP 581
             +++  Q+  +M+ +++DN+ +G   +  +   ++  + C     +    +  +T++G 
Sbjct: 697 NSVALCSQQSWIMNASVKDNVLFG--HRFDEATYKATLEACQLVPDLEILADGDETLVGE 754

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGK---LMKSKSI 637
            G  LSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I     K   L+K+K  
Sbjct: 755 KGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGLLKNK-- 812

Query: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY-ADPGSELSKLLHEKATRSERQQ 696
           T+I   + +S ++ S+++  L  DG + E G F ++   D  S+L +L+ E  + + + +
Sbjct: 813 TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVECESENTKAK 871

Query: 697 NTAEDQEIDPEETINIEN 714
               D EI  +  +N+E+
Sbjct: 872 IEPVDSEI--KAPVNLED 887

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  144 bits (364), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 148/519 (28%), Positives = 250/519 (48%), Gaps = 90/519 (17%)

Query: 206  NVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDG-FKAMLCGSVGIGMMI 264
            N++   +H +  FFD   VG +++R + D   V + L   +    F  + C S+ I ++ 
Sbjct: 1078 NMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSI-IFLIT 1136

Query: 265  SISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTK-----VAEEQFSGIKT 319
             I+P+       +   V++   + G+   +  R+L+    S+TK        E  +G+ T
Sbjct: 1137 IITPRFLV----VAVVVLVLYYFVGKCYLSAGRELKR-IDSITKSPIFQYFSETLAGVCT 1191

Query: 320  VQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAY 372
            +++F  E++ I      + ++  + +     N  FF L+  +   +F        +VL  
Sbjct: 1192 IRAFGDEKRFI------LENMDKIDQN----NRAFFYLSVAVKWFAFRVDIIGAFIVLGS 1241

Query: 373  GSYLVLHGSLSIGDLTAYMMYTEYTGSSIF-----GLSTFYSEIMQGAGAASRLFELT-- 425
            GS+++L+    IGD+ + +     T S +F      L   YS       +  RL E +  
Sbjct: 1242 GSFILLN----IGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYSGI 1297

Query: 426  -------DRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASN--QIFKNLSFKIDAGSN 476
                   + I ++  +L     P  G+IE  N+S  Y   ASN   + KN+SF +D  + 
Sbjct: 1298 EQENYNENHIQALQNSLW----PEHGKIEVDNLSLRY---ASNLPPVIKNVSFTVDPQTK 1350

Query: 477  VCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSG 536
            + IVG +G GKSTI + L R   P TG I +DG DISK+   +LRR ++I+ Q+P+L +G
Sbjct: 1351 IGIVGRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTG 1410

Query: 537  TIRDNITYGLVEKPTQDEVRSITKKCFCHNFIT-----KFPNSYDTILGPH--------- 582
            TI+ N+     +   + + R I K     N I+     +  N  +   G H         
Sbjct: 1411 TIKSNL-----DPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTE 1465

Query: 583  ----GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES----EGAINYTFGKLMKS 634
                G  LS G+KQ + IAR+L+++P I++LDEATS++D +S    +G I   F     S
Sbjct: 1466 IVEGGLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEF-----S 1520

Query: 635  KSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
            +S TI++IAHRL ++   + V+V+ + G V E     EL
Sbjct: 1521 RS-TILTIAHRLRSVIDYDKVLVM-DAGEVKEYDHPYEL 1557

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 87/292 (29%), Positives = 135/292 (46%), Gaps = 40/292 (13%)

Query: 441 PNKGEIEFKNVSFSYPTRASNQIFK------NLSFKIDAGSNVCIVGPSGRGKSTIASLL 494
           P+K +I+FK  +  +     N I K      N++F+I  G    I+G +G GKS +   L
Sbjct: 657 PDKNKIKFKKATLVW-NENDNDINKFRLCDLNINFRI--GKLNLILGSTGSGKSALLMGL 713

Query: 495 LRYYNPTTGQIFVDG----QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP 550
           L      +G I V G     D+       L    +   Q   L++GT+R+NI +  V   
Sbjct: 714 LGELYLLSGSIIVPGLEPRHDMIP-DLNGLTNSFAYCSQSAWLLNGTVRNNIIFNGVYD- 771

Query: 551 TQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
            ++  +++   C     +   P    T +G  G  LSGGQKQRI++ARA+      ++LD
Sbjct: 772 -ENRYKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLD 830

Query: 611 EATSALDVESEGAINYTF---GKLMKSKSITIISIAHRLS-TIRRSENVIVLGN-----D 661
           +  SA+D  +   I Y     G LMK++  T I + H +S  IR++   ++L N      
Sbjct: 831 DCLSAVDSHTAIWI-YEICITGLLMKNR--TCILVTHNISLAIRKAYFAVILENGKVKSQ 887

Query: 662 GSVAEV---GKFKELYADPGSELSKLLHEKATRSERQQNTAED-QEIDPEET 709
           G++ E+   G FKE   D G      L      +E+  N +E  QEI P  T
Sbjct: 888 GTITELKNKGVFKE---DFGQ-----LSYDDNNTEKNINRSEYFQEIAPRIT 931

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  144 bits (364), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 129/491 (26%), Positives = 236/491 (48%), Gaps = 65/491 (13%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            ++ + ++    FFDN  +G +++R S D  V+   L   +   F   +     + +++ I
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 267  SPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQF----SGIKTVQS 322
            +P+     +F    ++ S+   G L    SR+L+    S      + F    SG+ T+++
Sbjct: 1199 TPKFLIIAIF----IICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRA 1254

Query: 323  FVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAYGSY 375
            F  E K +K       ++  + + + F    FF + +V   +SF       + V   G++
Sbjct: 1255 FGNEIKFLKE------NLDFIDENNKF----FFYMWSVNSWLSFRIDLLGAITVFGSGAF 1304

Query: 376  LVLHGS-----LSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFE------- 423
            ++L+       L+   LT  + +TE+       +  FYS +     +  RL E       
Sbjct: 1305 ILLNADKIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEE 1360

Query: 424  -LTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGP 482
             L D   +I+P+      P +G I F N S  Y  +  + + K L+ KID GS + +VG 
Sbjct: 1361 ALADP-GAITPSENW---PVQGAITFANYSLRYAPKLPD-VLKQLNLKIDGGSKIGVVGR 1415

Query: 483  SGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI 542
            +G GKSTI S L R+ + ++G+I +D  DIS+++ + LR  ++I+ Q+P L  GTIR N+
Sbjct: 1416 TGAGKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNL 1475

Query: 543  TYGLVEKPTQD------EVRSITKKCFCH-NFITKFPNSY--------DTILGPHGTLLS 587
                 E   +D      +V  +T+    + N+      +Y        D+ +   G  LS
Sbjct: 1476 DPN-EEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLS 1534

Query: 588  GGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLS 647
             GQ+Q I +AR+++    I++LDEAT+++D +S+  +  T       K  TI++IAHR+ 
Sbjct: 1535 QGQRQLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIK 1592

Query: 648  TIRRSENVIVL 658
            ++   + ++VL
Sbjct: 1593 SVIDYDKILVL 1603

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 109/208 (52%), Gaps = 12/208 (5%)

Query: 465 KNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS----SKSL 520
           +N++ + + G    ++GP+G GK+++   LL   +  +G++FV   + SK +    S +L
Sbjct: 733 RNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKFNLIPESDNL 791

Query: 521 RRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILG 580
              ++   Q P + + TIR+NI + +     +D   ++   C              TI+G
Sbjct: 792 LNSIAYCSQLPWIFNDTIRNNIIFDM--GYDKDRYENVVIACGLERDFQILNLGDKTIVG 849

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF--GKLMKSKSIT 638
             G+ LSGGQKQRI++ARAL  K   LILD+  SA+D  S   I      G LM+ +  T
Sbjct: 850 DKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWIYNVCITGPLMQGR--T 907

Query: 639 IISIAHRLS-TIRRSENVIVLGNDGSVA 665
            I ++H +S TI+++  V ++ N   VA
Sbjct: 908 CILVSHNVSLTIKKASKVFMIENGYIVA 935

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 137/530 (25%), Positives = 244/530 (46%), Gaps = 36/530 (6%)

Query: 171  ISLVGVSLLVGTAA---NYGR-VILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGD 226
            +  VG+ +L+   A   N  R ++LL V S R   +L  ++    +     FF+   VG 
Sbjct: 1014 VFFVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGR 1073

Query: 227  LISRLSSDAYVVSRSLTQKVSDGFKAML---CGSVGIGMMISISPQLSAFLLFLTPPVML 283
            +I+R SSD   V  ++   +S    ++L      V IG  + +   ++A LL +    + 
Sbjct: 1074 IINRFSSDMNSVDDNVQYVISFFLISILDYVVVVVIIGYQVPLFLLVNAALLGI---YLY 1130

Query: 284  SASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQK----EIKRYNHAIRH 339
               ++  L R   R +  +   +  +  E  +G   + +F    +     I+     I  
Sbjct: 1131 YQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAFNHFSRFDYLNIEAVQFNINC 1190

Query: 340  IFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGS 399
            +FN    + +++ +  S+ A++   + L+ LA  +      +LS G +   M Y     +
Sbjct: 1191 VFNFRSTNRWLSIRLESIGALMILTTALLSLATTTG---DKALSTGMVGLLMSYALQVTN 1247

Query: 400  SIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLG----KKFVPNKGEIEFKNVSFSY 455
             +  +     ++     +  R+ E  D  P   P +     +K  P +G + FK+ S  Y
Sbjct: 1248 KLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKDYSARY 1307

Query: 456  PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKV 515
                 + + K L+ +I+    + IVG +G GKST++  L R   P  G I +DG DI+K+
Sbjct: 1308 RENL-DPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGVDITKI 1366

Query: 516  SSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS- 574
                LR H+SI+ Q+     G++R N+     E+ + DE+    +       I K  N  
Sbjct: 1367 GLADLRSHLSIIPQDAQAFEGSVRSNL--DPFEQYSDDEIWRALELSHLKPHILKMANEE 1424

Query: 575  --------YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
                     +T +  +G+ LS GQ+Q + ++RAL+ +  IL+LDEAT+A+D E++  I  
Sbjct: 1425 GPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQE 1484

Query: 627  TFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD 676
            T     K +  TI++IAHR+ T+  S+ ++VL + G V E      L AD
Sbjct: 1485 TIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVKEFDSPSNLLAD 1531

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 143/657 (21%), Positives = 283/657 (43%), Gaps = 83/657 (12%)

Query: 114 KLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISL 173
           K ++ AIS+  V   + +  P+++ + ++E  Q        ++ V  IAF L L +    
Sbjct: 294 KTIIIAISIEVVKDFMTILQPQLLRLFIEEFNQDRERTHPLINAV-FIAFALFLMK---- 348

Query: 174 VGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSS 233
                LV T  +    I++      +   L   + +K++   +E  +    GD+++ ++ 
Sbjct: 349 -----LVSTCLSNQFFIMIFEAGMGIRGALMTMLYQKSLKLSSEAREGKTAGDIMNMMAV 403

Query: 234 DAYVVSRSL--TQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRL 291
           D   + R    +Q++     A+L   V +   +  S      ++ +  P+    SY  R 
Sbjct: 404 DVLRIQRFFETSQELVGSPIALLTTLVSLYTFLGYSTAGGVVIMAVMFPI---NSYLSRK 460

Query: 292 IRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFIN 351
           I+   +   E   +  K   E  + +KTV+ +  E+  +KR +H    +           
Sbjct: 461 IKVLIKKQMEYKDARIKTVTEILNSVKTVKLYAWEEPMLKRLDHVRNEL----------E 510

Query: 352 AKFFSLTAVLGDMSFLV-----VLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFG--L 404
            + F   AV+ +++        +L   S  +++  +    LT  +++   +   I    +
Sbjct: 511 LESFKKIAVMNNLTLFAWNCVPILVASSTFLIYALVMDVPLTPQIVFPSLSLFDILNDCI 570

Query: 405 STFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFV--------PNKGEIEFKNVSF--S 454
            T    I+        +  L D +  ++  L K F+        PN   IE  N +F  +
Sbjct: 571 YTIPRTIINFIETGVSMGRLKDFL--LAKELDKSFIEFESLPDDPNVPVIEVHNATFLRN 628

Query: 455 YPTRASNQ--------------IFKNLS-FKIDAGSNVCIVGPSGRGKSTIASLLLRYYN 499
            PT+A+++                KN+  F+   G  VC+VG  G GKST    LL    
Sbjct: 629 LPTKATSEENYDEEAMIESSRVALKNIDGFQALKGQLVCVVGRVGAGKSTFLHALL---- 684

Query: 500 PTTGQIFVDGQDISKVSSKSLRR--HMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRS 557
              GQ+        + + K   R   +++  Q+  +++ +++ N+ +G   K  +   ++
Sbjct: 685 ---GQLPCISSSHDQATPKMHFRCDSVALCSQQAWILNASVKYNVLFG--HKYDEASYKA 739

Query: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
             + C     +    +  +T++G  G  LSGGQK RI++ARA+  +  + +LD+  SA+D
Sbjct: 740 TIEACQLLPDLGILADGDETLVGEKGISLSGGQKARISLARAVYSRSDVYLLDDILSAVD 799

Query: 618 VE-SEGAINYTFGK---LMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
            E  +  I++   +   L+K+K  T+I   + +S ++ S+++  L N G + E G F E+
Sbjct: 800 AEVCKRIIDHVLSRKTGLLKNK--TVILTTNSISVLKHSQSIYALEN-GEIVERGSFDEI 856

Query: 674 YA-DPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESDITQELLENP 729
            + D  S+L  L+ E  + S    +  +D E  PE+   ++    E D  +E + NP
Sbjct: 857 MSKDAESKLKTLIAEFGSDS----SAVKDDEPIPEQKPPVDLQEVEDDALEEEI-NP 908

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 145/567 (25%), Positives = 262/567 (46%), Gaps = 72/567 (12%)

Query: 153  FTVDDVP--EIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKK 210
            +T D  P    +F + LY F    G   +    + +  V  + V + +   +L  + +++
Sbjct: 906  WTEDKFPTRSTSFYMGLYSFFVFGGYIFM---TSQFTIVCFIGVNASK---KLNLSAVRR 959

Query: 211  TMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISIS-PQ 269
             +H    F D   +G +++R + D   +   LT+ V     A     +G+ +M  I  P 
Sbjct: 960  ILHTPMAFLDTTPLGRILNRFTKDTDSLDNELTENVRLML-AQFANIIGVCVMCIIYLPW 1018

Query: 270  LSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKE 329
             +  + F+    +L ++++    R   R        +     E   G+ T++ + +E++ 
Sbjct: 1019 FAIAIPFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGMDTIRFYNSEERF 1078

Query: 330  IKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDM-----SFLVVLAYGSYLVLHGSLSI 384
            + + ++ I  +     ++ ++        AVL DM     + ++ L   +      + S+
Sbjct: 1079 MAKSDYLIDKM----NEAGYLVVCVQRWVAVLLDMIAVCFALIIALLCVTRQFHISASSV 1134

Query: 385  GDLTAYMMY--------------TEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS 430
            G L  Y++               TE   +S+  L ++ +E+   A           R P 
Sbjct: 1135 GVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVSYATELPTEAAY---------RKPE 1185

Query: 431  ISPTLGKKFVPNKGEIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
             SP       P +G+I+F+ VSF+Y P   +  + KNLS  I+ G  + I G +G GKST
Sbjct: 1186 SSPDPS---WPQEGKIDFEEVSFAYRPGLPA--VLKNLSMSINGGEKIGICGRTGAGKST 1240

Query: 490  IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT------ 543
            I S L R     +G+I +DG +IS +    LRR +SI+ Q+PVL  GTIR N+       
Sbjct: 1241 IMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGERS 1300

Query: 544  ----------YGLVEKPTQDEVRSITKKCFCHNFITKFPNSY-DTILGPHGTLLSGGQKQ 592
                       G ++K + +EV+  T+K   ++ + +    + D  +   G+  S G++Q
Sbjct: 1301 DDELWDALSRGGSIDKESLEEVK--TQKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQ 1358

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKS-ITIISIAHRLSTIRR 651
             +A+ARAL++   +LILDEATS++D E++  I     +++++ S  TI+ IAHRL TI  
Sbjct: 1359 LLALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILN 1415

Query: 652  SENVIVLGNDGSVAEVGKFKELYADPG 678
             + ++VL   G +AE      LY   G
Sbjct: 1416 YDRILVL-EKGEIAEFDSPYNLYKMDG 1441

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 102/217 (47%), Gaps = 32/217 (14%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           FK+++ +I  G  + I GP G GK+++ + +      T G + ++G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHG 583
             ++   P + + T+RDNI +G      + +   + K C     +   P    T +G  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFG--SPFDKSKYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI------ 637
             LSGGQK RI +AR + K   I + D+  SA+D           GKL+  + +      
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSR--------VGKLIMDECLLGLLNG 759

Query: 638 -TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
            T +   H+LS +  +  VIVLGNDGSV ++G  +EL
Sbjct: 760 KTRVLATHQLSLVENASRVIVLGNDGSV-DIGTVEEL 795

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 141/539 (26%), Positives = 247/539 (45%), Gaps = 60/539 (11%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F        + G    +  +  + +++ + +  LRA  +++ +H    + D 
Sbjct: 932  SFYMGLYSFFVFAAFIFMNG---QFTILCAMGIMASKCL-NLRA--VRRILHTPMSYIDT 985

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAM---LCGSVGIGMM-ISISPQLSAFLLFL 277
              +G +++R + D    + SL  ++++  + M       VG+ +M I   P  +  + FL
Sbjct: 986  TPLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFL 1041

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
                +L A ++    R   R        +     E   G+ T++++ ++++ + + +  I
Sbjct: 1042 LVVFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLI 1101

Query: 338  RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLH--------GSLSIGDLTA 389
                N   ++ ++         +  DM   V +A+   + L          + S+G L  
Sbjct: 1102 ----NKMNEAGYLVVVLQRWVGIFLDM---VAIAFALIITLLCVTRAFPISAASVGVLLT 1154

Query: 390  YMMYTEYTGSSIFGLSTFYSEIMQGA----GAASRL-FELTDRIPSISPTLGKKFVPNKG 444
            Y++      ++I    T     M  A      A++L  E   R P ++P    +  P+KG
Sbjct: 1155 YVLQLPGLLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTP---PESWPSKG 1211

Query: 445  EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQ 504
            +I F+NV F+Y       + KN +  I +G  + I G +G GKSTI S L R    T GQ
Sbjct: 1212 KIVFENVDFAYRP-GLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQ 1270

Query: 505  IFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN----------------ITYGLVE 548
            IF+D  DIS++    LR+ ++I+ Q+PVL  GTIR N                +  G + 
Sbjct: 1271 IFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLDPFDERTDDELWDALVRGGAIA 1330

Query: 549  KPTQDEVR-SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTIL 607
            K    EVR     +   H  + KF    D  +   G+  S G++Q +A+ RAL+++  IL
Sbjct: 1331 KNDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKIL 1388

Query: 608  ILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            ILDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   G VAE
Sbjct: 1389 ILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAE 1444

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 105/214 (49%), Gaps = 22/214 (10%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           FK+L+F I  G  + I GP G GKS++ + +        G+I V+G              
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNGD------------- 650

Query: 524 MSIVQQEPVLMSGTIRDNITYGL-VEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH 582
             ++   P + + T+RDNI +G    K   DEV  +   C     +   P    T +G  
Sbjct: 651 -LLMCGYPWIQNATVRDNIIFGSPFNKEKYDEVIHV---CSLKADLDILPAGDMTEIGER 706

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIIS 641
           G  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K  T I 
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNK--TRIL 764

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
             H+LS I R+  VIVLG DG V ++G  +EL A
Sbjct: 765 ATHQLSLIERASRVIVLGTDGKV-DIGTVEELKA 797

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 133/526 (25%), Positives = 243/526 (46%), Gaps = 39/526 (7%)

Query: 166  NLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTM-HQDAEFFDNNKV 224
            ++++++++  +  +  +A    R I++ +      ++L  N +  ++      FF+   V
Sbjct: 1029 DIWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPV 1088

Query: 225  GDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLS 284
            G +++R SSD   +       +S  F++ML   + I   + I+  +  FLLF T  ++L 
Sbjct: 1089 GRIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITI---VIITVSMPWFLLFNT--ILLG 1143

Query: 285  ASYFGR-LIRNNSRDLQEATG----SLTKVAEEQFSGIKTVQSF----VAEQKEIKRYNH 335
              Y+ + L    SR+L+  T      +  +  E   G   + ++    +      +    
Sbjct: 1144 IYYYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAYKHANIFNYYNFENIQT 1203

Query: 336  AIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTE 395
             I  IFN    + +++ +  ++ AV+  ++ L+ LA    L     +S G +   M Y  
Sbjct: 1204 NINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALAS---LGTSNPISAGLIGLLMSYAL 1260

Query: 396  YTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS----ISPTLGKKFVPNKGEIEFKNV 451
               SS+  +      I     +  R+ E  D  P     I  +   K  P +GEI F++ 
Sbjct: 1261 QVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHY 1320

Query: 452  SFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQD 511
            +  Y     + + K++  +I     + +VG +G GKST+   L R   P  G+I +DG D
Sbjct: 1321 TTKYRENL-DPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGID 1379

Query: 512  ISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITK----KCFCHNF 567
            IS +    LRR +SI+ Q+     GT+R N+      + T  E+    +    K      
Sbjct: 1380 ISTLGLYDLRRSLSIIPQDAQAFEGTVRSNL--DPFNRHTDAEIWKALELSHLKPHIERI 1437

Query: 568  ITKFPNS-------YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
            +++ P+         DT +  +G  LS GQ+Q + ++RAL+    ILILDEAT+A+D E+
Sbjct: 1438 VSELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRET 1497

Query: 621  EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            +  I  T     K +  TI++IAHR+ T+  S+ ++VL + G V E
Sbjct: 1498 DKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKE 1540

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 138/597 (23%), Positives = 259/597 (43%), Gaps = 76/597 (12%)

Query: 198 RVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGS 257
           ++   L + V +K++   AE  ++   GD+++ +S D   + R            +L GS
Sbjct: 360 KIRGSLMSLVYQKSLRLSAEAREDKANGDVLNLMSVDVIRIQRFFENA------QILVGS 413

Query: 258 --VGIGMMISISPQL-SAFLLFLTPPVMLSA--SYFGRLIRNNSRDLQEATGSLTKVAEE 312
               IG++IS+   L +A +  L   V++    SY  RL +   +   +      K   E
Sbjct: 414 PIQLIGVLISLYVLLGNATIGGLVSIVIMVPINSYMTRLYKKLFKTQMQYKDKRIKTVTE 473

Query: 313 QFSGIKTVQSFVAEQKEIKRYNHAIRH---IFNVGKQSAFINAKFFSLTAV--LGDMSFL 367
             + +K+++ +  E+  + R NH +R+   + N+ K +   N  FF    V  L   S  
Sbjct: 474 ILNSMKSIKLYAWEKPMLDRLNH-VRNDLELHNMKKIAIVSNFMFFCWNIVPLLVTCSTF 532

Query: 368 VVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRL--FELT 425
           V+ +Y +  VL   +    LT + M  +    ++F + T  S I++   +  RL  + L 
Sbjct: 533 VLFSYLTDQVLSPQIIFPSLTLFSMLND----ALFTVPTMISNIIEIGVSLKRLKGYLLA 588

Query: 426 DRIPSISPTLGKKFVPNKGEIEFKNVSFSY--PTRASNQ--------------IFKNL-S 468
           + + + S     +   +   +E  N  F +  P  A++                 K++ +
Sbjct: 589 EELDT-SFIEHARATASDPTVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVALKSIEN 647

Query: 469 FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI-FVDGQDISKVSSKSLRR--HMS 525
           F        CIVG  G GKST    +L       GQ+  V     S V  K + R  +++
Sbjct: 648 FSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVIRADNLA 700

Query: 526 IVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTL 585
              Q+P +M+ +++DNI +G   K  +   +   K C     +   P+   T++G  G  
Sbjct: 701 YCPQQPWIMNASLKDNILFGY--KYDEAMYKKTIKACQLLPDLEILPDGDQTLVGEKGIS 758

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGK---LMKSKSITIIS 641
           LSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+    +   L+K+K  T+I 
Sbjct: 759 LSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK--TVIL 816

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD-----PGSELSKLLHEKATR--SER 694
             + ++ +  S+ + +L N G + E   ++E+ +        S L +++ E A+    E 
Sbjct: 817 TTNAVNVLVHSDMIYLLKN-GKIVESNSYEEVMSKDRNNGEKSSLREIIEEFASNESEET 875

Query: 695 QQNTAEDQEID-------PEETINIENS--TPESDITQELLENPIKEAIMDVAADNK 742
            +  +E   ID        E+  ++E +   PE  +  E  +NP    I     D +
Sbjct: 876 AEKKSESSTIDDKNVGSSSEDDGDLEGAPQPPEHLLNYEAAKNPDNNTITAYEEDQE 932

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 145/570 (25%), Positives = 251/570 (44%), Gaps = 60/570 (10%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F        + G    Y  +  + +++ +    L    +K+ +H    + D 
Sbjct: 933  SFYMGLYSFFVFAAFIFMNG---QYTILCAMGIMASK---WLNLKAVKRILHTPMSYIDT 986

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAM---LCGSVGIGMM-ISISPQLSAFLLFL 277
              +G +++R + D    + SL  ++++  + M       VG+ +M I   P  +  + FL
Sbjct: 987  TPLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFL 1042

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
                +L A ++    R   R        +     E   G+ T++++ ++++ + + +  I
Sbjct: 1043 LIIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLI 1102

Query: 338  RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397
                N   ++ ++         +  DM  +V     + L +  +  I   +  +M T Y 
Sbjct: 1103 ----NKMNEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTRAFPISAASVGVMLT-YV 1157

Query: 398  GSSIFGLSTFYSEIMQ---GAGAASRL--------FELTDRIPSISPTLGKKFVPNKGEI 446
                  L+T    + Q      +A RL         E   R P ++P    +  P+KGEI
Sbjct: 1158 LQLPGLLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPP---ESWPSKGEI 1214

Query: 447  EFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF 506
             FKNV FSY       + KNL+  I +G  + I G +G GKSTI S L R    + G+I 
Sbjct: 1215 AFKNVDFSYRP-GLPVVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEIL 1273

Query: 507  VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR-------SIT 559
            +D  +IS++    LRR ++I+ Q+PVL  GTIR N+      + T+DE+        +I 
Sbjct: 1274 IDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL--DPFNERTEDELWDALVRGGAIA 1331

Query: 560  KKCF------------CHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTIL 607
            K                H  + KF    D  +   G+  S G++Q +A+ RAL+++  IL
Sbjct: 1332 KNDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKIL 1389

Query: 608  ILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEV 667
            ILDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   G VAE 
Sbjct: 1390 ILDEATSSVDYETDGKIQVRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEF 1446

Query: 668  GKFKELYADPGSELSKLLHEKATRSERQQN 697
                 L++   S    +        E  +N
Sbjct: 1447 DTPWALFSQEDSIFKNMCSRSGIVEEDFEN 1476

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 109/220 (49%), Gaps = 22/220 (10%)

Query: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517
           + S + FK+L F+I  G  + I GP G GKS++ + +      T G+I V+G        
Sbjct: 598 KTSFKGFKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNGD------- 650

Query: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGL-VEKPTQDEVRSITKKCFCHNFITKFPNSYD 576
                   ++   P + + T++DNI +G    K   DEV  +   C     +   P    
Sbjct: 651 -------LLMCGYPWIQNATVKDNIIFGSPFNKEKYDEVIHV---CSLKADLDILPAGDM 700

Query: 577 TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSK 635
           T +G  G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     L+++K
Sbjct: 701 TEIGERGITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK 760

Query: 636 SITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
             T +   H+LS I ++  VIVLG DG V ++G   EL A
Sbjct: 761 --TRVLATHQLSLIEKASRVIVLGTDGDV-DIGTVDELKA 797

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 135/510 (26%), Positives = 235/510 (46%), Gaps = 63/510 (12%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            ++KK ++    FFD+  +G +++R S D   V + LT  V   F +++     + ++  I
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 267  SPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVAEEQFS----GIKTV 320
            +P       F    + ++  Y+  G      SR+L+           + FS    GI T+
Sbjct: 980  TPG------FFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTI 1033

Query: 321  QSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAYG 373
            ++F  E++ ++     I             N  FF L      ++F        V+ A G
Sbjct: 1034 RAFGDERRFMQENLEKIDEN----------NKPFFYLWVANRWLAFRIDMIGACVIFAAG 1083

Query: 374  SYLVLH-GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL--TDRIPS 430
             +++L+  SL  G     + Y          L   YS +     +  RL E    ++ P 
Sbjct: 1084 IFVLLNIKSLDSGLAGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMEVEQEPH 1143

Query: 431  ISPT-LGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
               T       P++G+IE  ++S  Y      ++ KN+SF +D    V IVG +G GKST
Sbjct: 1144 YQSTHTPPPEWPSQGKIEVNDLSLRYAPSLP-KVIKNVSFTVDPNCKVGIVGRTGAGKST 1202

Query: 490  IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI------- 542
            I + L R+ +P +G I +D  DI+ V  K LR+ ++I+ Q+P L +GT++ N+       
Sbjct: 1203 IITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYS 1262

Query: 543  ------TYGLVEKPTQDEVRSITKKCFCHNFI-TKFPNSY---DTILGPHGTLLSGGQKQ 592
                      V   T++E+ S       ++ I ++  N +   D  +   G  LS GQ+Q
Sbjct: 1263 DGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRLDNEITEGGANLSQGQRQ 1322

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTF-GKLMKSKSITIISIAHRLSTIRR 651
             + +AR+L++ P +++LDEAT+++D  S+  I  T  G+   S   TI++IAHRL +I  
Sbjct: 1323 LVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIID 1379

Query: 652  SENVIVLGNDGSVAEVGKFKELYADPGSEL 681
             + ++V+       + G+ KE Y  P S L
Sbjct: 1380 YDKILVM-------DAGEVKE-YDHPYSLL 1401

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 121/240 (50%), Gaps = 13/240 (5%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           ++  I F+N +FS+  +  +   KN+S +   G    ++GP+G GK+++   LL   +  
Sbjct: 471 SRKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLL 530

Query: 502 TGQIF---VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR-- 556
            G+++   +D ++   V +  +   ++   Q   L++ T+++NI   L   P  +E R  
Sbjct: 531 EGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNI---LFSSPF-NEARYD 586

Query: 557 SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
           ++ + C              T +G  G  LSGGQKQR+++ARAL      L+LD+  SA+
Sbjct: 587 AVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAV 646

Query: 617 DVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY 674
           D  +   I  N   G LM+ +  T I ++H ++   ++ + +V   +G V + G+  EL+
Sbjct: 647 DSHTALWIYENCITGPLMEGR--TCILVSHNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  142 bits (357), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 134/520 (25%), Positives = 233/520 (44%), Gaps = 83/520 (15%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            ++KK ++    FFD+  +G +++R S D   V + LT  V   F +++     + ++  I
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 267  SPQLSAFLLFLTPPVMLSASYF--GRLIRNNSRDLQEATGSLTKVAEEQFS----GIKTV 320
            +P       F    + +   Y+  G      SR+L+           + FS    GI T+
Sbjct: 1193 TPD------FFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTI 1246

Query: 321  QSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAYG 373
            ++F  E++ ++          N+ K     N  FF L      ++F        V+ A G
Sbjct: 1247 RAFGDERRFMQE---------NLTKIDE-NNKPFFYLWVANRWLAFRIDMIGACVIFAAG 1296

Query: 374  SYLVLH-GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL--TDRIPS 430
             +++L+  SL  G     + Y          L   YS +     +  RL E    ++ P 
Sbjct: 1297 IFVLLNIKSLDSGLAGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMEVEQEPH 1356

Query: 431  ISPTLGKK-FVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
               T       P++G+IE  ++S  Y      ++ KN++F +D    V IVG +G GKST
Sbjct: 1357 YQSTHNPPPEWPSQGKIEVNDLSLRYAPSLP-KVIKNVTFTVDPNCKVGIVGRTGAGKST 1415

Query: 490  IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI------- 542
            I + L R+ +P +G I +D  DI+ V  K LR+ ++I+ Q+P L +GT++ N+       
Sbjct: 1416 IITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYS 1475

Query: 543  ------TYGLVEKPTQDEV---------------RSITKKCFCHNFITKFPNSYDTILGP 581
                      V   TQ+E+                ++ K  F  N I++           
Sbjct: 1476 DKQIFEALKRVNLVTQEELDHAANPSPDNASAVSENVNKFLFLENEISE----------- 1524

Query: 582  HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIIS 641
             G+ LS GQ+Q + +AR+L++ P +++LDEAT+++D +S+  I  T          TI++
Sbjct: 1525 GGSNLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRSEFSDS--TILT 1582

Query: 642  IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
            IAHRL +I   + ++V+       + G+ KE Y  P S L
Sbjct: 1583 IAHRLRSIIDYDKILVM-------DAGEVKE-YDHPYSLL 1614

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 118/239 (49%), Gaps = 11/239 (4%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           ++ +I F+N +FS+  +  +   KN++     G    ++GP+G GK+++   LL   +  
Sbjct: 685 HRNKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLL 744

Query: 502 TGQIF---VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-TQDEVRS 557
            G+++   +D ++   + +  +   ++   Q   L++ T+++NI   L   P  +    +
Sbjct: 745 EGKVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNI---LFSSPFNEGRYNA 801

Query: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           + + C              T +G  G  LSGGQKQR+++ARAL      L+LD+  SA+D
Sbjct: 802 VIEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVD 861

Query: 618 VESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY 674
             +   I  N   G LM+ +  T I ++H ++   ++   +V   +G V + G+  ELY
Sbjct: 862 SHTALWIYENCISGPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 136/483 (28%), Positives = 231/483 (47%), Gaps = 27/483 (5%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  S  F  ++  +  I ++ + + Q   F+L +
Sbjct: 1025 FFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVVKVTFTIVVICTSTWQ---FILVV 1081

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
             P  +L   Y    +R  SR+L+    S+T+       +E   G+ T++ +  +QK    
Sbjct: 1082 LPLSVLYIYYQQYYLRT-SRELRR-LDSVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAH 1138

Query: 333  YNHAIRHIFNVGKQSAFINA-KFFSL-TAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAY 390
             N A R   N+      +NA ++ +     LG +  L       + +  G+L+ G +   
Sbjct: 1139 INQA-RIDNNMSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLS 1197

Query: 391  MMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS----ISPTLGKKFVPNKGEI 446
            + Y      S+  +     E+     +  R+ E  +  P     I  +   K  P++G+I
Sbjct: 1198 LSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGWPSQGDI 1257

Query: 447  EFKNVSFSYPTRASNQ-IFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
             F++ S  Y  R   Q I ++++  I A   V IVG +G GKS++   L R      G I
Sbjct: 1258 RFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHI 1315

Query: 506  FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
            F+DG     +    LR  +SI+ Q+  + +GT+R+N+     E+ T +E+    +     
Sbjct: 1316 FIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENVDP--TEEFTDEEIWHALELSHLK 1373

Query: 566  NFITKFPN-SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              +    N    T+L   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I
Sbjct: 1374 EHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVI 1433

Query: 625  NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKL 684
              T     K++  TI++IAHR++TI  S+ +IVL N+G VAE    + L   P S    L
Sbjct: 1434 QETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSL 1490

Query: 685  LHE 687
              E
Sbjct: 1491 CKE 1493

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 130/263 (49%), Gaps = 41/263 (15%)

Query: 440 VPNKGEIEFK---NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLL 495
           V +KG+I  K   + +F +  +   ++  KN++F+   G   CIVG  G GKS +   +L
Sbjct: 610 VTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVGSGKSALIQSIL 669

Query: 496 RYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDE 554
                  G +F V G         ++   ++ V Q P +M+GT+++NI +G    P+  E
Sbjct: 670 -------GDLFRVKG-------FATIHGSVAYVSQIPWIMNGTVKENILFGHKYDPSFYE 715

Query: 555 VRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
                K C  +  ++  P    T++G  G  LSGGQK R+++ARA+  +    +LD+  +
Sbjct: 716 --KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLA 773

Query: 615 ALDVE-SEGAINYTFG---------KLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSV 664
           A+D   ++  ++   G         K++ +  IT++SIA          + I L  +G +
Sbjct: 774 AVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIA----------DSIALLENGEI 823

Query: 665 AEVGKFKELYADPGSELSKLLHE 687
            + G + E+  D GS LSKL+HE
Sbjct: 824 VQQGSYDEVVRDDGSALSKLIHE 846

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 145/575 (25%), Positives = 251/575 (43%), Gaps = 64/575 (11%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F        +       G+  +L  +       L    +K+ +H    + D 
Sbjct: 932  SFYMGLYSFFVFAAFIFM------NGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDT 985

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAM---LCGSVGIGMM-ISISPQLSAFLLFL 277
              +G +++R + D    + SL  ++++  + M       VG+ +M I   P  +  + FL
Sbjct: 986  TPLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFL 1041

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
                +L A ++    R   R        +     E   G+ T++++ ++++ + + +  I
Sbjct: 1042 LVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLI 1101

Query: 338  RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLH--------GSLSIGDLTA 389
                N   ++ ++         +  DM   V +A+   + L          + S+G L  
Sbjct: 1102 ----NKMNEAGYLVVVLQRWVGIFLDM---VAIAFALIITLLCVTRAFPISAASVGVLLT 1154

Query: 390  YMMYTEYTGSSIFGLSTFYSEIMQGAG-----AASRLFELTDRIPSISPTLGKKFVPNKG 444
            Y++      ++I    T     M  A      A     E + R P ++P    +  P+ G
Sbjct: 1155 YVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTP---PESWPSMG 1211

Query: 445  EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQ 504
            EI F+NV F+Y       + KNL+  I +G  + I G +G GKSTI S L R    T G+
Sbjct: 1212 EIIFENVDFAYRP-GLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGK 1270

Query: 505  IFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN----------------ITYGLVE 548
            I +D  DIS++    LRR ++I+ Q+PVL  GTIR N                +  G + 
Sbjct: 1271 ILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIA 1330

Query: 549  KPTQDEVR-SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTIL 607
            K    EV+     +   H  + KF    D  +   G+  S G++Q +A+ RAL+++  IL
Sbjct: 1331 KDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKIL 1388

Query: 608  ILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEV 667
            ILDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   G VAE 
Sbjct: 1389 ILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEF 1445

Query: 668  GKFKELYADPGSELSKLLHEKATRSERQQNTAEDQ 702
                 L++   S    +     +RS   +N  E++
Sbjct: 1446 DTPWTLFSQEDS----IFRSMCSRSGIVENDFENR 1476

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 117/242 (48%), Gaps = 26/242 (10%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           FK+L+F I  G  + I GP G GKS++ + +      T G++ V+G              
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGD------------- 650

Query: 524 MSIVQQEPVLMSGTIRDNITYGL-VEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH 582
             ++   P + + ++RDNI +G    K   DEV    + C     +   P    T +G  
Sbjct: 651 -LLMCGYPWIQNASVRDNIIFGSPFNKEKYDEV---VRVCSLKADLDILPAGDMTEIGER 706

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIIS 641
           G  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K  T I 
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRIL 764

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAED 701
             H+LS I R+  VIVLG DG V ++G   EL A     L  LL   +  SE++    E+
Sbjct: 765 ATHQLSLIERASRVIVLGTDGQV-DIGTVDELKAR-NQTLINLLQFSSQNSEKED---EE 819

Query: 702 QE 703
           QE
Sbjct: 820 QE 821

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 133/490 (27%), Positives = 233/490 (47%), Gaps = 41/490 (8%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y +   L +  S  F      +V +  ++++    +   +F+
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFF----VNAVKVVFVMAVICATTWQFIFV 1094

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+ +   Y+ +     SR+L+    S+T+       +E   GI T++ +  E    KR
Sbjct: 1095 IIPLGVFYIYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGITTIRGYNQE----KR 1149

Query: 333  YNHAIRHIFNVGKQSAF---INA-KFFSL-TAVLGDMSFLVVLAYGSYLVLHGSLSIGDL 387
            + H I         SAF   INA ++ +    ++G +  L       + +  G+L+ G +
Sbjct: 1150 FGH-INQCRVDNNMSAFYPSINANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMV 1208

Query: 388  TAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKK-----FVPN 442
               + Y      ++  +     E+     +  R+ E   ++ S +P + ++       P 
Sbjct: 1209 GLSLSYALQITQTLNWIVRMTVEVETNIVSVERVKEYA-QLESEAPRIVEEKRPDEMWPT 1267

Query: 443  KGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTT 502
            +G+I+F+N S  Y     + + KN++  I     V IVG +G GKS++   L R    T 
Sbjct: 1268 EGDIKFENYSTRYRPEL-DLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATA 1326

Query: 503  GQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQ---DE--VRS 557
            G I +DG  I+++    LR  +SI+ Q+  +  GT+R+NI       PT    DE   R 
Sbjct: 1327 GNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI------DPTNLFTDEEIWRV 1380

Query: 558  ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
            +       + ++   +  D  L   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+D
Sbjct: 1381 LELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVD 1440

Query: 618  VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP 677
            VE++  +  T     K +  TI++IAHRL+TI  S+ +IVL + G + E     EL A P
Sbjct: 1441 VETDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DKGEIVEFDTPDELLAKP 1497

Query: 678  GSELSKLLHE 687
             S    L +E
Sbjct: 1498 ESLFYSLCNE 1507

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 113/492 (22%), Positives = 214/492 (43%), Gaps = 79/492 (16%)

Query: 253 MLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEE 312
           +L  S+ +G +I +      F++FL        SY  R+ R   +   +     T V  E
Sbjct: 440 LLGHSMWVGFIILV------FMIFLN-------SYLVRIQRKLQKQQMQFKDERTGVISE 486

Query: 313 QFSGIKTVQSFVAEQKEIKRYNHA--IRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVL 370
             + IK+++ +  E     + NH    + + N+ K   ++    F    V     FLV  
Sbjct: 487 ILNNIKSLKLYAWEVPYQTKLNHVRNDKELHNLTKLGCYMAVTSFQFNIV----PFLVSC 542

Query: 371 AYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTF--------YSEIMQGAGAASRLF 422
           A  +  V   +     LT  +++   T   +F L +F         +  ++ + + +RLF
Sbjct: 543 ATFAVFVYTEN---KPLTTDLVFPALT---LFNLLSFPLMVVPNVITSFVEASVSVNRLF 596

Query: 423 EL----------TDRIPSISPTLGKKFVPNKGEIEFK---NVSFSYPTRASNQI-FKNLS 468
                         R+P          V NKG++      N +F +  +   ++  KN++
Sbjct: 597 SFLTNEELQKDSIQRLPK---------VENKGDVAINLGDNATFLWKRKPEYKVALKNIN 647

Query: 469 FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIV 527
           F+   G   CIVG  G GKS +   +L       G +F V G         ++  +++ V
Sbjct: 648 FQAKKGDLTCIVGKVGSGKSALIQSIL-------GDLFRVKG-------FATVHGNVAYV 693

Query: 528 QQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLS 587
            Q P +M+GT+++NI +G   K  Q+      K C     +    +   T++G  G  LS
Sbjct: 694 SQVPWIMNGTVKENILFG--HKYDQEFYEKTIKACALTIDLGILVDGDQTLVGEKGISLS 751

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIISIAHRL 646
           GGQK R+++ARA+  +    +LD+  +A+D   S+  + +  G      S T +   +++
Sbjct: 752 GGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSKTKVLCTNKI 811

Query: 647 STIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAED----Q 702
           S +  ++++ +L N G + + G ++E+ +D  S L KL+ E   +  + + ++       
Sbjct: 812 SVLSIADSITLLEN-GEIVQQGSYEEVNSDEDSPLFKLIKEYGRKENKSKGSSTSLSTVT 870

Query: 703 EIDPEETINIEN 714
           E   E+TI +E+
Sbjct: 871 ESSREQTIPVED 882

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 135/496 (27%), Positives = 233/496 (46%), Gaps = 41/496 (8%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  S  F      +V +   I++    +   +F+
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVIFTITVICATTWQFIFI 1096

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+ +   Y+ +     SR+L+    S+T+       +E   G+ TV+ +  +    KR
Sbjct: 1097 IIPLGVCYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGYSQQ----KR 1151

Query: 333  YNHAIRHIFNVGKQSAF---INAKFFSLTAVLGDMSFLVVLAYGSYLVL---HGSLSIGD 386
            ++H I         SAF   INA  + L   L  +  +++L   +  V     G+L+ G 
Sbjct: 1152 FSH-INQCRIDNNMSAFYPSINANRW-LAYRLELIGSIIILGAATLSVFRLKQGTLTAGM 1209

Query: 387  LTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTD---RIP-SISPTLGKKFVPN 442
                + Y      ++  +     E+     +  R+ E  D     P +I   +  K  P+
Sbjct: 1210 AGISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPS 1269

Query: 443  KGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTT 502
            +G+I+F N S  Y     + + K+++  I     + IVG +G GKS++   L R    + 
Sbjct: 1270 QGDIKFNNYSTRYRPEL-DLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASA 1328

Query: 503  GQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQ---DEV--RS 557
            G I +DG  I+++    LR  +SI+ Q+  +  G++R+NI       PT    DE   R+
Sbjct: 1329 GNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENI------DPTNQYTDEAIWRA 1382

Query: 558  ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
            +       + ++   +  D  L   G  LS GQ+Q + +ARA++    ILILDEAT+A+D
Sbjct: 1383 LELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVD 1442

Query: 618  VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP 677
            VE++  +  T     K +  TI++IAHRL+TI  S+ +IVL N G+VAE     +L ++ 
Sbjct: 1443 VETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLLSNS 1499

Query: 678  GSELSKLLHEKATRSE 693
             S    L  E    +E
Sbjct: 1500 ESLFHSLCAEAGLVNE 1515

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 113/519 (21%), Positives = 228/519 (43%), Gaps = 58/519 (11%)

Query: 225 GDLISRLSSDAYVVSRSLTQKV----SDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280
           GD+++ +S D   + + LTQ +    S  F+ ++C    +  ++  S  +   +L +  P
Sbjct: 404 GDIVNLMSVDVQKI-QDLTQWLNLIWSGPFQIIIC-LYSLYKLLGNSMWVGVIILVIMMP 461

Query: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQK-----EIKRYNH 335
           +    S+  R+ +   +   +     T+V  E  + IK+++ +  E+      E  R N 
Sbjct: 462 L---NSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEDIRNNK 518

Query: 336 AIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTE 395
            ++++  +G   A  + +F ++   L       V  Y     L   L    LT + + + 
Sbjct: 519 ELKNLTRLGCYMAVTSFQF-NIVPFLVSCCTFAVFVYTEDRALTTDLVFPALTLFNLLS- 576

Query: 396 YTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF--VPNKGEIEFK---N 450
                +  +    +  ++ + +  RLF        + P   ++   V N G++      +
Sbjct: 577 ---FPLMIIPMVLNSFIEASVSIGRLFTFFTN-EELQPDSVQRLPKVENFGDVAINVGDD 632

Query: 451 VSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF-VD 508
            +F +  +   ++  KN++F+   G   C+VG  G GK+ + S +L       G +F V 
Sbjct: 633 ATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSCML-------GDLFRVK 685

Query: 509 GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFI 568
           G         ++   ++ V Q P +M+GT+ +NI +G   K   +      K C     +
Sbjct: 686 G-------FATVHGSVAYVSQVPWIMNGTVMENILFG--HKYDVEFYEKTIKACALTIDL 736

Query: 569 TKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
               +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 796

Query: 628 FGK--LMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
            G   L+ +K  T +   +++S +  +++V +L N G + + G + E+  D  S L KLL
Sbjct: 797 LGPNGLLHTK--TRLLATNKVSALSIADSVALLDN-GEIIQKGTYDEITKDADSPLWKLL 853

Query: 686 HEKATRSERQQNTAEDQEIDPEETINIENSTPESDITQE 724
           ++   ++  ++N + D           +NS  ES I  E
Sbjct: 854 NDYGKKNNNKRNDSGDSS---------KNSVRESSIPVE 883

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  139 bits (349), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 133/493 (26%), Positives = 235/493 (47%), Gaps = 35/493 (7%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  S  F      +V +   I++    +   +F+
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFI 1095

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+ +   Y+ +     SR+L+    S+T+       +E   G+ TV+ +  +    KR
Sbjct: 1096 IIPLSVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGYSQQ----KR 1150

Query: 333  YNHAIRHIFNVGKQSAF---INAKFFSLTAVLGDMSFLVVLAYGSYLVL---HGSLSIGD 386
            ++H I         SAF   INA  + L   L  +  +++L   +  V     G+L+ G 
Sbjct: 1151 FSH-INQCRIDNNMSAFYPSINANRW-LAYRLELIGSIIILGAATLSVFRLKQGTLTAGM 1208

Query: 387  LTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK-----KFVP 441
            +   + Y      ++  +     E+     +  R+ E  D + S +P + +     K  P
Sbjct: 1209 VGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYAD-LKSEAPLIVEGHRPPKEWP 1267

Query: 442  NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
            ++G+I+F N S  Y     + + K+++  I     V IVG +G GKS++   L R    +
Sbjct: 1268 SQGDIKFNNYSTRYRPEL-DLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEAS 1326

Query: 502  TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEV-RSITK 560
             G I +D   I+++    LR  +SI+ Q+  +  GT+R+NI    + + T + + R++  
Sbjct: 1327 EGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPINQYTDEAIWRALEL 1384

Query: 561  KCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                 + ++   +  D  L   G  LS GQ+Q + +ARA++    IL+LDEAT+A+DVE+
Sbjct: 1385 SHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVET 1444

Query: 621  EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSE 680
            +  +  T     K +  TI++IAHRL+TI  S+ +IVL N G VAE     +L +D  S 
Sbjct: 1445 DKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPGQLLSDNKSL 1501

Query: 681  LSKLLHEKATRSE 693
               L  E    +E
Sbjct: 1502 FYSLCMEAGLVNE 1514

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 106/496 (21%), Positives = 220/496 (44%), Gaps = 49/496 (9%)

Query: 225 GDLISRLSSDAYVVSRSLTQKV----SDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280
           GD+++ +S D   + + LTQ +    S  F+ ++C    +  ++  S  +   +L +  P
Sbjct: 403 GDIVNLMSVDVQKL-QDLTQWLNLIWSGPFQIIIC-LYSLYKLLGNSMWVGVIILVIMMP 460

Query: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQK-----EIKRYNH 335
           +    S+  R+ +   +   +     T+V  E  + IK+++ +  E+      E  R N 
Sbjct: 461 L---NSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNK 517

Query: 336 AIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTE 395
            ++++  +G   A  + +F ++   L       V  Y     L   L    LT + + + 
Sbjct: 518 ELKNLTKLGCYMAVTSFQF-NIVPFLVSCCTFAVFVYTEDRALTTDLVFPALTLFNLLS- 575

Query: 396 YTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF--VPNKGEIEFK---N 450
                +  +    +  ++ + +  RLF        + P   ++   V N G++      +
Sbjct: 576 ---FPLMIIPMVLNSFIEASVSIGRLFTFFTN-EELQPDSVQRLPKVKNIGDVAINIGDD 631

Query: 451 VSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF-VD 508
            +F +  +   ++  KN++F+   G+  CIVG  G GK+ + S +L       G +F V 
Sbjct: 632 ATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCML-------GDLFRVK 684

Query: 509 GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFI 568
           G         ++   ++ V Q P +M+GT+++NI +G   +   +      K C     +
Sbjct: 685 G-------FATVHGSVAYVSQVPWIMNGTVKENILFG--HRYDAEFYEKTIKACALTIDL 735

Query: 569 TKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
               +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 736 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHV 795

Query: 628 FGK--LMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLL 685
            G   L+ +K  T +   +++S +  ++++ +L N G + + G + E+  D  S L KLL
Sbjct: 796 LGPNGLLHTK--TKVLATNKVSALSIADSIALLDN-GEITQQGTYDEITKDADSPLWKLL 852

Query: 686 HEKATRSERQQNTAED 701
           +    ++  + N   D
Sbjct: 853 NNYGKKNNGKSNEFGD 868

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  138 bits (348), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 130/493 (26%), Positives = 236/493 (47%), Gaps = 35/493 (7%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  S  F      +V +   I +    +   +F+
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFF----VNAVKVSFTIIVICFTTWQFIFI 1093

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+ +   Y+ +     SR+L+    S+TK       +E   GI T++ +    ++  R
Sbjct: 1094 IIPLGVFYIYYQQYFLRTSRELRRL-DSITKSPIFSHFQETLGGITTIRGY----QQQHR 1148

Query: 333  YNHAIRHIFNVGKQSAF---INAKFFSLTAVLGDMSFLVVLAYGSYLVL---HGSLSIGD 386
            + H I         SAF   +NA  + L   L  +  L++L   +  V     G+L+ G 
Sbjct: 1149 FTH-INQCRVDNNMSAFYPSVNANRW-LAYRLETIGSLIILGAATLSVFRLRQGTLTAGM 1206

Query: 387  LTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF-----VP 441
            +   + Y      S+  +     E+     +  R+ E +D + S +P + +        P
Sbjct: 1207 VGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSD-LKSEAPAVIEDHRPAETWP 1265

Query: 442  NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
            ++G+I+F++ S  Y     + I K+++  I     V IVG +G GKS++   L R    +
Sbjct: 1266 DEGDIKFEHYSTRYRPEL-DLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEAS 1324

Query: 502  TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561
            +G+I +D   I+++    LR  +SI+ Q+  +  GT+R+NI      + T +++ ++   
Sbjct: 1325 SGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLAL 1382

Query: 562  CFCHNFITKFPNS-YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                + I    +   +  L   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE+
Sbjct: 1383 SHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVET 1442

Query: 621  EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSE 680
            +  I  T     K +  TI++IAHR++TI  S+ +IVL N G++ E    ++L  +P S 
Sbjct: 1443 DKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLENPSSL 1499

Query: 681  LSKLLHEKATRSE 693
               L  E   +++
Sbjct: 1500 FYSLCQEAGLQNK 1512

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 122/553 (22%), Positives = 235/553 (42%), Gaps = 112/553 (20%)

Query: 225 GDLISRLSSDAYVVSRSLTQKV----SDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280
           GD+++ +S D   + + + Q +    S  F+ +LC  V +  ++  S  +   +L +  P
Sbjct: 400 GDIVNLMSVDVQKL-QDMCQFIQLLWSAPFQVILC-LVSLYKLLGKSMWVGVLILVIMIP 457

Query: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAE----QK-EIKRYNH 335
           +    SY  R+ +   +         T+V  E  + IK+++ +  E    QK E  R N 
Sbjct: 458 I---NSYLVRVQKKLQKSQMTYKDERTRVISEMLNNIKSLKLYAWEVPYRQKLENVRNNK 514

Query: 336 AIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLV-VLAYGSYLVLHGSLSIGDLTAYMMYT 394
            ++++  +G   A ++ +F         + FLV    + +++         DL       
Sbjct: 515 ELKNLTKLGCYMALMSFQF-------NVVPFLVSCCTFAAFIYTENRPLTTDLV------ 561

Query: 395 EYTGSSIFGLSTF--------YSEIMQGAGAASRLFEL----------TDRIPSISPTLG 436
            +   ++F L  F         + I++ + +  RLF              R+P ++    
Sbjct: 562 -FPALTLFNLLHFPLMVIPNVLTMIIETSVSIGRLFSFLTNEELQKDAVQRLPKVT---- 616

Query: 437 KKFVPNKGEIEFK---NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIAS 492
                N G++      + +F +  +   ++  KN++F+   G   CIVG  G GKS +  
Sbjct: 617 -----NIGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQ 671

Query: 493 LLLRYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPT 551
            +L       G +F V G         ++  +++ V Q   +M+GT+++NI +G   K  
Sbjct: 672 SIL-------GDLFRVKG-------FATIHGNVAYVSQVAWIMNGTVKENILFG--HKYD 715

Query: 552 QDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
           +D  +   K C     +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+
Sbjct: 716 EDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDD 775

Query: 612 ATSALD----------VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGND 661
             +A+D          V     + +T  K++ +  ++++SIA  +S          L  +
Sbjct: 776 PLAAVDEHVARHLVEHVLGPNGLLHTKTKVLATNKVSVLSIADSVS----------LLEN 825

Query: 662 GSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESDI 721
           G + + G + E+  D  S LSKL+ E   +S              + T N+  ST  S+I
Sbjct: 826 GEIVQQGTYDEIMKDDSSPLSKLITEYGKKS-------------TDSTSNVTPSTSSSNI 872

Query: 722 TQEL--LENPIKE 732
            ++   LE  +KE
Sbjct: 873 HEQSVPLEAELKE 885

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  138 bits (348), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 133/515 (25%), Positives = 242/515 (46%), Gaps = 53/515 (10%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +     F   L  +V +   + +    +   +F+
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRT----FSQFLVNAVKVVFTMIVICWTTWQFIFI 1100

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+ +   Y+ +     SR+L+    S+T+       +E   G+ T++ +     + +R
Sbjct: 1101 IGPLGVLYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGMSTIRGY----NQQRR 1155

Query: 333  YNHAIRHIFNVGKQSAF---INAKFFSLTAVLGDMSFLVVLAYGS---YLVLHGSLSIGD 386
            ++H I H       SAF   INA  + L   L  +  +++L   +   Y +  G+L+ G 
Sbjct: 1156 FDH-INHCRIDNNMSAFYPSINANRW-LAFRLESIGSVIILGAATLSIYRLGQGTLTAGM 1213

Query: 387  LTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKK-----FVP 441
            +   + Y      ++  +     E+     +  R+ E ++ + S +P + ++       P
Sbjct: 1214 VGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSE-LKSEAPLVIEEKRPAAHWP 1272

Query: 442  NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
            + G+I F + S  Y     + + ++++  I     + IVG +G GKS++   L R    +
Sbjct: 1273 DSGDIRFDHYSTRYRPEL-DLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVEAS 1331

Query: 502  TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561
            +G I +DG  I ++    LR ++SI+ Q+  +  GTIR+N+     E  T DE+  + + 
Sbjct: 1332 SGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENV--DPTETYTDDEIWRVLE- 1388

Query: 562  CFCHNFITKFPNSYDTILGPHGTL---------LSGGQKQRIAIARALIKKPTILILDEA 612
                       N +   +GP G L         LS GQ+Q + +ARAL+    ILILDEA
Sbjct: 1389 -------LSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEA 1441

Query: 613  TSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKE 672
            T+A+DVE++  I  T     + +  TI++IAHR++TI  S+ ++VL + G V E      
Sbjct: 1442 TAAVDVETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEFDTPTN 1498

Query: 673  LYADPGSELSKLLHEKATRSERQQNTAEDQEIDPE 707
            L  + GS+   L  E    +  Q+  AE +  DP+
Sbjct: 1499 LLRNEGSQFHSLCQEAGLLTRAQEAGAEGR--DPK 1531

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 109/504 (21%), Positives = 213/504 (42%), Gaps = 79/504 (15%)

Query: 225 GDLISRLSSDAYVVSRSLTQKV----SDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280
           GD+++ +S D   + + L Q +    S  F+ ++C  V +  ++  S  +   +L +  P
Sbjct: 402 GDIVNLMSVDVQKL-QDLCQFIHLLWSGPFQVVIC-LVSLYKLLGPSMWIGVVILLVMTP 459

Query: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI--R 338
           +    ++  ++ +   +         T V  E  + IK+++ +  E+   K+  H    +
Sbjct: 460 L---NTFLAKIQKRLQKSQMGFKDERTSVISEILNNIKSLKLYAWEEPYKKKLEHVRNDK 516

Query: 339 HIFNVGKQSAFINAKFFSLTAV--LGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEY 396
            + N+ K   F+    F    V  L       V  Y     L   L    LT + + +  
Sbjct: 517 ELKNLTKLGCFMAITSFQFNVVPFLVSCCTFAVFVYTEDRALTVDLVFPALTLFNLLS-- 574

Query: 397 TGSSIFGLSTFYSEIMQGAGAASRLFEL----------TDRIPSISPTLGKKFVPNKGEI 446
               +F +    +  ++ + + +RLF              R+P ++         N G++
Sbjct: 575 --FPLFVIPNVMTSFIEASVSVTRLFNFLTNEELQKDSVQRLPKVT---------NVGDV 623

Query: 447 EFK---NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTT 502
             K   + +F +  +   ++  KN++F+   G   C+VG  G GKS +   L       +
Sbjct: 624 AVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKSALIQSL-------S 676

Query: 503 GQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561
           G +F V G         ++   ++ V Q   +M+GT+++NI +G    P  +      K 
Sbjct: 677 GDLFRVKG-------FATVHGSVAYVSQVAWIMNGTVKENILFGHRYDP--EFYDKTIKA 727

Query: 562 CFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C     +    +  +T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D E  
Sbjct: 728 CALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVD-EHV 786

Query: 622 GA--INYTFG---------KLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670
           G   + +  G         K++ +  I+++SIA R          I L  +G + E G +
Sbjct: 787 GKHLLEHVLGPTGLLRTKTKILATNKISVLSIADR----------IALLENGEIVEQGSY 836

Query: 671 KELYADPGSELSKLLHEKATRSER 694
            E+ AD  S LSKL+ +   +  +
Sbjct: 837 DEVTADGDSALSKLIRDYGRKDNK 860

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 125/515 (24%), Positives = 241/515 (46%), Gaps = 79/515 (15%)

Query: 206  NVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMIS 265
            +++ + +H    FFD+  +G +++R S D      S+ Q++    +++   ++ +   + 
Sbjct: 1128 SLLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFATLL 1183

Query: 266  ISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQE----ATGSLTKVAEEQFSGIKTVQ 321
            +   ++     +   ++L  S  G      SR+L+     +   + +   E   G+ T++
Sbjct: 1184 LISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIR 1243

Query: 322  SFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAYGS 374
            +F  EQ+ IK       ++  + + S      FF L  V   +SF       LV+ + G 
Sbjct: 1244 AFGDEQRFIKE------NLSMIDQNSM----PFFYLWVVNRWLSFRIDLIGALVIFSSGV 1293

Query: 375  YLVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFE------ 423
            +++L+       L+   LT  + +TE    +   L   YSE+     +  R+ E      
Sbjct: 1294 FILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQ 1349

Query: 424  ---LTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIV 480
               + D   +++P       P+ G++E  N+S  Y       + K+++F I+    V IV
Sbjct: 1350 EPLIADPANAVTPPPQW---PDSGKVEVNNLSLKYAPHLP-YVIKDVTFTIEPLEKVGIV 1405

Query: 481  GPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRD 540
            G +G GKSTI + L R+    TG I +DG +I+ +  K LRR ++I+ Q+P L +G+IR 
Sbjct: 1406 GRTGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRS 1465

Query: 541  NIT----------------YGLVE----KPTQDEVRSITKKCFCHNFITKFPNSYDTILG 580
            N+                   LV     + +  E++S + K      + KF N  ++ + 
Sbjct: 1466 NLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKN-----VNKFLN-LESEIA 1519

Query: 581  PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITII 640
              G+  S GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  +   +   T++
Sbjct: 1520 EGGSNFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQEFNNS--TVL 1577

Query: 641  SIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
            +IAHRL +I   + ++V+       EV +F   Y+
Sbjct: 1578 TIAHRLRSIVDYDKILVM----DAGEVKEFDHPYS 1608

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 111/240 (46%), Gaps = 11/240 (4%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           N   + F+NV+  + +   + + +NL  +   G    IVG +G GK++I   LL     +
Sbjct: 702 NGKRLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLS 761

Query: 502 TGQIFVDG---QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP-TQDEVRS 557
            G+I V     +   +  +  +   ++   Q   L++ T+R+NI   L   P  Q    +
Sbjct: 762 EGKIIVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNI---LFNAPFDQARYDA 818

Query: 558 ITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           + + C              T +G  G  LSGGQKQR+++ARAL      L+LD+  SA+D
Sbjct: 819 VVEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVD 878

Query: 618 VESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
             +   I      G LM+ +  T I + H ++   ++ + +V+  DG V E G   EL A
Sbjct: 879 SHTALWIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 139/524 (26%), Positives = 247/524 (47%), Gaps = 42/524 (8%)

Query: 177  SLLVGTA-ANYGRVILLRVLSERVVARLRANVIKKT-MHQDAEFFDNNKVGDLISRLSSD 234
            +L +G+A A   + I+L V      ++   N++  + +     FF+   +G +++R S+D
Sbjct: 998  ALGIGSALATLIQTIILWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSND 1057

Query: 235  AYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRN 294
             Y V   L +  S  F      +V +   I++    +   +F+  P+ +   Y+ +    
Sbjct: 1058 IYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFIIIPLGVFYIYYQQYYLR 1113

Query: 295  NSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAF 349
             SR+L+    S+T+       +E   G+ TV+ +  +    KR++H I         SAF
Sbjct: 1114 TSRELRR-LDSITRSPIYSHFQETLGGLATVRGYSQQ----KRFSH-INQCRIDNNMSAF 1167

Query: 350  ---INAKFFSLTAVLGDMSFLVVLAYGSYLVL---HGSLSIGDLTAYMMYTEYTGSSIFG 403
               INA  + L   L  +  +++L   +  V     G+L+ G +   + Y      ++  
Sbjct: 1168 YPSINANRW-LAYRLELIGSIIILGAATLSVFRLKQGTLTSGMVGLSLSYALQITQTLNW 1226

Query: 404  LSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK-----KFVPNKGEIEFKNVSFSYPTR 458
            +     E+     +  R+ E  D + S +P + +     K  P +G+I F N S  Y   
Sbjct: 1227 IVRMTVEVETNIVSVERIKEYAD-LKSEAPLIIEGHRPPKQWPAQGDIRFNNYSTRYRPE 1285

Query: 459  ASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSK 518
              + + K ++  I     V IVG +G GKS++   L R    + G I +DG  I+++   
Sbjct: 1286 L-DLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLY 1344

Query: 519  SLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTI 578
             LR  +SI+ Q+  +  GT+R+NI   + +   +   R++       + ++   +  D  
Sbjct: 1345 DLRHKLSIIPQDSQVFEGTVRENID-PINQYSDEAIWRALELSHLKEHVLSMSNDGLDAQ 1403

Query: 579  LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSIT 638
            L   G+ LS GQ+Q + +ARA++    IL+LDEAT+A+DVE++  +  T     K +  T
Sbjct: 1404 LSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--T 1461

Query: 639  IISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELS 682
            I++IAHRL+TI  S+ +IVL N G VAE       +  PG  LS
Sbjct: 1462 ILTIAHRLNTIMDSDRIIVLDN-GKVAE-------FDTPGQLLS 1497

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 119/541 (21%), Positives = 239/541 (44%), Gaps = 58/541 (10%)

Query: 203 LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKV----SDGFKAMLCGSV 258
           L A + +K++    E    +  GD+++ +S D   + + LTQ +    S  F+ ++C   
Sbjct: 382 LTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKL-QDLTQWLNLIWSGPFQIIIC-LY 439

Query: 259 GIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIK 318
            +  ++  S  +   +L +  P+    S+  R+ +   +   +     T+V  E  + IK
Sbjct: 440 SLYKLLGNSMWVGVIILVIMMPL---NSFLMRIQKKLQKSQMKYKDERTRVISEILNNIK 496

Query: 319 TVQSFVAEQK-----EIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYG 373
           +++ +  E+      E  R N  ++++  +G   A  + +F ++   L       V  Y 
Sbjct: 497 SLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQF-NIVPFLVSCCTFAVFVYT 555

Query: 374 SYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISP 433
               L   L    LT + + +      +  +    +  ++ + +  RLF        + P
Sbjct: 556 EDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRLFSFFTN-EELQP 610

Query: 434 TLGKKF--VPNKGEIEFK---NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGK 487
              ++   V N G+I      + +F +  +   ++  KN+ F+   G+  CIVG  G GK
Sbjct: 611 DSVQRLPNVENIGDIAINIGDDATFLWQRKPEYKVALKNIDFQATKGNLTCIVGKVGSGK 670

Query: 488 STIASLLLRYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGL 546
           + + S +L       G +F V G         ++   ++ V Q P +M+GT+++NI +G 
Sbjct: 671 TALLSCML-------GDLFRVKG-------FATVHGCIAYVSQVPWIMNGTVKENILFG- 715

Query: 547 VEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTI 606
             K   +      K C     +    +   T++G  G  LSGGQK R+++ARA+  +   
Sbjct: 716 -HKYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADT 774

Query: 607 LILDEATSALDVE-SEGAINYTFGK--LMKSKSITIISIAHRLSTIRRSENVIVLGNDGS 663
            +LD+  +A+D   +   I +  G   L+ +K  T I   +++S +  ++++ +L N G 
Sbjct: 775 YLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TRILATNKVSALSIADSIALLDN-GE 831

Query: 664 VAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETINIENSTPESDITQ 723
           + + G + ++  D  S L KLL++   ++  +Q+         EE  + +NS  ES I  
Sbjct: 832 IIQQGAYSDITKDADSPLWKLLNDYGKKNNNKQS---------EECDSSKNSVRESSIPV 882

Query: 724 E 724
           E
Sbjct: 883 E 883

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 131/492 (26%), Positives = 232/492 (47%), Gaps = 33/492 (6%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  S  F      +V +   I++    +   +F+
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICVTTWQFIFI 1096

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+ +   Y+ +     SR+L+    S+T+       +E   G+ TV+ +  +    KR
Sbjct: 1097 IVPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGYSQQ----KR 1151

Query: 333  YNHAIRHIFNVGKQSAF---INAKFFSLTAVLGDMSFLVVLAYGSYLVL---HGSLSIGD 386
            ++H I         SAF   +NA  + L   L  +  +++L   +  V     G+L+ G 
Sbjct: 1152 FSH-INQCRIDNNMSAFYPSVNANRW-LAYRLELIGSVIILGAATLSVFRLKQGTLTAGM 1209

Query: 387  LTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK-----KFVP 441
            +   + Y      ++  +     E+     +  R+ E  D I S +P + +     K  P
Sbjct: 1210 VGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYAD-IKSEAPLVIEGHRPPKEWP 1268

Query: 442  NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
             +G+I+F   S  Y     + + K +   I     + IVG +G GKS++   L R    +
Sbjct: 1269 GQGDIKFNQYSTRYRPEL-DLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEAS 1327

Query: 502  TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561
             G I +DG  I+++    LR  +SI+ Q+  +  GT+R+NI   + +   +   R++   
Sbjct: 1328 AGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAMWRALELS 1386

Query: 562  CFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                + ++   +  D+ L   G+ LS GQ+Q + +ARA++ +  IL+LDEAT+A+DVE++
Sbjct: 1387 HLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETD 1446

Query: 622  GAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
              I  T     K +  TI++IAHRL+TI  S+ +IVL N G VAE     +L  +  S  
Sbjct: 1447 KVIQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPAQLLTNTKSLF 1503

Query: 682  SKLLHEKATRSE 693
              L  E    +E
Sbjct: 1504 YSLCAEAGLVNE 1515

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 109/522 (20%), Positives = 223/522 (42%), Gaps = 63/522 (12%)

Query: 199 VVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKV----SDGFKAML 254
           V + L A + +K++    E    +  GD+++ +S D   + + LTQ +    S  F+ ++
Sbjct: 378 VKSALTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKL-QDLTQWLNLIWSGPFQIII 436

Query: 255 CGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQF 314
           C    +  ++  S  +   +L +  P+    S+  R+ +   +   +     T+V  E  
Sbjct: 437 C-LYSLYKLLGNSMWVGVIILVIMMPL---NSFLMRIQKKLQKSQMKYKDERTRVISEIL 492

Query: 315 SGIKTVQSFVAEQK-----EIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVV 369
           + IK+++ +  E+      E  R N  + ++  +G   A  + +F ++   L       V
Sbjct: 493 NNIKSLKLYAWEKPYREKLEDVRNNKELNNLTKLGCYMAVTSFQF-NIVPFLVSCCTFAV 551

Query: 370 LAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIP 429
             Y     L   L    LT + + +      +  +    +  ++ + +  RLF       
Sbjct: 552 FVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRLFSFFTN-E 606

Query: 430 SISPTLGKKF--VPNKGEIEFK---NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPS 483
            + P   ++   V N G+I      + +F +  +   ++  KN++F+   G   C+VG  
Sbjct: 607 ELQPDSVQRLPKVENVGDIAINIGDDATFLWQRKPEYKVALKNINFQAKKGELTCVVGKV 666

Query: 484 GRGKSTIASLLLRYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI 542
           G GK+ + S        T G +F V G         S+   ++ V Q P +M+GT+++NI
Sbjct: 667 GSGKTALLS-------STLGDLFRVKG-------FASVHGSVAYVSQVPWIMNGTVKENI 712

Query: 543 TYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIK 602
            +G   K   +      K C     +    +   T++G  G  LSGGQK R+++ARA+  
Sbjct: 713 LFG--HKYDAEFYEKTIKACALTIDLAILMDGDQTLVGEKGISLSGGQKARLSLARAVYS 770

Query: 603 KPTILILDEATSALD----------VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRS 652
           +    +LD+  +A+D          V     + +T  KL+ +  ++ +S+A         
Sbjct: 771 RADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTKTKLLATNKVSALSVA--------- 821

Query: 653 ENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSER 694
            + I L ++G + + G + ++  D  S L KL+ +   ++ +
Sbjct: 822 -DSIALLDNGEIIQQGTYDDITKDADSPLWKLIKDYGKKNNK 862

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 142/535 (26%), Positives = 247/535 (46%), Gaps = 54/535 (10%)

Query: 166  NLYEFISLVGVSLLVGTAA----NYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +L++F   VG+  L+G ++    N   VI+L   S R    L   +    +     FF++
Sbjct: 1024 DLWKF---VGIYALLGISSAAFDNIRAVIILLYSSIRGSKVLHNKMAVSVLKSPMGFFES 1080

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPV 281
              +G +I+R SSD   V R+L    +  FK +L   V I   + I   +  FL+F    +
Sbjct: 1081 TPIGRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTI---LLIGYNMPWFLVF-NAGL 1136

Query: 282  MLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQS-FVAEQKEIKRYNHAIR-H 339
            ++   Y+       SR+L+       +++   FS I ++ S  +     I  + H+ R H
Sbjct: 1137 LVVYVYYQVFYVTLSRELK-------RLSSTAFSPIMSLFSETLGGHMVITAFRHSERFH 1189

Query: 340  IFNVGKQSAFINAKF----------FSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTA 389
              N  K    I+A+F            L  + G M  +  L   + +     ++ G +  
Sbjct: 1190 FLNFNKTQFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMTAGLVGL 1249

Query: 390  YMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTL-----GKKFVPNKG 444
             M Y     +S+  +    + I     +  R++E   ++PS +P +      +K  P+ G
Sbjct: 1250 LMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYC-QLPSEAPAIIESSRPEKSWPSMG 1308

Query: 445  EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQ 504
            EI FK+ S  Y     + + K ++  I     + +VG +G GKS+++  L R    T G 
Sbjct: 1309 EIIFKDYSTKYRPEL-DPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTGGS 1367

Query: 505  IFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI----TYGLVEKPTQDEVRSITK 560
            I +DG DISK+    LR H+SI+ Q+     GT+R N+     Y + E     E+  + K
Sbjct: 1368 IEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQYSVQEIWKAVELAHL-K 1426

Query: 561  KCFCHNFITKFPN---------SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
                     + P+         + D  +  +G  +S GQ+Q + ++RAL+ K  +L+LDE
Sbjct: 1427 PHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLVLDE 1486

Query: 612  ATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            AT+A+D+E++  I  T     + K  TI++IAHR+ T+  S+ ++VL + G V E
Sbjct: 1487 ATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DKGEVKE 1538

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 120/244 (49%), Gaps = 19/244 (7%)

Query: 469 FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI-- 526
           F+   G+  C+VG  G GKST+   +L       GQ+         +S + L R  S+  
Sbjct: 662 FEAKKGALTCVVGRVGSGKSTLLRAIL-------GQLPCRSGPKEFISPEILVRARSVAY 714

Query: 527 VQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLL 586
             Q P +M+ +I+DNI +G   +  +       K C     +       +T++G  G  L
Sbjct: 715 CPQAPWVMNASIKDNILFG--HRYDETYYNLTIKACQLIPDLKILSEGDETLVGEKGISL 772

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGK---LMKSKSITIISI 642
           SGGQK R+++ARA+  +  + ++D+  SA+D E S+  I+   G+   L+K K  TII  
Sbjct: 773 SGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILT 830

Query: 643 AHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA-DPGSELSKLLHEKATRSERQQNTAED 701
            + +S ++ S N+I     G + E G +++  +    S L KL+ E  T +E   +  +D
Sbjct: 831 TNAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEFDTFAENPSDKKKD 889

Query: 702 QEID 705
           +E D
Sbjct: 890 EEND 893

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 240/511 (46%), Gaps = 71/511 (13%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            ++ K +H    FFD+  +G +++R S D   + + LT  V    ++++  SV +   + +
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYV----ESVVYNSVQLIATVLL 1191

Query: 267  SPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFS----GIKTVQS 322
               ++   + +   V+L   + G    + SR+L+    +      + FS    G+ T+++
Sbjct: 1192 ITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRA 1251

Query: 323  FVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-------LVVLAYGSY 375
            +  E + +K          N+ K     N  FF L      + F       LV+   G  
Sbjct: 1252 YGDEIRFMKE---------NLTKIDEN-NKPFFYLWVANRWLCFRIDIIGSLVIFGAGVL 1301

Query: 376  LVLH-----GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTD--RI 428
            ++++       L+   LT  + +TE    S   L   YS +     +  R+ E  D  + 
Sbjct: 1302 VLMNINKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQE 1357

Query: 429  PSISPTLG-KKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGK 487
            P  +  +   K  P++G+IE  ++S  Y      ++ KN+SF ++    V +VG +G GK
Sbjct: 1358 PYSAGIVNVDKSWPSEGKIEVNDLSLRYAPSLP-KVIKNVSFTVEPKMKVGVVGRTGAGK 1416

Query: 488  STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI----T 543
            STI + L R+ +P TG I +D  DI+ +  K LR+ ++I+ Q+P L +GTI+ N+     
Sbjct: 1417 STIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNE 1476

Query: 544  YG-------------LVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQ 590
            Y              +V+     +V S++ +      + KF N    I    G+ LS GQ
Sbjct: 1477 YNDDQIFKALRRVNLIVDGNLNSDVTSVSSEN-----VNKFLNLQSEI-SEGGSNLSQGQ 1530

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIR 650
            +Q + +AR+L++ P I++LDEAT+++D  S+  I  T     K    TI++IAHRL ++ 
Sbjct: 1531 RQLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRNEFKDS--TILTIAHRLRSVI 1588

Query: 651  RSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
              + ++V+       + G+ KE Y  P S L
Sbjct: 1589 DYDKILVM-------DAGEVKE-YDHPYSLL 1611

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 114/230 (49%), Gaps = 11/230 (4%)

Query: 445 EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQ 504
           +I  +NV+ S+  +  +   +NL+     G    ++GP+G GK+++   LL   +   G+
Sbjct: 697 KISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEGK 756

Query: 505 IFVDGQDIS---KVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561
           I V   D        S  L   M+   Q   L++ T+++NI +    +  ++   ++   
Sbjct: 757 ITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFN--AEYNEERYLAVISA 814

Query: 562 CFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C              T +G  G  LSGGQKQRI++ARAL      ++LD+  SA+D  + 
Sbjct: 815 CALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHTA 874

Query: 622 GAI--NYTFGKLMKSKSITIISIAHRLS-TIRRSENVIVLGNDGSVAEVG 668
             I  N   G LM+++  T I ++H ++ T++ +E VI++ N G ++ +G
Sbjct: 875 AWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMIDN-GKISHIG 921

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 139/571 (24%), Positives = 247/571 (43%), Gaps = 54/571 (9%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGR-VILLRVLSERVVARLRANVIKKTMHQDAEFFD 220
             +  +  +F+++  +  L+  A N  R VI+L   S R   +L   +    M     FF+
Sbjct: 1015 GYNKDFLKFVTIYAIIGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFE 1074

Query: 221  NNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280
               +G +++R SSD   +   L    S  F+++L   V + ++    P   A    L   
Sbjct: 1075 TTPIGRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMI 1134

Query: 281  VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQK------EIKRYN 334
                 +Y+  L R   R    +   +  +  E   G   + +F    +      E  +YN
Sbjct: 1135 YFYYQAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAFDHTSRFNFFNFETVQYN 1194

Query: 335  HAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYG--SYLVL--HGSLSIGDLTAY 390
              I  +F     + +++ +       L  +  L++LA G  S+  L     LS G +   
Sbjct: 1195 --IDCVFQFRSTNRWLSVR-------LQTIGNLIILATGLLSFATLGTKKQLSSGMVGLL 1245

Query: 391  MMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS----ISPTLGKKFVPNKGEI 446
            M Y+    SS+  +     +I     +  R  E  +  P     I  +   +  P +G I
Sbjct: 1246 MSYSLQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAI 1305

Query: 447  EFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF 506
            EF N +  Y     + + K+++  I     + IVG +G GKST+   L R    T G I 
Sbjct: 1306 EFNNYTTKYRENL-DPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSIS 1364

Query: 507  VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHN 566
            +DG DISK+  + LR +++I+ Q+     GTIR N+     ++ + +E+    +      
Sbjct: 1365 IDGIDISKIGLEDLRSNLAIIPQDAQAFEGTIRSNL--DPFDQHSDEELWRAVELSHLKQ 1422

Query: 567  FITKF------------------PNSYD------TILGPHGTLLSGGQKQRIAIARALIK 602
             I +                   P+S++      T +  +G+ +S GQ+Q + ++RAL+ 
Sbjct: 1423 HILRMNEEANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLN 1482

Query: 603  KPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDG 662
               +LILDEAT+A+D+E++  +  T     K +  TI++IAHR+ T+   + ++VL + G
Sbjct: 1483 PSKVLILDEATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVL-DKG 1539

Query: 663  SVAEVGKFKELYADPGSELSKLLHEKATRSE 693
             VAE      L +D  +   KL  + A   E
Sbjct: 1540 EVAEFDTVSNLLSDKNTMFYKLCEQGAYLKE 1570

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 125/582 (21%), Positives = 258/582 (44%), Gaps = 69/582 (11%)

Query: 203 LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGM 262
           L A V KK++   ++    +  GD+I+ +S+D   + R      S     +    V I +
Sbjct: 366 LMALVYKKSLRISSDARQKHSSGDIINLMSTDVLNLQRFFENSQSIIGAPIQIVIVLISL 425

Query: 263 MISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQS 322
            + +   + A ++ +   + ++A Y  R + +  +   +   S   +  E  + IK+++ 
Sbjct: 426 YLLLDKAVFAGMISMVIMIPINA-YLSRKVGSLYKTQMKYKDSRLTILTEILNSIKSIKL 484

Query: 323 FVAEQKEIKRYNHAIRH---IFNVGKQSAFINAKFFSLTAV--LGDMSFLVVLAYGSYLV 377
           +  E+  +K+  H +R+   + N  K   F N  FF+   V  +   S  ++ +  S + 
Sbjct: 485 YSWEKPMLKKLLH-VRNDLELENFKKIGIFSNLIFFAWNCVPLMVTCSTFLIFSMISDVP 543

Query: 378 LHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK 437
           L   +    LT + +  +    +I+ + +  ++++Q   +  RL +       ++  L  
Sbjct: 544 LSPDIIFPSLTLFNILND----AIYVVPSTINDVIQANISMKRLRDFL-----LAEELDD 594

Query: 438 KFVPNKGE--------IEFKNVSFSYPTR----------------ASNQIFKNL-SFKID 472
            F+  K          IE  N +F + ++                 S    KN+ +F + 
Sbjct: 595 SFIEYKSPSETDDAPVIEINNATFLWQSKKIINENSSTDEESNIETSKAALKNIDNFTVK 654

Query: 473 AGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI-FVDGQDISKVSSKSLR-RHMSIVQQE 530
            GS  CIVG  G GKSTI   +L       GQ+  +   D ++    ++R   ++   QE
Sbjct: 655 KGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIAYCPQE 707

Query: 531 PVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGG- 589
             +M+ ++++NI +G   K  ++    + + C   + ++  P+  +TI+G  G  L GG 
Sbjct: 708 AWIMNSSVKENIVFG--HKHDENYYNLVIQACQLASDLSILPDGDETIVGEKGISLVGGV 765

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGK---LMKSKSITIISIAHR 645
           QK RI++ARA+  +  + +LD+  SA+D   S+  I Y   K   L+++K  TII   + 
Sbjct: 766 QKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TIILSTNN 823

Query: 646 LSTIRRSENVIVLGNDGSVAEVGKFKELY-ADPGSELSKLLHEKATRSE-----RQQNTA 699
           ++ ++ S+ +  +   G + E   ++ +  +   S + KL+ E  T +      ++ ++ 
Sbjct: 824 VNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEEFGTSTSNSNEVKETSSE 882

Query: 700 EDQEIDPEETINIENSTPESDITQELLENPIKEAIMDVAADN 741
                  ++T N      + DI +   +N I E+I+   A+N
Sbjct: 883 NSSSEIEDKTSNATELLKKKDIDE---DNDIVESIVSFDAEN 921

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 130/505 (25%), Positives = 222/505 (43%), Gaps = 52/505 (10%)

Query: 203  LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGM 262
            L    +K+ +H    F D   +G +++R + D   +   LT+ V   F        G+ +
Sbjct: 928  LNLKAVKRLLHTPMSFMDTTPLGRVLNRFTKDTDTLDNELTESVR-LFVYQTANIAGVII 986

Query: 263  MISIS-PQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321
            M  I  P  +  + FL    ++ A ++    R   R        +     E  SG+ T++
Sbjct: 987  MCIIYLPWFAIAVPFLGLIFIIVADHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIK 1046

Query: 322  SFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKF-FSLTAVLGDMSFLVVLAYGSYLVLHG 380
            ++ +E + + + +  I  +   G     +      SL  +    + ++ L   +      
Sbjct: 1047 AYKSENRFLMKSDFLINRMSEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDIS 1106

Query: 381  SLSIGDLTAY--------------MMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTD 426
            + S+G L  Y              M   E   +S+  +  + +E+ Q A           
Sbjct: 1107 AASVGVLLTYVLQLPGLLNGLLRAMTQAENDMNSVERIVNYATELPQEAAY--------- 1157

Query: 427  RIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRG 486
            R P ++P   ++  P+ GE+ F NVS SY       + K +S  I  G  + I G +G G
Sbjct: 1158 RKPEMTP---QEPWPSNGEVVFDNVSLSYRP-GLPLVLKGVSLNIKGGEKIGICGRTGAG 1213

Query: 487  KSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN----- 541
            KSTI S L R      G++ +DG D SK+    LRR +SI+ Q+PVL  G+IR N     
Sbjct: 1214 KSTIMSALYRLCELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFG 1273

Query: 542  -----------ITYGLVEKPTQDEVRSITK-KCFCHNFITKFPNSYDTILGPHGTLLSGG 589
                       +  G +E    ++V++  + +      + KF    D  +   GT  S G
Sbjct: 1274 EREDEELWSALVRSGTIEAEEVEKVKNQHRDESGSSTGLHKF--HLDQEVEDDGTNFSLG 1331

Query: 590  QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTI 649
            ++Q +A+ RAL+++  ILILDEATS++D E++  I     +  +    TI+ IAHRL TI
Sbjct: 1332 ERQLLALTRALVRQSKILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTI 1389

Query: 650  RRSENVIVLGNDGSVAEVGKFKELY 674
               + ++VL N G+V E    + L+
Sbjct: 1390 LNYDRLVVLDN-GTVKEFDTPRSLF 1413

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 452 SFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQD 511
           +F+   +AS   FKNL+F+I  G  V I G  G GKS++ + L  +   T G IF +G  
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG-- 616

Query: 512 ISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR--SITKKCFCHNFIT 569
                  SL     ++   P + + T+RDNI +G     + D+VR   + + C     + 
Sbjct: 617 -------SL-----LLCGYPWIQNTTVRDNILFG----SSFDDVRYKEVIRVCALQADLD 660

Query: 570 KFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF 628
             P    T +G  G  LSGGQK RI +AR++ K   I + D+  SA+D    +  ++   
Sbjct: 661 ILPAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECL 720

Query: 629 GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH-E 687
             ++  K  T I   H+LS I R+  VI LG  GS  ++G  +EL  +  S   KL+   
Sbjct: 721 MGMLDGK--TRILATHQLSLIERASRVIFLGAGGSF-DIGTVEEL-KERNSGFVKLMEFS 776

Query: 688 KATRSERQQNTAEDQ 702
             T+S  Q+   +D 
Sbjct: 777 TQTKSANQREEVDDH 791

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 147/572 (25%), Positives = 260/572 (45%), Gaps = 90/572 (15%)

Query: 174  VGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSS 233
            V V++L GT A   + I  ++LS   +A+LR             F D   VG +++R S 
Sbjct: 1060 VWVAVLFGTNAT--KKIFAKLLSSIFLAKLR-------------FHDITPVGRIMNRFSK 1104

Query: 234  DAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF--GRL 291
            D  ++ + L       F +++     I ++  I+P+   FLLF  P   L A Y+  G L
Sbjct: 1105 DMDIIDQQLIPNFEGLFYSVVVCLWVIFLIGYITPR---FLLFAIP---LCALYYIVGSL 1158

Query: 292  IRNNSRDLQEA----TGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQS 347
                SR+L+         + ++  E   G+ T+++   E++ I +   AI          
Sbjct: 1159 YLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDK-------- 1210

Query: 348  AFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTG---SSIFGL 404
               NA FF L      +++ V +  G+ ++   SL I  L A  +     G   S+ F  
Sbjct: 1211 --SNAPFFYLNLATEWITYRVDII-GALILFSSSLMIV-LKAPYLDAGLAGILLSNAFSF 1266

Query: 405  STFYSEIMQGAGAASRLFELTDRIPS-----ISPTLGKKFV------PNKGEIEFKNVSF 453
            +     I++       L    +RI       +  +    +       P  G+IEF+N++ 
Sbjct: 1267 TETAQWIIKVFSGVELLMSSVERIKEYVDVPLESSESNNYATPLANWPQTGDIEFENLTL 1326

Query: 454  SYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
             Y   +S  +   +SFK+ AG+ V IVG +G GKS+I + + R  +   G I +D +DI 
Sbjct: 1327 RYSPHSSKAL-DGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIK 1385

Query: 514  KVSSKSLRRHMSIVQQEPVLMSGTIRDNI----------------TYGLVEKPTQDEVRS 557
             V  + LR  +S + Q P L  GTIR N+                  GL+E+   + + S
Sbjct: 1386 YVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQ--SEGLCS 1443

Query: 558  ITKKCFCHNFITKFPNSY---DTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
            +  +   +    K  N +   +T++   G+ +S GQ+Q + +AR+++    I+++DEAT+
Sbjct: 1444 LPGQKLSYPSNHKLRNRFIDLNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATA 1503

Query: 615  ALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY 674
            ++D  S+  I  T  + M++   T+++IAHRL ++   + ++V+ + G V E      L 
Sbjct: 1504 SIDYVSDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM-DMGRVEEYDHPYNLI 1560

Query: 675  ADPGS----------ELSKL--LHEKATRSER 694
            +D  +          E  KL  L EK+ ++ER
Sbjct: 1561 SDKNTIFHRLCKRSGEFEKLFSLAEKSFKNER 1592

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 85/298 (28%), Positives = 137/298 (45%), Gaps = 23/298 (7%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           +K ++ F+N +  +    ++   KN+S      +   I+GP+G GKS++   LL   N  
Sbjct: 661 SKTKLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLR 720

Query: 502 TGQI---FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSI 558
           +G+I    V  +D  ++    +   M+   Q P L+SGTI+DNI +G  E   Q +   +
Sbjct: 721 SGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKFDDV 778

Query: 559 TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            K C     I        T +G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+D 
Sbjct: 779 IKCCCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDP 838

Query: 619 ESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA- 675
           E+   I      G +MK +  T I  +H +S I +    +V+ ++G V   GK  +L   
Sbjct: 839 ETALHIYEECLCGPMMKGR--TCIVTSHNISLIIKQAQWLVILDNGEVKAQGKPSDLIES 896

Query: 676 ----------DPGSELSKLLHEKATRSERQQNTAEDQEIDPEETIN---IENSTPESD 720
                     DPG +    +  K  ++ ++       E DP++  N    EN   E D
Sbjct: 897 SKFLKESINNDPGDKSYNQIKLKQFKTLKKTENVLPIEEDPQDEENPQEAENPQEEED 954

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 141/553 (25%), Positives = 241/553 (43%), Gaps = 72/553 (13%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F    G   + G    Y  +  + V + +V   L    +++ +H    + D 
Sbjct: 923  SFYMGLYSFFVFGGYLFMNG---QYTLICYMGVTASKV---LNLKAVERVLHTPMAYMDT 976

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISIS-PQLSAFLLFLTPP 280
              +G +++R + D   +   LT+ +   F       +G+ +M  I  P  +  + FL   
Sbjct: 977  TPIGRILNRFTKDTDSLDNELTESLR-LFMTQFANIIGVCVMCIIYLPWFAIAIPFLVLI 1035

Query: 281  VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340
             +L A ++    R   R        +     E   G+ T++++ ++++ + + +  I   
Sbjct: 1036 FVLIADHYQASGREVKRLDAIQRSFVYNNLNEVLGGMDTIKAYGSQERFLVKTDFLI--- 1092

Query: 341  FNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL-------HGS-LSIGDLTAYMM 392
             N   ++ ++        A+  DM   + +A+   + L       H S  S+G L  Y++
Sbjct: 1093 -NKMNEAGYLLVALQRWVAIFLDM---IAVAFALIISLLCVTRQFHISPASVGVLLTYVL 1148

Query: 393  YTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSIS----PTLGK-KFVPNKGEIE 447
                  ++I    T   +      +A RL    + +P  +    P L   +  P+KGEI 
Sbjct: 1149 QLPGLLNTILRALT---QTENDMNSAERLVYCANELPLEADYKRPELAPPESWPSKGEIV 1205

Query: 448  FKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFV 507
            F++VSF+Y       + K +S  I +   + I G +G GKSTI S L R    + G+IF+
Sbjct: 1206 FEDVSFAYRP-GLPVVLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNELSDGKIFI 1264

Query: 508  DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQ--------------D 553
            D  DI ++    LR+ +SI+ Q+PVL  GTIR N+     E P +              +
Sbjct: 1265 DSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLD-PFQEHPDELLWKSLVSGGAISAE 1323

Query: 554  EVR--------SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPT 605
            EV         SI      H F        D  +   G   S G++Q +A+ RAL+++  
Sbjct: 1324 EVEVVKGQKPDSIGSLSSMHKF------HLDQKVEEEGANFSLGERQLLALTRALVRQSK 1377

Query: 606  ILILDEATSALDVESEGAIN----YTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGND 661
            ILILDEATS++D E++  I       FG        TI+ IAHRL TI   + ++VL   
Sbjct: 1378 ILILDEATSSVDYETDNKIQSRIAAAFG------DCTILCIAHRLKTILTYDRILVL-EQ 1430

Query: 662  GSVAEVGKFKELY 674
            G + E    + LY
Sbjct: 1431 GEIEEFDTPRSLY 1443

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 126/266 (47%), Gaps = 26/266 (9%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           FKNL+  I  G  V I GP G GKS++ S +  +   T+G + VDG              
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDGD------------- 642

Query: 524 MSIVQQEPVLMSGTIRDNITYGL-VEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH 582
             ++   P + + T+RDNI +G   +K   DEV    + C     I   P    T +G  
Sbjct: 643 -LLMCGYPWIQNATVRDNIIFGSPYDKERFDEV---VRVCSLKADIDILPGGELTEIGER 698

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGKLMKSKSITII 640
           G  LSGGQK RI +AR++ K   I + D+  SA+D      I      G+L   K  T I
Sbjct: 699 GITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRI 755

Query: 641 SIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAE 700
              H+LS I ++  VIVLG DGS  E GK ++L       L  LLH  + +S  ++    
Sbjct: 756 LATHQLSLIEKASVVIVLGVDGSF-EAGKLEDL-KRSNKTLINLLHFSSQKSSSKEADTS 813

Query: 701 DQEIDPEETI-NIENSTPESDITQEL 725
           ++++  + +I  ++    ES   +EL
Sbjct: 814 EKDLALKTSIEEVKTHDSESKEWEEL 839

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  125 bits (314), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 153/294 (52%), Gaps = 49/294 (16%)

Query: 417 AASRLFELTDRIPS-----ISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKI 471
           +  R+ E TD IPS     ISP       P  G++E KN+S  Y   +S +   N+SFK+
Sbjct: 3   SVERIKEYTD-IPSESNGYISPPAN---WPQTGDVELKNLSLRYSPHSS-KALDNVSFKV 57

Query: 472 DAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEP 531
            AG+ V IVG +G GKS+I + + R  +   G I +D +DI  +  + LR  +S + Q+P
Sbjct: 58  KAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDP 117

Query: 532 VLMSGTIRDNIT----------YGLVEKPTQDEVRSITKKC--FCHNFITKFPN------ 573
            L  GT+R N+           YG++ K        + ++C   C  F  + PN      
Sbjct: 118 TLFDGTVRSNLDPFDRYSDVQIYGVLSKV------GLIEECDELCLIFEQEQPNFSSHKL 171

Query: 574 -----SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
                  +T++   G+ LS GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T 
Sbjct: 172 RNRFIDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTI 231

Query: 629 GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELS 682
            + M  K+ TI++IAHRL ++   + ++V+       E+G+ KE Y  P + +S
Sbjct: 232 RETM--KNTTILTIAHRLRSVIDYDKILVM-------EMGRVKE-YDHPYTLIS 275

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 142/540 (26%), Positives = 253/540 (46%), Gaps = 72/540 (13%)

Query: 174  VGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSS 233
            V V++L GT  N  + I  ++LS    A+LR             F D   VG +++R S 
Sbjct: 1047 VWVAMLSGT--NATKKIFSKLLSSIFEAKLR-------------FHDITPVGRIMNRFSK 1091

Query: 234  DAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYF-GRLI 292
            D  ++ + L       F +++   V + ++I I      FL+F  P  +    YF G L 
Sbjct: 1092 DMDIIDQQLIPNFEGLFYSVV---VCLWIVILIGYVTPRFLIFAIP--LCGLYYFVGALY 1146

Query: 293  RNNSRDLQEA----TGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRH----IFNVG 344
               SR+L+         + ++  E   G+ T+++   E++ I     AI       F + 
Sbjct: 1147 LRASRELKRIDNINVSPIHQLFTEAIKGVVTIRALADERRFITHTLEAIDGSNAPFFYLS 1206

Query: 345  KQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLV--LHGSLSIGDLTAYMMYTEYTGSSIF 402
              + +I  +   + A++   S L+++A   YL   L G L + +  ++    ++      
Sbjct: 1207 VATEWITYRVDIIGALVLFSSSLMIIARAPYLDAGLAGIL-LSNAFSFTETAQWIIKVFS 1265

Query: 403  GLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQ 462
            G+    S + +         E +    S +  +     P  GEIEFKN+S  Y   +S  
Sbjct: 1266 GVELLMSSVERIKEYIEVPLEFSKSNDSATSPVDW---PQTGEIEFKNLSLRYSPHSSKA 1322

Query: 463  IFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRR 522
            +  N+SFK+  G+ V IVG +G GKS+I + + R  +  +G I +D +DI  VS + LR 
Sbjct: 1323 L-DNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDNKDIKCVSLECLRN 1381

Query: 523  HMSIVQQEPVLMSGTIRDNI----------------TYGLVEKPTQDEVRS-ITKKCFCH 565
             +S + Q P L  GTIR N+                  GL+E+   +EV   +T +    
Sbjct: 1382 SISCIPQNPTLFDGTIRSNLDPYNQYSDKQVFDALAKVGLIER---NEVLCLVTDRQQSS 1438

Query: 566  NFITKFPNSY---DTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
            +F    PN +   ++++   G+ LS GQ+Q + +AR+++    I+++DEAT+++D  S+ 
Sbjct: 1439 SFS---PNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEATASIDYISDA 1495

Query: 623  AINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELS 682
             I  T  + M++   TI++IAHRL ++     ++V+       ++G+ KE Y  P + +S
Sbjct: 1496 KIQKTIRETMENT--TILTIAHRLRSVIDYNKILVM-------DMGRVKE-YDHPYNLIS 1545

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 122/237 (51%), Gaps = 9/237 (3%)

Query: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           +K ++ FK+ +  +    ++   KN+S +    S   I+GP+G GKS++   LL   N  
Sbjct: 660 SKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLC 719

Query: 502 TGQIFV---DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSI 558
           +GQI+V   D +D  +V    +   M+   Q P L+SGTI DNI +G  E+P Q    ++
Sbjct: 720 SGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAV 777

Query: 559 TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            K C     +        T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D 
Sbjct: 778 IKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDP 837

Query: 619 ESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
           E+   I      G +MK ++  I S  H +S I +    +V+ ++G V   GK  +L
Sbjct: 838 ETALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGKPSDL 892

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 132/486 (27%), Positives = 226/486 (46%), Gaps = 37/486 (7%)

Query: 203  LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGM 262
            L ++++   +     FF+   +G +++R S+D Y +   L +  S  F      +V +  
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFF----VNAVKVSF 1088

Query: 263  MISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGI 317
             I +    +   + L  P+ +   Y+ +     SR+L+    S+TK       +E   G+
Sbjct: 1089 TILVICWNTWQFILLVIPMGVLYLYYQQYYLRTSRELRRL-DSITKSPIYAHFQESLGGL 1147

Query: 318  KTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLV 377
             T++ +  +QK     N A R   N+      IN+  + L   L  +  L++    S  +
Sbjct: 1148 ATIRGY-EQQKRFIHINQA-RVDNNMSAYYPSINSNRW-LAYRLEFLGSLIIFGAASLSI 1204

Query: 378  LH---GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPT 434
            L    G+L+ G +   + Y      S+  +     E+     +  R+ E  + + S +P 
Sbjct: 1205 LKLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAE-LKSEAPL 1263

Query: 435  L-----GKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
            +       +  P +G I+F+N S  Y     + + KN+S  I     V IVG +G GKS+
Sbjct: 1264 IIEEKRPSENWPERGAIKFENYSTRYRPDL-DLVLKNISLDIKPQEKVGIVGRTGAGKSS 1322

Query: 490  IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEK 549
            +   L R      G I VDG +IS++    LR  +SI+ Q+  +  GTIR+NI    +  
Sbjct: 1323 LTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNIY- 1381

Query: 550  PTQDEVRSITKKCFCHNFITKF---------PNSYDTILGPHGTLLSGGQKQRIAIARAL 600
             T +++ +  +       I +           N+  T +   G  LS GQ+Q + +ARAL
Sbjct: 1382 -TDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLARAL 1440

Query: 601  IKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGN 660
            +    ILILDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL +
Sbjct: 1441 LVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-D 1497

Query: 661  DGSVAE 666
             G VAE
Sbjct: 1498 KGEVAE 1503

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 129/533 (24%), Positives = 242/533 (45%), Gaps = 62/533 (11%)

Query: 220 DNNKVGDLISRLSSDAYVVSRSLTQKV----SDGFKAMLCGSVGIGMMISISPQLSAFLL 275
           D +  GD+++ +S D   + + LTQ      S  F+ +LC    +  ++  S  +   +L
Sbjct: 399 DLSSTGDVVNLMSVDVQRL-QDLTQWCNIIWSGPFQIILC-LFSLYKLLGHSMWVGVIVL 456

Query: 276 FLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNH 335
            +  P+    SY  R+ +   +   +     T+V  E  + IK+++ +  EQ   ++  H
Sbjct: 457 IVMIPL---NSYLMRIQKQLQKVQMKYKDERTRVINEILNNIKSLKLYAWEQPYKEKLEH 513

Query: 336 A-----IRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAY 390
                 ++++  +G  +A  N +F +L   L   S   V  Y     L   L    LT +
Sbjct: 514 VRNEKELKNLTRIGVFNAMTNFQF-NLVPFLVSCSTFAVFVYIEDKPLTTDLVFPALTLF 572

Query: 391 MMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL-------TDRIPSISPTLGKKFVPNK 443
            + T      +  L    +  ++ + + SRLF         TD I  + P      V  +
Sbjct: 573 NLLT----FPLAALPIVITAFIEASVSMSRLFSFMTNEELQTDAIQRLPP------VKKQ 622

Query: 444 GEIEFK---NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYN 499
           G+I      N +F +  +   ++  KN+ F+   G   CIVG  G GKS     +L    
Sbjct: 623 GDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGELACIVGKVGSGKSAFIQSIL---- 678

Query: 500 PTTGQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSI 558
              G +F V G         ++  +++ V Q P +M+GT++DNI +G   K  Q+     
Sbjct: 679 ---GDLFRVKG-------FATIHGNVAYVSQLPWIMNGTVKDNILFG--HKYNQEFYEKT 726

Query: 559 TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            + C     ++  P+   T++G  G  LSGGQK R+++ARA+  +  + +LD+  +A+D 
Sbjct: 727 LRACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDPLAAVDE 786

Query: 619 E-SEGAINYTFGK--LMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYA 675
             S+  I +  G   L+ +K  T +   +++S +  ++N+ +L +DG + + G + E+  
Sbjct: 787 HVSKHLIQHVIGPNGLLHTK--TRVLATNKISVLSIADNITLL-DDGEIVQQGTYNEVTD 843

Query: 676 DPGSELSKLLHEKATRSERQQNTAEDQEIDPEE---TINIENSTPESDITQEL 725
           +  S L KL+ E   ++    +T  +  + P+E   ++N EN+ P     +EL
Sbjct: 844 NINSPLCKLISEYGNKNNVNSSTDTESTMTPKESSTSLNRENTVPVETELKEL 896

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 137/483 (28%), Positives = 228/483 (47%), Gaps = 27/483 (5%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D + V   L +  +  F   +  S  I   I I      F+L +
Sbjct: 1026 FFETTPIGRILNRFSNDIFKVDELLGRTFAQFFVNAIKVSFTI---IVICFSTWQFILVI 1082

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
             P   L   Y    +R  SR+L+    S+T+       +E   GI T++ +  +QK    
Sbjct: 1083 LPMGTLYIYYQQYYLRT-SRELRR-LDSVTRSPIYAHFQETLGGISTIRGY-NQQKRFVH 1139

Query: 333  YNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL---HGSLSIGDLTA 389
             N A R   N+      +NA  + L   L  +  +++LA  S  VL    G+L+ G +  
Sbjct: 1140 INQA-RVDNNMSAYYPSVNANRW-LAFRLEFIGSVIILAASSLSVLRLKQGALTPGMIGL 1197

Query: 390  YMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFE---LTDRIPS-ISPTLGKKFVPNKGE 445
             + Y      S+  +     E+     +  R+ E   L    P+ I      +  P++G 
Sbjct: 1198 SVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANLESEAPAVIESNRPSEDWPSQGS 1257

Query: 446  IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
            I+F+N S  Y       + K+++  I     + IVG +G GKS++   L R     +G+I
Sbjct: 1258 IKFENYSARYRPELELSL-KDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIEAASGRI 1316

Query: 506  FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
            ++DG  I  +  + LR H+SI+ Q+  L  GTIR+NI      + T +++    +     
Sbjct: 1317 YIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENI--DPTNEYTDEQIWRALELSHLK 1374

Query: 566  NFITKF-PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
            + +        D  L   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I
Sbjct: 1375 DHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDQVI 1434

Query: 625  NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKL 684
              T     K++  TI++IAHR++TI  S+ ++VL + G VAE      L  +P S    L
Sbjct: 1435 QETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNPESLFYSL 1491

Query: 685  LHE 687
             +E
Sbjct: 1492 CYE 1494

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 127/286 (44%), Gaps = 41/286 (14%)

Query: 437 KKFVPNKGEIEFK---NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIAS 492
           K  V  KGE+      + +F +  +   ++  KN++F    G   C+VG  G GKS +  
Sbjct: 605 KSKVTKKGEVAVNVGADATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQ 664

Query: 493 LLLRYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPT 551
            +L       G +F V G         S+   ++ V Q P +M+GT++DNI +G   K  
Sbjct: 665 AIL-------GDLFRVKG-------FASVHGSIAYVSQVPWIMNGTVKDNILFG--HKYD 708

Query: 552 QDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
           +       K C     +   P    T++G  G  LSGGQK R+++ARA+  +    +LD+
Sbjct: 709 ESFYTMTLKACALIVDLAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDD 768

Query: 612 ATSALDVE-SEGAINYTFG---------KLMKSKSITIISIAHRLSTIRRSENVIVLGND 661
             +A+D   ++  + +  G         K++ +  IT++SIA            I L  +
Sbjct: 769 PLAAVDEHVTKHLVEHVLGPNGLLASKTKVLATNKITVLSIADH----------IALLEN 818

Query: 662 GSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEIDPE 707
           G + + G + ++ +   S LSK++     + E+ +         PE
Sbjct: 819 GEIIQQGSYDDVTSAKSSALSKIISTFGKKPEKSKTGENTVATTPE 864

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 134/524 (25%), Positives = 238/524 (45%), Gaps = 38/524 (7%)

Query: 159  PEIAFGLNLYEFISLVGVSL--LVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDA 216
            P +A  L +Y F+  +G SL  L+ +A      IL    S      L  +++   +    
Sbjct: 964  PNVALYLGVY-FMFGLGASLSTLIQSA------ILWIYCSIHASVYLHESMLAAVLRAPM 1016

Query: 217  EFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLF 276
             FF+   +G +++R S+D Y V   L +  S  F      S  I ++   + Q + F++ 
Sbjct: 1017 SFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSFTIIVICVTTWQFTFFVI- 1075

Query: 277  LTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIK 331
               P+ +   Y+ +     SR+L+    S+TK       +E  +G+ +++ +     ++ 
Sbjct: 1076 ---PLAMLYIYYQQYYLKTSRELRR-LDSVTKSPVYAHFQETLNGVSSIRGY----GQLD 1127

Query: 332  RYNHAIRHIFNVGKQSAF----INAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDL 387
            R+ H  +   N    + +    +N         +G            + +  GSL+ G +
Sbjct: 1128 RFIHINQARINNNTSAYYPSMNVNRWLAYRLEFIGSCIIFFAATLSVFRLASGSLTSGMV 1187

Query: 388  TAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS----ISPTLGKKFVPNK 443
               + Y      S+  +     E+     +  R+ E  +  P     I+ ++     P  
Sbjct: 1188 GLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAPQFIANSVPSGDWPKD 1247

Query: 444  GEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTG 503
            GEI+F+N S  Y     + I + ++  I     V IVG +G GKS++A  L R      G
Sbjct: 1248 GEIKFENYSTRYRP-GLDLILRGINLHIKPHERVGIVGRTGAGKSSLALSLFRIIEAAEG 1306

Query: 504  QIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCF 563
             I +DG  I  +    LR+ +SI+ Q+  +  GT+RDNI     ++ T +++    +   
Sbjct: 1307 HISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNI--DPTKQYTDEQIWKALELSH 1364

Query: 564  CHNFITKF-PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
              + +     +  DT L   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++ 
Sbjct: 1365 LADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILVLDEATAAIDVETDK 1424

Query: 623  AINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
             I  T       +  TI++IAHR++TI  S+ ++VL + G+VAE
Sbjct: 1425 VIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTVAE 1465

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 120/515 (23%), Positives = 234/515 (45%), Gaps = 58/515 (11%)

Query: 207 VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQK----VSDGFKAMLCGSVGIGM 262
           + KK +H   E    +  GD+++ +S DA  + R LTQ      S  F+  LC    +  
Sbjct: 366 IYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLC-LYSLHR 423

Query: 263 MISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQS 322
           ++     +   LL  T P+    SY  R+++   ++  +     T++  E  + IK+++ 
Sbjct: 424 LLGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNNIKSLKL 480

Query: 323 FVAE-----QKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLV 377
           +  E     + +  R    ++ +  +G  +AF N ++  +  ++   +F V +       
Sbjct: 481 YAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFLVSCSTFAVFVLTQKGRP 540

Query: 378 LHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLF------ELTDRIPSI 431
           L   L    LT + + +         +++F    ++ + A  RL       EL     + 
Sbjct: 541 LTTDLVFPALTLFNLLSFPLAVLPIAITSF----IEASVAIGRLTNFLTAEELQRDAITR 596

Query: 432 SPTLGKKFVPNKGEIEFK-NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKST 489
            P +     P    +    N +F +  +   ++  KN++F+       CI+G  G GKS 
Sbjct: 597 EPAVK---APGGVAVALADNATFLWQRKPEYKVALKNINFRAKKSELTCIIGKVGSGKSA 653

Query: 490 IASLLLRYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVE 548
           +   +L       G +F V+G       S  +R +++ V Q   +M+GT+RDNI +G   
Sbjct: 654 LIQAML-------GDLFRVNG-------SAVVRGNVAYVSQVAWIMNGTVRDNILFG--H 697

Query: 549 KPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI 608
           K      +   K C     ++  P+  +T +G  G  LSGGQK R+++ARA+  +    +
Sbjct: 698 KYDAKFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARADTYL 757

Query: 609 LDEATSALDVE-SEGAINYTFGK--LMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVA 665
           LD+  +A+D   ++  +   FG   L+KSK+  + +  ++++ +  ++++++L N G + 
Sbjct: 758 LDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIADHIVLLEN-GEIV 814

Query: 666 EVGKFKELYADPGSELSKL-LHEKATRSERQQNTA 699
           + G F E+ +D  S +SKL LH       ++QN A
Sbjct: 815 QQGTFSEVISDEDSAISKLVLHHG-----KKQNGA 844

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 134/500 (26%), Positives = 223/500 (44%), Gaps = 58/500 (11%)

Query: 203 LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVG-IG 261
           L    +K  +H    F D   +G +++R + D   +   LT+ +       L   +G I 
Sbjct: 482 LNLKAVKGILHTPLSFMDTTPLGRILNRFTKDTDSMDNELTEDIR-LMMFQLGNIIGVIV 540

Query: 262 MMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321
           M I   P  +  + FL    ++ A ++    R   R        +     E   G+ T++
Sbjct: 541 MCIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEVLGGLDTIR 600

Query: 322 SFVAEQKEIKRYNHAIRHIFNVGKQSAFIN---AKFFSLTAVLGDMSFLVVLAYGSYLVL 378
           ++ ++ + + + +  I  +   G   A +    A F  + AV+   + ++ L   +    
Sbjct: 601 AYRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVI--FALIITLLCVTRQFK 658

Query: 379 HGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLF--------ELTDRIPS 430
               S G L  Y++      +++    T   +   G  +A RL         E   R P 
Sbjct: 659 ISPSSTGVLLTYVLQLPGLLNTVLRALT---QAENGMNSAERLVTYALDLPQEAEYRRPE 715

Query: 431 ISPTLGKKFVPNKGEIEFKNVSFSY-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKST 489
           +SP    +  P++GEI+F+ VSF+Y P+     + KN S  I +G  + I G +G GKST
Sbjct: 716 MSPP---ENWPDRGEIKFEGVSFAYRPSLPP--VLKNFSLNIGSGEKIGICGRTGAGKST 770

Query: 490 IASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT-YGLVE 548
           I S L R      G+IF+D  +I+ +    LR  ++I+ Q+PVL  GTI+ N+  +G  E
Sbjct: 771 IMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFG--E 828

Query: 549 KPTQDEVRSITK------------------KCFCHNFITKFPNSYDTILGPHGTLLSGGQ 590
           K  Q+   S+ +                      H+ + KF    +  +   G   S G+
Sbjct: 829 KTDQELWESLVRGGAIAPEDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLGE 886

Query: 591 KQRIAIARALIKKPTILILDEATSALDVESEGAIN----YTFGKLMKSKSITIISIAHRL 646
           KQ +A+ RAL++   ILILDEATS++D E++  I       FG        TI+ IAHRL
Sbjct: 887 KQLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFG------DCTILCIAHRL 940

Query: 647 STIRRSENVIVLGNDGSVAE 666
           +TI   + ++VL   G VAE
Sbjct: 941 NTILNYDRILVL-EQGEVAE 959

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 121/246 (49%), Gaps = 23/246 (9%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F+NL+F I  G  + + GP G GK+++ S +  +   + G + V+G+ +S          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQD-EVRSITKKCFCHNFITKFPNSYDTILGPH 582
                  P + + T+RDNI +G    P +  + R + K C   + +   P    T +G  
Sbjct: 156 ----CGYPWIQNATVRDNIIFG---SPYEKAKYRKVIKACSLDSDLEILPAGDMTEIGER 208

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIIS 641
           G  LSGGQK RI +AR + K   I + D+  SA+D    +  ++     L+  K  T I 
Sbjct: 209 GINLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK--TRIL 266

Query: 642 IAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAED 701
             H+L+ I ++  +IVLGNDGS   +G ++EL     S+L KLL   + +SE   N  + 
Sbjct: 267 ATHQLALIEKATRLIVLGNDGSFT-IGTYEEL-QKSNSQLKKLLQFTSDKSEEDDNDQKQ 324

Query: 702 QEIDPE 707
            E D E
Sbjct: 325 NENDKE 330

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  129 bits (324), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 128/498 (25%), Positives = 232/498 (46%), Gaps = 27/498 (5%)

Query: 203  LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGM 262
            L A +          FF+   +G +++R S+D + V   L +  S     ++  S  I +
Sbjct: 1032 LHAGMANSVFRAPMRFFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNVIKVSFTIIV 1091

Query: 263  MISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGS----LTKVAEEQFSGIK 318
            +   + Q + F++    P+ +   Y+ +     SR+L+    +    +    +E   G+ 
Sbjct: 1092 ICFTTWQFTLFVI----PLGILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLS 1147

Query: 319  TVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL 378
            T++ +  +Q+     N + R   N+      +NA  + L   L  +  +++    S  +L
Sbjct: 1148 TIRGY-NQQRRFIHINQS-RMDNNMSAYYPSVNANRW-LAYRLEFIGTIIIFGASSLSIL 1204

Query: 379  H---GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTL 435
                GSL+ G +   + Y      S+  +     E+     +  R+ E ++ IPS +P L
Sbjct: 1205 RLKSGSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-IPSEAPYL 1263

Query: 436  --GKKFVPN---KGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTI 490
               ++  PN    G I+F++ S  Y     + I K+++  I     + IVG +G GKS++
Sbjct: 1264 IEDRRPSPNWPTDGAIQFQHYSTRYRP-GLDLILKDINLDIKPKEKIGIVGRTGAGKSSL 1322

Query: 491  ASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP 550
               L R      G+I +DG  I ++    LR  +SI+ Q+  +  G++R+NI     E+ 
Sbjct: 1323 TLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENI--DPTEQY 1380

Query: 551  TQDEVRSITKKCFCHNFITKFPN-SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
            + +E+  +       N +    N    T L   G  LS GQ+Q + +ARAL+    IL+L
Sbjct: 1381 SDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVL 1440

Query: 610  DEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
            DEAT+A+DVE++  +  T       +  TI++IAHRL+TI  S+ ++VL + G VAE   
Sbjct: 1441 DEATAAVDVETDKVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVL-DAGRVAEFDT 1497

Query: 670  FKELYADPGSELSKLLHE 687
             + L  +PG+    L  +
Sbjct: 1498 PENLLKNPGTMFYGLCQD 1515

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 125/529 (23%), Positives = 232/529 (43%), Gaps = 81/529 (15%)

Query: 203 LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKV----SDGFKAMLCGSV 258
           L + + KK++   +E  D +  GD+++ +S D   + + L Q      S  F+ +LC + 
Sbjct: 385 LTSVIYKKSLVLSSEAADMSSTGDIVNLMSVDVQRL-QDLAQWCHLIWSGPFQIILCLT- 442

Query: 259 GIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIK 318
            +  ++  S  +   +L +  P+    S   R+ +N  +   +     T++  E  + +K
Sbjct: 443 SLYKLLGKSMWVGVIILIVMMPL---NSSLMRVQKNLQKGQMKNKDQRTRLINEILNNMK 499

Query: 319 TVQSFVAEQK-----EIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYG 373
           +++ +  E+      E  R    ++++  +G  +A IN +F ++       S   V  Y 
Sbjct: 500 SLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQF-NIVPFFVSCSTFAVFVYT 558

Query: 374 SYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTF--------YSEIMQGAGAASRLFEL- 424
               L   L    LT            +FGL +F         +  ++ + +  RL+   
Sbjct: 559 EDRPLTTDLVFPALT------------LFGLLSFPLAVVPLVLNSYIEASVSIGRLYSFL 606

Query: 425 ---------TDRIPSISPTLGKKFVPNKGEIEFK---NVSFSYPTRASNQI-FKNLSFKI 471
                      R+P          V N G++  K   N +F +  +   ++  KN++F+ 
Sbjct: 607 TNEELQRDSVQRLPR---------VKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQA 657

Query: 472 DAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIVQQE 530
             G   C+VG  G GKS +   LL       G +F V G         ++  +++ V Q 
Sbjct: 658 KKGELNCVVGRVGSGKSALIQSLL-------GDLFRVKG-------FATVHGNIAYVSQV 703

Query: 531 PVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQ 590
             +M+GT++DNI +G    P   E     K C     +   P+   TI+G  G  LSGGQ
Sbjct: 704 AWIMNGTVKDNILFGHKYDPEFYE--KTIKACALTIDLAILPDGDKTIVGEKGISLSGGQ 761

Query: 591 KQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGK--LMKSKSITIISIAHRLS 647
           K R+++ARA+  +  I +LD+  +A+D   S   I++  G   L+K+K  T I   +++S
Sbjct: 762 KARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTK--TKILATNKIS 819

Query: 648 TIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQ 696
            +  +++V +L N G + + G F E+     S LSKL+ E   +  + +
Sbjct: 820 ALSIADSVTLLEN-GEIIQQGTFCEITKAADSPLSKLIKEYGKKKHKSE 867

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  129 bits (323), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 137/518 (26%), Positives = 244/518 (47%), Gaps = 47/518 (9%)

Query: 173  LVGVSLLVGTA-ANYGRVILLRVL-----SERVVARLRANVIKKTMHQDAEFFDNNKVGD 226
            ++ ++L VG+A A   + I+L V      S+ +   + ++V+K  M     FF+   +G 
Sbjct: 996  MIYLALGVGSALATLIQTIVLWVFCTIHGSKYLHDAMASSVLKAPM----SFFETTPIGR 1051

Query: 227  LISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSAS 286
            +++R S+D Y V   L +  +  F  ++  S  I ++   + Q     +F+  P+ +   
Sbjct: 1052 ILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVVICMATWQF----IFIVLPLSVLYI 1107

Query: 287  YFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIK----RYNHAI 337
            Y+ +     SR+L+    S+T+       +E   G+ T++ +  + + +     R ++ +
Sbjct: 1108 YYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGLTTIRGYSQQNRFVHINQTRVDNNM 1166

Query: 338  RHIF---NVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYT 394
               +   N  +  AF   +F     +L   S L V+  G     +G+L+ G +   + + 
Sbjct: 1167 SAFYPSVNANRWLAF-RLEFIGSVIILA-ASMLAVIRLG-----NGTLTAGMIGLSLSFA 1219

Query: 395  EYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF-----VPNKGEIEFK 449
                 S+  +     E+     +  R+ E  + + S +P + K        P  GEI+F 
Sbjct: 1220 LQITQSLNWIVRMTVEVETNIVSVERIKEYAE-LKSEAPYIIKDHRPPASWPESGEIKFV 1278

Query: 450  NVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDG 509
            N S  Y       I K++   I     + IVG +G GKS++   L R     +G I +DG
Sbjct: 1279 NYSTRYRPEL-ELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIEAASGHIVIDG 1337

Query: 510  QDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFIT 569
              I  +    LR  +SI+ Q+  +  GT+R+NI      + T +E+ +        + I 
Sbjct: 1338 IPIDSIGLADLRHGLSIIPQDSQIFEGTVRENI--DPTNRYTDEEIWNALALSHLKDHIL 1395

Query: 570  KF-PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
                N  +T+L   G+ LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  T 
Sbjct: 1396 GMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVDVETDQLIQKTI 1455

Query: 629  GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
                K +  TI++IAHR++TI  S+ +IVL + G V E
Sbjct: 1456 RNAFKER--TILTIAHRINTIMDSDRIIVL-DKGRVTE 1490

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 101/401 (25%), Positives = 179/401 (44%), Gaps = 51/401 (12%)

Query: 307 TKVAEEQFSGIKTVQSFVAEQKEIKRYNHA-----IRHIFNVGKQSAFINAKFFSLTAVL 361
           T+V  E  + IK+++ +  E     + +H      ++++  +G   A  N +F ++   L
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQF-NIVPFL 540

Query: 362 GDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRL 421
              S   V  Y     L   L    LT + + +         +S+F    ++ + + +RL
Sbjct: 541 VSCSTFAVFVYTEERPLSTDLVFPALTLFNLLSFPLAVVPNAISSF----IEASVSINRL 596

Query: 422 FE-LTDRIPSISPTLGKKFVPNKGE--IEFKNVSFSYPTRASNQI-FKNLSFKIDAGSNV 477
           F  LT+        L +  V N G+  ++  + +F +  +   ++  KN++F    G   
Sbjct: 597 FAFLTNEELQNDAVLREPKVKNIGDEGVKVNDATFLWQRKPEYKVALKNINFVAKKGELT 656

Query: 478 CIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGT 537
           CIVG  G GKS +   LL       G   V G D++ VS            Q P +M+GT
Sbjct: 657 CIVGKVGSGKSALIQSLLGDLIRVKGFATVHG-DVANVS------------QVPWIMNGT 703

Query: 538 IRDNITYGLVEKPTQDEVRSIT-KKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAI 596
           ++DNI +G    P   E   +T K C     ++  P+   T++G  G  LSGGQK R+++
Sbjct: 704 VKDNILFGHKYDP---EFYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSL 760

Query: 597 ARALIKKPTILILDEATSALDVE-SEGAINYTFG---------KLMKSKSITIISIAHRL 646
           ARA+  +    +LD+  +A+D   ++  I +  G         K++ +  IT++SIA   
Sbjct: 761 ARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA--- 817

Query: 647 STIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
                  + I L  +G + + G + ++     S LSKL+ E
Sbjct: 818 -------DSITLMENGEIIQQGSYDQVNESTNSPLSKLIAE 851

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 130/479 (27%), Positives = 232/479 (48%), Gaps = 35/479 (7%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  +  F  +   S  I ++   + Q     +FL
Sbjct: 1042 FFETTPIGRILNRFSNDIYKVDELLGRTFAQFFVNVTKVSFTIIVICVTTWQF----IFL 1097

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+++   Y+ +     SR+L+    S+TK       +E   G+ T++ +  +Q++  R
Sbjct: 1098 ILPMIVLYVYYQQYYLRTSRELRR-LDSVTKSPVYAHFQESLGGLSTIRGY--DQQD--R 1152

Query: 333  YNHAIRHIFNVGKQSAF---INAKFFSLTAVLGDMSFLVVLAYGSYLVLH---GSLSIGD 386
            + H  +   +    SAF   +NA  + L   L  +  +++    S  +L    GSL+ G 
Sbjct: 1153 FTHINQSRID-NNMSAFYPSVNANRW-LAFRLEFIGTIIIFGAASLSMLRLKAGSLTPGM 1210

Query: 387  LTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKF-----VP 441
            +   + Y      S+  +     E+     +  R+ E ++ I S +P + +        P
Sbjct: 1211 IGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-IKSEAPLVIEDHRPPADWP 1269

Query: 442  NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
            +KG+I+F++ S  Y     N + K+++  +     + IVG +G GKS++   L R     
Sbjct: 1270 SKGDIKFEHYSTRYRENM-NLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAA 1328

Query: 502  TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561
             G+I +DG  I+++    LR  +SI+ Q+  +  GT+R+NI      + + +E+  + + 
Sbjct: 1329 EGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENI--DPTNQYSDEEIWRVLEL 1386

Query: 562  CFCHNFITKF-PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                N +     +   T L   G  LS GQ+Q + +ARAL+    ILILDEAT+A+DVE+
Sbjct: 1387 SHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVET 1446

Query: 621  EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGS 679
            +  I  T     K +  TI++IAHRL+TI  S+ ++VL + G V E    + L    GS
Sbjct: 1447 DQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVREFDTPENLLKQQGS 1502

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 117/258 (45%), Gaps = 39/258 (15%)

Query: 444 GEIEFK---NVSFSYPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYN 499
           G++  K   + +F +  +   Q+  KN++ ++  G   C+VG  G GKS +   LL    
Sbjct: 627 GDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLLGDLY 686

Query: 500 PTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSIT 559
              G   V G               + V Q P +M+GT++DNI +G    P   ++    
Sbjct: 687 RVKGYAAVHGS-------------TAYVSQVPWIMNGTVKDNILFGHKYDPVFYDL--TI 731

Query: 560 KKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           K C     +   P+   T++G  G  LSGGQK R+++ARA   +    +LD+  +A+D  
Sbjct: 732 KACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVDEH 791

Query: 620 -SEGAINYTFG---------KLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
            ++  I +  G         KL+ +  IT++SIA  +S +            G + + G 
Sbjct: 792 VAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE----------GGEIIQHGS 841

Query: 670 FKELYADPGSELSKLLHE 687
           ++++  D  S LS L+ E
Sbjct: 842 YEDISKDLDSPLSNLVKE 859

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 135/507 (26%), Positives = 222/507 (43%), Gaps = 46/507 (9%)

Query: 202  RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
            RL    +++ +H    F D   +G +++R + D   V   LT+ V   F   L   VG+ 
Sbjct: 975  RLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVR-LFVFQLSNIVGVI 1033

Query: 262  MMISIS-PQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTV 320
            +M  I  P  +  + FL    +  A ++    R   R        +     E   G+ T+
Sbjct: 1034 VMCIIYLPWFAIAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTI 1093

Query: 321  QSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSF-LVVLAYGSYLVLH 379
            +++  E++ + + +     +   G     I  ++ ++   +  M+F L+V         H
Sbjct: 1094 RAYRGERRFLTKSDFLTNKMNEAGYLVVAIQ-RWVAIALDMIAMAFALIVTLLCVTRQFH 1152

Query: 380  -GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAG---AASRL--------FELTDR 427
              + S+G L  Y++  +  G     L+     + QG     +  RL         E   R
Sbjct: 1153 ISAASVGVLLTYVL--QLPGL----LNMLLRAMTQGENDMNSTERLISYATELPLEAAYR 1206

Query: 428  IPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGK 487
             P +SP       P  G IEF +VS +Y       + K+++  + AG  + I G +G GK
Sbjct: 1207 RPEMSPPAE---WPTDGRIEFDHVSLAYRP-GLPLVLKDVTLHVAAGEKIGICGRTGAGK 1262

Query: 488  STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIR-------- 539
            STI S L R      G I +DG DIS +    LR  +SI+ Q+PV+  G +R        
Sbjct: 1263 STIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHE 1322

Query: 540  ---DNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH----GTLLSGGQKQ 592
               D + + LV           T +   H       N +   L       GT  S G++Q
Sbjct: 1323 RTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGERQ 1382

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKS-ITIISIAHRLSTIRR 651
             +A+ RAL+++  ILILDEATS++D E++  I     +++++ S  TI+ IAHRL+TI  
Sbjct: 1383 LLALTRALVRQSKILILDEATSSVDYETDAKIQ---TRIVEAFSNCTILCIAHRLNTILD 1439

Query: 652  SENVIVLGNDGSVAEVGKFKELYADPG 678
             + ++VL + G V E      LYA  G
Sbjct: 1440 YDRILVL-DQGRVCEFDTPAALYARGG 1465

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 120/268 (44%), Gaps = 27/268 (10%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F NL+ +I  G  V + G  G GKS++   L  +   T G I+ DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGT------------- 649

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR--SITKKCFCHNFITKFPNSYDTILGP 581
             ++   P + + T+RDNI +G       +E R   I + C     +   P    T +G 
Sbjct: 650 -MLLCGYPWIQNATVRDNILFG----SPYNEARYNEIIRVCSLQADLELLPAGDRTEIGE 704

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGKLMKSKSITI 639
            G  LSGGQK RI +ARA+ KK  I + D+  SA+D      I      GKL  S   T 
Sbjct: 705 RGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TR 761

Query: 640 ISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTA 699
           +   H+LS I R+  VI +  DGSV +VG  +EL       ++ + +   + SE++    
Sbjct: 762 VLATHQLSLIARASKVIYIDLDGSV-DVGSVEELKKRKPGFVNLMQYSNHSESEKKPGEV 820

Query: 700 EDQEIDPEETINIENSTPESDITQELLE 727
           E+++   E     +   PE D  Q  LE
Sbjct: 821 EEEK-RQEAGAGAQPVRPEIDSRQSELE 847

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 123/470 (26%), Positives = 226/470 (48%), Gaps = 43/470 (9%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  S  F      +V +   I +    +   +F+
Sbjct: 1062 FFETTPIGRILNRFSNDIYKVDSILGRTFSQFF----VNTVKVLFTIGVIAYTTWQFVFV 1117

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAEQKEIKR 332
              P+ +   Y+ +     SR+L+    S+T+       +E   G+ T++ +  +QK  + 
Sbjct: 1118 IVPLGIFYIYYQQYYLRTSRELRRLE-SVTRSPIFSHFQETLGGLATIRGY-GQQKRFEH 1175

Query: 333  YNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLH---GSLSIGDLTA 389
             N   R   N+      INA  + L   L  +  +++L   +  +     G+++ G +  
Sbjct: 1176 INEC-RVDNNMSAFYPSINANRW-LAYRLEFIGSVIILGAATLSIFKLRAGTMTAGMIGL 1233

Query: 390  YMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGK-----KFVPNKG 444
             + Y      ++  +     E+     +  R+ E ++ + S +P + +     K  P  G
Sbjct: 1234 SLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSE-LKSEAPLVIESNRPPKEWPVAG 1292

Query: 445  EIEFKNVSFSYPTRAS---NQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
            EI+F++    Y TR     + + K+++ +I     + IVG +G GKS++   L R    T
Sbjct: 1293 EIKFEH----YYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEAT 1348

Query: 502  TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQ-----DEVR 556
            +G I +DG  I+++    LR H+SI+ Q+  +  GTIR+NI       PT      D  R
Sbjct: 1349 SGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENI------DPTNQFTDADIWR 1402

Query: 557  SITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            ++       + +    +   T++   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+
Sbjct: 1403 ALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAV 1462

Query: 617  DVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            DVE++  I  T     K +  TI++IAHR++TI  ++ +IVL + G V E
Sbjct: 1463 DVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVE 1509

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 125/548 (22%), Positives = 236/548 (43%), Gaps = 62/548 (11%)

Query: 199 VVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKV----SDGFKAML 254
           V + L + + +K +    E  + +  GD+++ +S D   + + LTQ +    S   + +L
Sbjct: 396 VKSALTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKL-QDLTQWIHLIWSGPLQIVL 454

Query: 255 CGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQF 314
           C  + +  ++  S  +   +L +  PV    S+  ++ +N  +   +     T+V  E  
Sbjct: 455 C-LISLYKLLGHSMWVGVLILTIMIPV---NSFLMKIQKNLQKSQMKFKDERTRVISEIL 510

Query: 315 SGIKTVQSFVAEQ--KEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAV--LGDMSFLVVL 370
           + +K+++ +  EQ  KE   Y    + + N+ K   ++    F    V  L   S   V 
Sbjct: 511 NNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLVSCSTFAVF 570

Query: 371 AYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFEL------ 424
            Y     L   L    LT + + +      +  +    + I++ + + SRLF        
Sbjct: 571 VYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNEEL 626

Query: 425 ----TDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQI-FKNLSFKIDAGSNVCI 479
                 R+P +   +G   V N G+    N +F +  +   ++  KN++++   G   CI
Sbjct: 627 QKDAVQRLPKVKE-IGDVAV-NVGD----NATFLWKRKPEYKVALKNINYQAKKGELSCI 680

Query: 480 VGPSGRGKSTIASLLLRYYNPTTGQIF-VDGQDISKVSSKSLRRHMSIVQQEPVLMSGTI 538
           VG  G GKS     LL       G +F V G         ++   ++ V Q   +M+GT+
Sbjct: 681 VGKVGSGKSAFLQSLL-------GDLFRVKG-------FATIHGSVAYVSQVAWIMNGTV 726

Query: 539 RDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIAR 598
           RDN+ +G    P   E     K C     +    +   T++G  G  LSGGQK R+++AR
Sbjct: 727 RDNVLFGHKYDPEFYE--KTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLAR 784

Query: 599 ALIKKPTILILDEATSALDVE-SEGAINYTFGK--LMKSKSITIISIAHRLSTIRRSENV 655
           A+  +    +LD+  +A+D   S   + +  G   L+ SK  T I   +++S +  ++++
Sbjct: 785 AVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSK--TRILATNKISVLSAADSI 842

Query: 656 IVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQN-----TAEDQEIDPEETI 710
            +L N G + + G + +   D  S L KLL E   +  +  +     ++     D E T+
Sbjct: 843 TLLEN-GEITQQGTYADCRKDEESALGKLLKEFGRKESKNDDTITSSSSAVSISDKEPTV 901

Query: 711 NIENSTPE 718
            +E+   E
Sbjct: 902 PLEDELEE 909

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 128/524 (24%), Positives = 230/524 (43%), Gaps = 56/524 (10%)

Query: 203  LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGM 262
            L    +K+ +H    F D   +G +++R + D   +   L + V     +     VG+ +
Sbjct: 968  LNIQALKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTV-SQFANIVGVCV 1026

Query: 263  M-ISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321
            M I   P  +  + FL    +   +++    R   R        +     E   G+ T++
Sbjct: 1027 MCIVYLPWFAIAVPFLVFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFNEILGGMDTIK 1086

Query: 322  SFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL--- 378
             + +E++ I + ++ I  +     ++ ++        A+L DM   + +A+   + L   
Sbjct: 1087 FYKSEERYIAKSDYLIDKM----NEAGYLTVCVQRWVAILVDM---IAVAFALIITLLCV 1139

Query: 379  ----HGSLS-IGDLTAYMMYTEYTGSSIFG-LSTFYSEIMQGAGAASRLFELTDRIP--- 429
                H S S +G L  Y++        +F  L    S++     +  RL      +P   
Sbjct: 1140 TRQFHISASSVGVLLTYVLQL----PGLFNTLLRAVSQVENDMNSTERLVSYATDLPLEA 1195

Query: 430  --SISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGK 487
                  T   +  P +G I+F+NV F+Y       + KN++ +I+    + I G +G GK
Sbjct: 1196 QYHKPETAPPESWPEEGTIKFENVDFAYRPGLP-IVLKNINLQINGTEKIGICGRTGAGK 1254

Query: 488  STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT---- 543
            STI + L R    T+G I +D  DI+K+    LR+ ++I+ Q+PVL  G IR N+     
Sbjct: 1255 STIMTALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHE 1314

Query: 544  ------YGLV--------EKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGG 589
                  + ++        E   + + + IT+     + + KF    D ++   G   S G
Sbjct: 1315 RTDEELWDVLVRGGAIAPEDLAETKAQHITEDGTSAD-LHKF--HLDKVVEEDGANFSLG 1371

Query: 590  QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTI 649
            ++Q +A+ RAL++   ILILDEATS++D E++  I             TI+ IAHRL TI
Sbjct: 1372 ERQILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTI 1429

Query: 650  RRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSE 693
               + ++VL + G VAE      L+ D     + + H    +S+
Sbjct: 1430 LNYDRILVLEH-GEVAEFDTPMNLFKDE----TTIFHNMCKKSD 1468

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 107/206 (51%), Gaps = 20/206 (9%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F NL+F+I  G  V I GP G GK+++ +    +   T+G I ++G              
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQINGD------------- 658

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHG 583
             ++   P + + T+RDNI +G      +D+ + + + C   + +   P    T +G  G
Sbjct: 659 -LLMGGYPWIQNATVRDNIIFG--SPYEEDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIISI 642
             LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++    KL+ +K  T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNK--TRLLA 773

Query: 643 AHRLSTIRRSENVIVLGNDGSVAEVG 668
            H+LS I ++  +IVLGNDGSV E+G
Sbjct: 774 THQLSLIDKASRIIVLGNDGSV-EIG 798

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  123 bits (309), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 121/466 (25%), Positives = 213/466 (45%), Gaps = 35/466 (7%)

Query: 218  FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277
            FF+   +G +++R S+D Y V   L +  S  F   +  S  I ++ S + Q     +F+
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAVKVSFTIIVICSSTWQF----VFV 1075

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQFSGIKTVQSFVAE------ 326
              P+     Y+ +     SR+L+    S+T+       +E   GI T++ +  +      
Sbjct: 1076 IIPLGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTIRGYQQQGRFLHI 1134

Query: 327  -QKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIG 385
             Q  +     A     N  +  AF   +F     +LG  +  V      + +  G+L+ G
Sbjct: 1135 NQARVDNNMSAFYPSVNANRWLAF-RLEFIGSIIILGAATLSV------FRLKQGALTPG 1187

Query: 386  DLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS----ISPTLGKKFVP 441
             +   + Y      S+  +     E+     +  R+ E  +  P     I      +  P
Sbjct: 1188 MIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPAEDWP 1247

Query: 442  NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
              G I+F+N S  Y       + +N++  I     + IVG +G GKS++   L R     
Sbjct: 1248 THGAIKFENYSARYRPELDLSL-RNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAA 1306

Query: 502  TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561
             G+I +DG     +  + LR H+SI+ Q+  +  GT+R+NI      + T +E+    + 
Sbjct: 1307 EGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENID--PTNEYTDEEIWHALEL 1364

Query: 562  CFCHNFITKF-PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                + I     +  +++L   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE+
Sbjct: 1365 AHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVET 1424

Query: 621  EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            +  I  T     K++  TI++IAHR++TI  S+ ++VL + G +AE
Sbjct: 1425 DQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAE 1467

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 132/271 (48%), Gaps = 48/271 (17%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIF-VDGQDISKVSSKSLRR 522
            KN++F+   G   CIVG  G GKS +   +L       G +F V G         S+  
Sbjct: 631 LKNINFQAKKGELTCIVGKVGSGKSALIQGIL-------GDLFRVKG-------FASVHG 676

Query: 523 HMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH 582
            ++ V Q P +M+GT+++NI +G   K   D   +  + C     ++  P   +T++G  
Sbjct: 677 SIAYVSQVPWIMNGTVKENILFG--HKYDADFYDTTLRACALAVDLSILPKGDETLVGEK 734

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFG---------KLM 632
           G  LSGGQK RI++ARA+  +    +LD+  +A+D   ++  I +  G         K++
Sbjct: 735 GISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVL 794

Query: 633 KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRS 692
            +  I+++SIA  +S          L  +G + + G ++E+ +D  S LSK++   A   
Sbjct: 795 ATNKISVLSIADHIS----------LLENGEIIQQGSYEEVTSDKSSALSKII---ANYG 841

Query: 693 ERQQNTAEDQEIDPEETINIENSTPESDITQ 723
           ++Q     D+        + E+STP+S++ +
Sbjct: 842 KKQTKGKGDE--------SPESSTPDSEVAE 864

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 140/535 (26%), Positives = 240/535 (44%), Gaps = 49/535 (9%)

Query: 166  NLYEFISLVGVSLLVGTAANYGR-VILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKV 224
            NL+ F+ +  +  ++  A N  R +++L   S R   +L  N+    ++    FF+   +
Sbjct: 1012 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1071

Query: 225  GDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLS 284
            G +I+R S D   V   L    S  F+++L   V + ++    P    F +FL       
Sbjct: 1072 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYY 1131

Query: 285  ASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKT-VQSFVAEQKEIKRYNHAIRH-IFN 342
             +Y+       SR+L+  T S+T      +S I + +   +A    I  YNHA R   FN
Sbjct: 1132 QAYYIV----TSRELKRLT-SIT------YSPIMSLISETLAGYLVINAYNHAKRFSYFN 1180

Query: 343  VGKQSAFINAKF------FSLTAVLGDMSFLVVLAYG----SYLVLHGSLSIGDLTAYMM 392
                   I+  F        L+  L  +  L+VLA G    S +     L+ G +   M 
Sbjct: 1181 FESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMS 1240

Query: 393  YTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISP----TLGKKFVPNKGEIEF 448
            Y+    +S+  +     +I     +  R+ E  +  P        T  +K  P  G I+F
Sbjct: 1241 YSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKF 1300

Query: 449  KNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVD 508
             + S  Y  +  + +   ++ +I+    + IVG +G GKST+   L R    T G+I +D
Sbjct: 1301 IDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVID 1359

Query: 509  GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT----------YGLVE----KPTQDE 554
            G DIS +    LR +++I+ Q+     GTIR N+           +  +E    KP  + 
Sbjct: 1360 GVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLER 1419

Query: 555  V---RSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
            +   R    +    N   K  N  +  +  +G+ LS GQ+Q + ++RAL+    IL+LDE
Sbjct: 1420 IISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDE 1479

Query: 612  ATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            AT+++D+E++  I  T       +  TI++IAHR+ T+   + ++VL + G V E
Sbjct: 1480 ATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVRE 1531

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 132/268 (49%), Gaps = 29/268 (10%)

Query: 464 FKNLS-FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRR 522
           FKN++ F++  GS  CIVG  G GK+T+   +L       GQ+         +  K + R
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLIIR 696

Query: 523 HMSIVQ--QEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILG 580
             SI    Q+  +M+ ++++NI +G   K  +       + C     +   P+  +TI+G
Sbjct: 697 GNSIAYCPQQAWIMNSSVKENILFG--HKYDEHYYNLTIEACQLTEDLKMLPDGDETIVG 754

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGK---LMKSKS 636
             G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+KSK 
Sbjct: 755 EKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK- 813

Query: 637 ITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY-ADPGSELSKLLHE-------- 687
            TII   + +S ++ S+ +  L N   + E G + ++  +   S+L  L++E        
Sbjct: 814 -TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNN 871

Query: 688 -KATRSERQQNTAEDQEIDPEETINIEN 714
            K   SE ++ + E  ++ P +   IEN
Sbjct: 872 SKEEVSEERKTSEETSDVVPIDDNLIEN 899

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 125/504 (24%), Positives = 222/504 (44%), Gaps = 54/504 (10%)

Query: 207  VIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISI 266
            V+ K +H    FFD    G +++RLS D   V + L       F A++     + ++  +
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 267  SPQLSAFLLFLTPPVMLSASY--FGRLIRNNSRDLQEATGSLTKVAEEQFS----GIKTV 320
            +PQ      FL   + +   Y   G      SR+L+           + FS    GI ++
Sbjct: 1174 TPQ------FLIMAIFIGFLYALIGYFYVTTSRELKRFESITRSPIYQHFSETLVGITSI 1227

Query: 321  QSFVAEQK----EIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYL 376
            +++  E++     + R +   R  F +     +I  ++ +    L  +  LV    G ++
Sbjct: 1228 RAYGDERRFMLENLSRIDDNNRPFFYL-----WIANRWLAFRVDL--LGALVTFFSGLFI 1280

Query: 377  VLH-GSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRL---FELTDRIPSIS 432
             L+ G L  G     + Y  +           YS +     +  RL    E+     + +
Sbjct: 1281 YLNIGKLDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNEN 1340

Query: 433  PTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIAS 492
              L     P  G I+  ++S  Y      ++ KN++F ++    V IVG +G GKSTI +
Sbjct: 1341 AQLPPDNWPQHGRIDVSDLSLRYAPNLP-KVIKNVNFSVEPKLKVGIVGRTGAGKSTIIT 1399

Query: 493  LLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIR----------DNI 542
             + R+ +P TG + +D  DI+ +    LR+ ++I+ Q+P L +GT++          D  
Sbjct: 1400 AMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDKQ 1459

Query: 543  TYGLVEK-----PTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIA 597
             Y  +++      T     S          I KF +  + +    G  LS GQ+Q + +A
Sbjct: 1460 IYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLDLNNEV-TEGGANLSQGQRQLVCLA 1518

Query: 598  RALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIV 657
            R+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I   + V+V
Sbjct: 1519 RSLLRSPKIIMLDEATASIDYTSDEKIQQTIREEFRDS--TILTIAHRLKSIIDYDKVLV 1576

Query: 658  LGNDGSVAEVGKFKELYADPGSEL 681
            +       + G+ KE Y  P S L
Sbjct: 1577 M-------DAGEVKE-YDHPYSLL 1592

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 106/230 (46%), Gaps = 11/230 (4%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           + F+N + ++    S+   +N+  +   G      GP+G GKS++   LL       G+I
Sbjct: 672 LAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKI 731

Query: 506 FVDGQDISK---VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDE-VRSITKK 561
           +V   D  +   + +  L   ++   Q   L++ T R NI   L   P  ++    + + 
Sbjct: 732 YVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNI---LFNSPYNEQRYNDVLEA 788

Query: 562 CFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C              T +G  G  LSGGQKQRI++ARAL      L+LD+  SA+D  + 
Sbjct: 789 CGLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTA 848

Query: 622 GAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGK 669
             I  N   G LM+ ++  ++S  H ++   R+ + +V+  +G V   G+
Sbjct: 849 LLIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQGE 896

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 140/535 (26%), Positives = 240/535 (44%), Gaps = 49/535 (9%)

Query: 166  NLYEFISLVGVSLLVGTAANYGR-VILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKV 224
            NL+ F+ +  +  ++  A N  R +++L   S R   +L  N+    ++    FF+   +
Sbjct: 1040 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1099

Query: 225  GDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLS 284
            G +I+R S D   V   L    S  F+++L   V + ++    P    F +FL       
Sbjct: 1100 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYY 1159

Query: 285  ASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKT-VQSFVAEQKEIKRYNHAIRH-IFN 342
             +Y+       SR+L+  T S+T      +S I + +   +A    I  YNHA R   FN
Sbjct: 1160 QAYYIV----TSRELKRLT-SIT------YSPIMSLISETLAGYLVINAYNHAKRFSYFN 1208

Query: 343  VGKQSAFINAKF------FSLTAVLGDMSFLVVLAYG----SYLVLHGSLSIGDLTAYMM 392
                   I+  F        L+  L  +  L+VLA G    S +     L+ G +   M 
Sbjct: 1209 FESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMS 1268

Query: 393  YTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISP----TLGKKFVPNKGEIEF 448
            Y+    +S+  +     +I     +  R+ E  +  P        T  +K  P  G I+F
Sbjct: 1269 YSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKF 1328

Query: 449  KNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVD 508
             + S  Y  +  + +   ++ +I+    + IVG +G GKST+   L R    T G+I +D
Sbjct: 1329 IDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVID 1387

Query: 509  GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT----------YGLVE----KPTQDE 554
            G DIS +    LR +++I+ Q+     GTIR N+           +  +E    KP  + 
Sbjct: 1388 GVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLER 1447

Query: 555  V---RSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
            +   R    +    N   K  N  +  +  +G+ LS GQ+Q + ++RAL+    IL+LDE
Sbjct: 1448 IISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDE 1507

Query: 612  ATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAE 666
            AT+++D+E++  I  T       +  TI++IAHR+ T+   + ++VL + G V E
Sbjct: 1508 ATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVRE 1559

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 132/268 (49%), Gaps = 29/268 (10%)

Query: 464 FKNLS-FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRR 522
           FKN++ F++  GS  CIVG  G GK+T+   +L       GQ+         +  K + R
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLIIR 724

Query: 523 HMSIVQ--QEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILG 580
             SI    Q+  +M+ ++++NI +G   K  +       + C     +   P+  +TI+G
Sbjct: 725 GNSIAYCPQQAWIMNSSVKENILFG--HKYDEHYYNLTIEACQLTEDLKMLPDGDETIVG 782

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGK---LMKSKS 636
             G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+KSK 
Sbjct: 783 EKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK- 841

Query: 637 ITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY-ADPGSELSKLLHE-------- 687
            TII   + +S ++ S+ +  L N   + E G + ++  +   S+L  L++E        
Sbjct: 842 -TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNN 899

Query: 688 -KATRSERQQNTAEDQEIDPEETINIEN 714
            K   SE ++ + E  ++ P +   IEN
Sbjct: 900 SKEEVSEERKTSEETSDVVPIDDNLIEN 927

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 124/492 (25%), Positives = 226/492 (45%), Gaps = 59/492 (11%)

Query: 202  RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
            +L    + K +H    F ++  +G +++R + D   +   +   V   F  M   S   G
Sbjct: 555  KLNLRAVHKVLHTPMSFIESTPIGRIMNRFTKDTDNLDGQILDNVRLTFYHM---STMFG 611

Query: 262  MMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQ--EAT--GSLTKVAEEQFSGI 317
            + I     L  F + + P ++ +  +     + +SR+++  EA     +     +   G+
Sbjct: 612  ICIMCIVYLPWFAI-VIPFLIFTIVFIFNFYQGSSREIRRLEAVRRSFIFNNINDVLGGL 670

Query: 318  KTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFI--NAKFFS--LTAVLGDMSFLVV--LA 371
              ++++  + + I + ++ I    N   +++++    + ++  L +++G +  L++  L 
Sbjct: 671  DIIKAYQVQNRFIFKSDYLI----NKTNEASYLYTGVQLWNNILVSIIGVLFALIISLLC 726

Query: 372  YGSYLVLHGS---------LSIGDLTAYMMYT----EYTGSSIFGLSTFYSEIMQGAGAA 418
                  + GS         L I ++  Y++ T    E   +S+  L T+ + + Q     
Sbjct: 727  VTKQFKISGSSTGVLLTYVLQIPNILNYLLDTLKKAENDMNSVERLVTYATNLPQ----- 781

Query: 419  SRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVC 478
                E T   P  SP       P  G+I+FK+ +F Y       I KN +  + +G  + 
Sbjct: 782  ----ERTSSKPETSP---GHIWPENGKIQFKDANFRYK-EGLPLILKNFNMLVQSGEKIG 833

Query: 479  IVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTI 538
            I G +G GKSTI + L R    T G I++D  DIS +    LR+++SI+ Q+P+L  GTI
Sbjct: 834  ICGRTGAGKSTIMNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTI 893

Query: 539  RDNIT-YGLVEKPTQDEVR----SITKKCFCHNFITKFPNSYDTI---LGPH----GTLL 586
            R N+  +   +  T  E       I +  F H F  K  N+ +     L  H    GT  
Sbjct: 894  RKNLDPFSYFDDATLWEAMILSGFIDRDTFGH-FSEKPVNNKELTKFHLTAHVEEDGTNY 952

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRL 646
            S G+KQ +A  RA+I    +++LDEA+S++D E++  I     K       TI+ IAHRL
Sbjct: 953  SLGEKQLLAFTRAIIHHSKVVVLDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRL 1010

Query: 647  STIRRSENVIVL 658
            +TI + + ++VL
Sbjct: 1011 NTILKYDRILVL 1022

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 116/251 (46%), Gaps = 43/251 (17%)

Query: 446 IEFKNVSFSYPTRAS---------NQI------------FKNLSFKIDAGSNVCIVGPSG 484
           I+F N SF + T            NQI            F NL+F I  G  + I GP G
Sbjct: 166 IKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNGFNNLNFSI-XGEFIIITGPIG 224

Query: 485 RGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITY 544
            GK+++   +        G I +DG             ++ +    P + + T+RDNI +
Sbjct: 225 TGKTSLLYAMSGLMKKLEGTIEIDG-------------NLQLCGY-PWVQNTTVRDNIIF 270

Query: 545 GLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKP 604
           G   K  +++   + + C     +  F     T +G  G  LSGGQK RI +ARA+ K  
Sbjct: 271 G--SKYEKEKFDHVIRICALTEDLENFSGKDLTEIGELGITLSGGQKARINLARAIYKTS 328

Query: 605 TILILDEATSALDVESEGAI--NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDG 662
            I + D+  SA+D      I  N   G L   K+  I++  H+LS I++++ ++VLGND 
Sbjct: 329 DIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXILA-THQLSLIKKADRIVVLGNDN 386

Query: 663 SVAEVGKFKEL 673
           S  E+G +KEL
Sbjct: 387 SF-EIGPYKEL 396

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 125/542 (23%), Positives = 248/542 (45%), Gaps = 79/542 (14%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + +Y F     +  L G  +      LL  +  R    L    + + +H    F ++
Sbjct: 838  SFYMGMYSFFVFGSIVFLTGQFS------LLCYIGLRASKSLNLQAVNRVIHSPMWFMES 891

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAML---CGSVGIGMMISIS-PQLSAFLLFL 277
              +G +++R + D    + SL  ++ D  + ++   C  VGI ++  I  P  +  +  L
Sbjct: 892  TPMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCIIYLPWFAIAIPGL 947

Query: 278  TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337
               + ++ S++    R   R        +     +   G+ T++++ AE+    R+++ +
Sbjct: 948  GLILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEE----RFSYKL 1003

Query: 338  RHIFNVGKQSAFINA---KFFSLTAVLGDMSFLVVLAY------------GSYLVLHGSL 382
             ++ +   +++++     ++ ++   L  +SF ++++              + +VL   L
Sbjct: 1004 DYLIDKTNEASYLYTAVQRWINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVL 1063

Query: 383  SIGDLT----AYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKK 438
             I DL       +  TE   +S+  L T+ +E+ Q A          + +PS       K
Sbjct: 1064 LIPDLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHG-------EEVPS-------K 1109

Query: 439  FVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYY 498
              P  GEI+F+NV +++       +    + KI AG  V I G +G GKST+   L R  
Sbjct: 1110 TWPENGEIKFENVRYTHRD-GLPAVLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLR 1168

Query: 499  NPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNIT-YGLVEKPTQDEVRS 557
               +G++ +D  D+SK++  +LR  ++I+ Q+PVL  G++R N+  +G   +   D +++
Sbjct: 1169 EVESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNLDPFG---EYDDDVLKN 1225

Query: 558  ITKKCFCHNF-------------------ITKFPNSYDTILGPHGTLLSGGQKQRIAIAR 598
               +C    F                   + KF    D  +  +G   S G++Q +A+AR
Sbjct: 1226 ALMRCTVGKFNKTGNESTEGIDTDADNGLVGKF--RLDQDVEENGCNFSVGERQVLALAR 1283

Query: 599  ALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVL 658
            ALI+  +IL+LDEAT+A+D  ++  +     +  K +  T++ +AHRL TI   + ++VL
Sbjct: 1284 ALIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVL 1341

Query: 659  GN 660
             N
Sbjct: 1342 EN 1343

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 116/459 (25%), Positives = 205/459 (44%), Gaps = 69/459 (15%)

Query: 298 DLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNV-----GKQSAFINA 352
           ++ + T     +  E  + IK V+ +  EQ     Y  +I+ I ++      +     N 
Sbjct: 354 NINQVTDQRVSILREVLNNIKMVKLYCWEQA----YEKSIKKIRSLETSKLTRMEILKNV 409

Query: 353 KF---FSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYS 409
            F   FSL  +   M+FL +        +HG L      A  +++  +   I  L +FY 
Sbjct: 410 IFSVTFSLPNICSLMTFLALFK------IHGGLK----NAATIFSSLSLFKILSLLSFYI 459

Query: 410 EIMQGAG-----AASRLFELTDRIPS-----ISPTLGKKFVPNKGEIEFKNVSFSYPTRA 459
            +  G       +  R  E  +   S     I  T  + +  N   I+  + SF + T  
Sbjct: 460 PLSLGTAIDIVTSLDRFQEFLEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEE 519

Query: 460 SNQI-------FKNLSFKIDAGSNVCIVGPSGRGKST----IASLLLRYYNPTTGQIFVD 508
            +         F +L+F+I  G  + IVGP G GK++    I  L+ +Y N   G++ VD
Sbjct: 520 KDNNEEKEFSGFHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGNE--GELEVD 577

Query: 509 GQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFI 568
           G  +S                 P + + T+RDNI +G   K  + + + + + C     +
Sbjct: 578 GSLVS--------------CGYPWIQNTTVRDNILFG--SKYDESKFKRVIRMCSLEEDL 621

Query: 569 TKFPNSYD-TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
            K  ++YD T +G  G  LSGGQK RI +AR+L K+  I + D+  SA+D    +  +  
Sbjct: 622 EKL-SAYDMTEIGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKE 680

Query: 627 TFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLH 686
              + +K+K  T +   H+LS I +++ +IVLGNDG   ++G++++L     + ++ + +
Sbjct: 681 CLMEGLKNK--TRVLATHQLSLIGKADQLIVLGNDGKF-DMGRYEDLIKTNETLINLMQY 737

Query: 687 EKATRS-ERQQNTAEDQEIDPEETINIENSTPESDITQE 724
            K     + ++   +D+    E TI+ EN  P    T+E
Sbjct: 738 AKLQEEIQEKEEVIKDKNEKTETTIS-ENLEPSQLTTKE 775

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 133/521 (25%), Positives = 234/521 (44%), Gaps = 49/521 (9%)

Query: 189  VILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSD 248
            VI++   S +   +L   + +  +     FF+   VG +I+R SSD  VV + L    + 
Sbjct: 1035 VIMMIYCSIKGSKKLHDTMARAVLRSPMSFFETTPVGRIINRFSSDVNVVDQGLQFSFTY 1094

Query: 249  GFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATG---- 304
             F  +L     +  +I IS  +  FLLF    +++   Y+       SR+L+  T     
Sbjct: 1095 FFIYILNY---LFTVILISFNMPLFLLF-NGILLVLYFYYQIYYITLSRELKRLTSISYS 1150

Query: 305  SLTKVAEEQFSG------IKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLT 358
             +  +  E   G       K +Q F     E  ++N  I  +FN    + +++ +   L 
Sbjct: 1151 PIMSLLSETLGGHLVINAYKHLQRFTYLNNESIQFN--INCMFNFRSTNRWLSMR---LQ 1205

Query: 359  AVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAA 418
             +   +  L  L   S +    +LS G +   M Y     +S+  +     ++     + 
Sbjct: 1206 TIGAVLVLLTALLSLSTINTDKALSSGMVGLLMSYALQVTTSLTWIVRMSVQVETDIVSV 1265

Query: 419  SRLFELTDRIPS----ISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAG 474
             R+ E  +  P     I  +   K  P++G I F+N S  Y     + + K+++ +I   
Sbjct: 1266 ERILEYCNLPPEADAIIEESRPPKEWPSRGAITFQNYSTKYRENL-DPVLKDITVEIKPQ 1324

Query: 475  SNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLM 534
              + IVG +G GKST++  L R   P+ G I +DG DI+K+    LR +++I+ Q+    
Sbjct: 1325 EKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAF 1384

Query: 535  SGTIRDNIT-YGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT---------------- 577
             GTI+ N+  +G   + + +E+    +       I K  +  +T                
Sbjct: 1385 EGTIKSNLDPFG---QYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELL 1441

Query: 578  --ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSK 635
               +  +G  LS GQ+Q + ++RAL+    IL+LDEAT+A+D+E++  I  T     K +
Sbjct: 1442 SARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR 1501

Query: 636  SITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD 676
              TI++IAHR+ T+  S+ ++VL + G V E      L AD
Sbjct: 1502 --TILTIAHRIDTVMDSDKIMVL-DKGEVKEFDTPTNLLAD 1539

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 131/270 (48%), Gaps = 24/270 (8%)

Query: 443 KGEIEFKNVSFSYPTRASNQIFKNL-SFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501
           KG  E +N        ++    KN+  F+   G   CIVG  G GKST    +L      
Sbjct: 624 KGLKEDENYDEEAAVASTKVALKNIRHFEARKGDLTCIVGRVGSGKSTFLQAIL------ 677

Query: 502 TGQI-FVDGQDISKVSSKSLRRHMSIVQ--QEPVLMSGTIRDNITYGLVEKPTQDEVRSI 558
            GQ+  + G D   V  K + R  SI    Q+P +M+ +++DN+ +G   +  +D  ++ 
Sbjct: 678 -GQLPCISGLD-EHVPPKLIIRAKSIAYCPQQPWIMNASLKDNVIFG--HRLNEDYYKAT 733

Query: 559 TKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +KC     +   P+   T++G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D 
Sbjct: 734 IRKCQLLPDLDILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDILSAVDA 793

Query: 619 E-----SEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKE- 672
           E      E  +N   G L   K+ T+I   + +S ++ S+N+  L  DG + E   + + 
Sbjct: 794 EVSKNIVEQVLNRGTGIL---KNKTVILTTNAVSVLKHSQNIYALL-DGEIVENKSYADA 849

Query: 673 LYADPGSELSKLLHEKATRSERQQNTAEDQ 702
           +  D  S L  L+ E  +    +++T + Q
Sbjct: 850 MSCDDSSILKTLIQEFDSNENSREDTKDGQ 879

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 131/517 (25%), Positives = 221/517 (42%), Gaps = 45/517 (8%)

Query: 203  LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGM 262
            L    +K+ +H    F D   +G +++R + D   +   LT+ V   F       VG+ +
Sbjct: 961  LNLKAVKRLLHTPMSFLDTTPIGRVLNRFTKDTDTLDTELTESVR-LFLFQASNIVGVVI 1019

Query: 263  MISIS-PQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321
            M  I  P  +  + FL       A ++    R   R        +     E  SG+ T++
Sbjct: 1020 MCIIYLPWFAIAVPFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIR 1079

Query: 322  SFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGS 381
            ++  E + + + +  I  +   G     I  ++ S+   +  M+F +++   + L +   
Sbjct: 1080 AYRGEARFLTKSDFLINKMNEAGYVVVAIQ-RWVSIALDMIAMAFALII---TLLCVTRQ 1135

Query: 382  LSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAG---AASRL--------FELTDRIPS 430
             SI   +  ++ T Y       L+T    + QG     +A RL         E   R P 
Sbjct: 1136 FSISAASVGVLLT-YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPE 1194

Query: 431  ISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTI 490
             SP    +  P++G I+F +VS +Y       +  ++S  +  G  + I G +G GKSTI
Sbjct: 1195 TSP---PESWPSEGAIDFDHVSLAYRP-GLPLVLHDVSLHVRGGEKIGICGRTGAGKSTI 1250

Query: 491  ASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI-------- 542
             S L R      G I +DG DI+++    LR  ++I+ Q+PVL  G +R N+        
Sbjct: 1251 MSALYRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSD 1310

Query: 543  ---TYGLVEK---PTQDEVRSITKKCFCHNFITKFPNSY-DTILGPHGTLLSGGQKQRIA 595
                  LV      T+DE  +          +T     + +  +   G+  S G++Q +A
Sbjct: 1311 NELWDALVRAGAIATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLA 1370

Query: 596  IARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENV 655
            + RAL++   ILILDEATS++D E++  I             T++ IAHRL+TI   + +
Sbjct: 1371 LTRALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRI 1428

Query: 656  IVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRS 692
            +VL + G V E      L+   G     L  E   RS
Sbjct: 1429 LVL-DQGRVCEFDTPHALFVRNG-----LFTEMCARS 1459

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 115/253 (45%), Gaps = 36/253 (14%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           FKNL+ +I  G  V + G  G GKS++ + +  +    +G I+ +G         SL   
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---------SL--- 641

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVR--SITKKCFCHNFITKFPNSYDTILGP 581
             ++   P + + T++DNI +G    P  DE R     + C     +   P    T +G 
Sbjct: 642 --LLCGYPWIQNTTVKDNILFG---SPF-DEARYKETIRVCSLQADLDLLPAGDKTEIGE 695

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALD------VESEGAINYTFGKLMKSK 635
            G  LSGGQK RI +AR++ KK  I + D+  SA+D      +  E  +    GK     
Sbjct: 696 RGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGALDGK----- 750

Query: 636 SITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQ 695
             T +   H+LS I R+  VI +  DG+V + G   EL +     +   L E +  +   
Sbjct: 751 --TRVLATHQLSLIARASKVIFIDLDGTV-DSGTLDELKSRHAGFVK--LMEYSNHTSTD 805

Query: 696 QNTAEDQEIDPEE 708
           +   +D E++ EE
Sbjct: 806 EEEGQDGEVEHEE 818

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 138/499 (27%), Positives = 235/499 (47%), Gaps = 34/499 (6%)

Query: 184  ANYGRVILLRVLSERVVA--RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRS 241
            A+   +I+L+ L   + A  ++ A ++ + +H    FFD    G +++R++ D  ++ + 
Sbjct: 974  ASVTTLIMLKFLCIGLEASSKVFAEILNRVLHAKMTFFDFTPAGRILNRITRDFEILEQE 1033

Query: 242  LTQKVSDGFKAMLCGSVG-IGMMISISPQ---LSAFLLFLTPPVMLSASYFGRLIRNNSR 297
            L   +     A+   S+G I ++IS+      + AFLL +   VM++ SY         R
Sbjct: 1034 LMVLLLQLLFAI--TSLGAILLLISVIATKFLIFAFLLGIIYAVMIT-SYIPAF-----R 1085

Query: 298  DLQEATGSLTKVAEEQFS----GIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAK 353
            DL+   G       EQFS    G  T++ F    KE        R +    + + +++  
Sbjct: 1086 DLKRYEGITRSPIFEQFSELLSGFVTIRGF---GKEKSCMGQLFRKLDLNNRPAYYVSVV 1142

Query: 354  FFSLTAVLGDMSFLVVLAYGSYLVLHG-SLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIM 412
               L   +  +  LV+ A  +  +L+   L  G     + Y      S    +T  S + 
Sbjct: 1143 QLWLCLRVEVLGSLVLGATATLSLLNAKELGAGLAGLALTYAMPFSQSALWTATVSSNVE 1202

Query: 413  QGAGAASRLFELT--DRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFK 470
                +  R+ E T  D   + +  L         EI F +V   Y     + + KN+SF 
Sbjct: 1203 IKMTSVERIKEYTEIDCEDTKAGALINTQWSGGAEISFDHVYVRYAPHLPD-VLKNVSFT 1261

Query: 471  IDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQE 530
            +   S V IVG +G GKST+   L R    T G I + G DI+ ++ ++LRR ++++ Q+
Sbjct: 1262 LLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGTIRIGGIDIASLNLQTLRRELTVIPQD 1321

Query: 531  PVLMSGTIRDNIT-YGLVEKPTQDEVRSITKK--CFCHNFITKFPNSYDTILGPHGTLLS 587
            P L SGTI+ NI  +G   + +  E+    ++   F      +  NS  +++   G  +S
Sbjct: 1322 PSLFSGTIKSNIDPFG---RYSDQELTHFARRIGLFSGTDDVRTFNSLGSLVSEGGENMS 1378

Query: 588  GGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLS 647
             GQ+Q + +ARAL++K  ILILDEAT+++D E++  I         S    +I++AHR+S
Sbjct: 1379 QGQRQLLCLARALLQKSKILILDEATASIDHETDATIQQVVRDF--SSGGIVITVAHRMS 1436

Query: 648  TIRRSENVIVLGNDGSVAE 666
            TI   + VIVL + G V E
Sbjct: 1437 TIIDYDQVIVL-DSGIVKE 1454

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 137/295 (46%), Gaps = 21/295 (7%)

Query: 445 EIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQ 504
           E+ F+N S ++    +  + KNL+   +      I+GPSG GKS++   LL   +   G 
Sbjct: 634 EMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGS 693

Query: 505 IFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFC 564
           I      + +      R   +   Q P + + T+++NI +    +      + +   C  
Sbjct: 694 I-----RVPRGYMHDDRCSFAFCSQTPWITNATVKENIVFS--SQFNTKRYQEVLHACGL 746

Query: 565 HNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              I +     +T++G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D    G  
Sbjct: 747 EEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVD---PGMA 803

Query: 625 NYTF-----GKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGS 679
            + F     G LMK K  T I   H ++ +++  ++I+L ++G V+++GK ++   D   
Sbjct: 804 VWIFQKCIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDFNFDSEF 861

Query: 680 ELSKLLHEKATRSERQQNTAEDQE--IDPEETINIENSTPESDITQELLENPIKE 732
           + SK    K  ++E + N    +E  + P+   + E    +  I  E+    +K 
Sbjct: 862 DYSK--PSKLEKAEMKPNKKPKKEMILQPDTGFSREEHKEDGSIKIEVYNWLVKH 914

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  120 bits (300), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 132/542 (24%), Positives = 239/542 (44%), Gaps = 40/542 (7%)

Query: 170  FISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLIS 229
            ++ L  + +L   A  + + I + +L       L    +++ +H    F D   +G +++
Sbjct: 911  YMGLYILFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMN 970

Query: 230  RLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFG 289
            R + D   +   +T+ V      +   +  I + I   P  +  + FL    +  A ++ 
Sbjct: 971  RFTKDTDTLDNEITESVRLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHYQ 1030

Query: 290  RLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAF 349
               R   R        +     E   G+ T++++ +EQ+ + + +  I  +   G     
Sbjct: 1031 ASGREIKRMDAVQRSFVYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGYLVTS 1090

Query: 350  IN---AKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLST 406
            I    A    + AV+  +   ++     + V  GS  +G +  Y++      +++    T
Sbjct: 1091 IQRWVAISLDMLAVIFALIIALLCVTRQFHVSAGS--VGVMVTYVLQLPGLLNALLRSQT 1148

Query: 407  FYSEIMQGAGAASRLFELTDRIP-----SISPTLGKKFVPNKGEIEFKNVSFSYPTRASN 461
               +      +A RL      +P      I  T   +  P++G I+F+NVS +Y      
Sbjct: 1149 ---QTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAYRPELPV 1205

Query: 462  QIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLR 521
             + KN+S  I +   + I G +G GKSTI S L R     TG+I +D  DIS +    LR
Sbjct: 1206 AL-KNVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYELR 1264

Query: 522  RHMSIVQQEPVLMSGTIRDN----------------ITYGLVEKPTQDEVRSITKKCFCH 565
              ++I+ Q+PVL  G IR N                +  G +++   D +R+  K     
Sbjct: 1265 SKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDA--- 1321

Query: 566  NFIT--KFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
            N ++   F    D ++   G+  S G++Q +A+ RAL++   ILILDEATS++D  ++  
Sbjct: 1322 NGLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAK 1381

Query: 624  INYTFGKLMKSKS-ITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELS 682
            I     ++++  S  TI+ IAHRL TI     ++VL + G V E    K+LY D  S  +
Sbjct: 1382 IQ---SRIVEEFSNCTILCIAHRLKTILAYNRILVL-DQGQVVEFDTPKKLYNDRDSIFN 1437

Query: 683  KL 684
            ++
Sbjct: 1438 EM 1439

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 135/287 (47%), Gaps = 42/287 (14%)

Query: 451 VSFSYPTRASNQI-------FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTG 503
           VS +   +AS++I       F  L+F +     + I GP G GKS++ + L  +   ++G
Sbjct: 572 VSTTETEKASSEIEQTPFRGFHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSG 631

Query: 504 QIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGL-VEKPTQDEVRSITKKC 562
            + + G                ++   P + + T++DNI +G   +KP   +V  I   C
Sbjct: 632 SMTIKGD--------------LLLCGYPWVQNATVKDNILFGSPFDKPKYQKVIEI---C 674

Query: 563 FCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SE 621
                +   P    T +G  G  LSGGQK RIA+AR++ K   I + D+  SA+D    +
Sbjct: 675 SLQADLDILPAGDRTEIGERGITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCK 734

Query: 622 GAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681
             ++      +K K  T I   H+LS I ++  VI LG DGS  ++G   EL     +  
Sbjct: 735 HIVDECMMGYLKQK--TRILATHQLSLIDKASRVIFLGLDGSF-DIGTVPELLKR-NTGF 790

Query: 682 SKLLHEKATRSERQQNTAEDQEIDPEET----INIENSTPESDITQE 724
           S L+        + QN+A  +E++ ++T    + I   + ++DI+++
Sbjct: 791 SDLM--------QFQNSAPAEELEDDDTKAQNMEITAISSQTDISKK 829

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 138/556 (24%), Positives = 233/556 (41%), Gaps = 72/556 (12%)

Query: 162  AFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDN 221
            +F + LY F        + G    Y  +  + V++ +    L    + K +H    F D 
Sbjct: 941  SFYMGLYSFFVFGSYIFMNG---QYTLLCYMGVVASKT---LNLQALHKILHTPMSFMDT 994

Query: 222  NKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISIS-PQLSAFLLFLTPP 280
            N +G +++R + D   +   LT+ +     + +   +G+G M  I  P  +  + FL   
Sbjct: 995  NPLGRILNRFTKDTDALDNELTENLRLAM-SQIANIIGVGAMCIIYLPWFAIAIPFLLLI 1053

Query: 281  VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340
             +L A ++    R   R        +     E  +G+ T++++ A+     R+      +
Sbjct: 1054 FLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQD----RFATKSEFL 1109

Query: 341  FNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVL-----HGSLSIGDLTAYMMY-- 393
             +   ++A+I+        +  D   LV +A+   + L        +S  D    + Y  
Sbjct: 1110 IDKMNEAAYISIAVQRWAGIFLD---LVAVAFALIITLLCVTRQFHISGADTGVLLTYVL 1166

Query: 394  ---------------TEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKK 438
                           TE   +S   L ++ +++ Q         E   R P  SP +   
Sbjct: 1167 QLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQ---------EAQYRKPECSPPIDW- 1216

Query: 439  FVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYY 498
              P  G I F+N++F+Y       I KN +  I     + I G +G GKSTI + L R  
Sbjct: 1217 --PQNGHIVFENINFAY-RPGLPIILKNFNLIIKPNEKIGICGRTGAGKSTIMNALYRLT 1273

Query: 499  NPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDN----------------I 542
              TTG+I +D  DIS +    LR  ++I+ Q+PVL  G IR N                +
Sbjct: 1274 ELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDDLLWESLV 1333

Query: 543  TYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIK 602
              G ++    + V+S  K     N + KF    +  +   G   S G++Q +A+ RAL++
Sbjct: 1334 KAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGERQVLALTRALVR 1390

Query: 603  KPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDG 662
            +  ILILDEATS++D E++  I             TI+ IAHRL TI   + ++VL   G
Sbjct: 1391 QSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILNYDRILVL-EKG 1447

Query: 663  SVAEVGKFKELYADPG 678
             VAE      L+ + G
Sbjct: 1448 EVAEFDTPWNLFNNDG 1463

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 100/214 (46%), Gaps = 21/214 (9%)

Query: 463 IFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRR 522
           +  N++F I  G  V + GP G GK+++   L       +G++   G D+          
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSG-DL---------- 672

Query: 523 HMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPH 582
              ++   P + + TIRDNI +G    PT    + +   C   + +   P    T +G  
Sbjct: 673 ---LLCGIPWVQNATIRDNILFGSPYDPT--FYKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGKLMKSKSITIIS 641
           G  LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y     +  K  T I 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 642 IAHRLSTIRRSENVIVLGN--DGSVAEVGKFKEL 673
             H+LS + +++ +IVL    D    E+G FKEL
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 118/495 (23%), Positives = 220/495 (44%), Gaps = 42/495 (8%)

Query: 202  RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
            RL  +  K+ ++    F D   +G +++R + D  V+   LT   +  F   +   VG+ 
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTDS-TRMFVFQMANVVGVF 956

Query: 262  MM-ISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAE----EQFSG 316
            ++ I+  P    ++    P  +L   + G   ++  R+++               E   G
Sbjct: 957  ILSIAYLP----YVAIAVPISVLLLLFIGDHYQSAGREVKRLEAIQRSFVYNNLGEVLDG 1012

Query: 317  IKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAK-FFSLTAVLGDMSF-LVVLAYGS 374
            + T++++ A+ + +++ ++ +      G     I A+ + +LT  L  ++  L+V     
Sbjct: 1013 LDTIRAYNAQSRFLRKSDYFLNRTNEAGY--LVIGARCWVALTTDLVAIAIALIVTLLCV 1070

Query: 375  YLVLHGSLSIGD--LTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSIS 432
              V+H + S     LT  +    Y    + G    ++E+     +  R+      +P  +
Sbjct: 1071 TRVIHITPSSAGVLLTVVLQMPAYFNMVLRG----FTELENNMNSTQRVHYYATALPQEA 1126

Query: 433  P-----TLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGK 487
            P            P  GEI F+ VSF+Y       +   +SF + AG  + I G +G GK
Sbjct: 1127 PQYLPGAAPPAGWPAAGEIVFQEVSFAYRPGLPLALC-GVSFHVRAGEKIGICGRTGAGK 1185

Query: 488  STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLV 547
            +++ + L R     +G I +DG DI+ +    LR  +SI+ Q+P+L  GT+R N+     
Sbjct: 1186 TSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNL----- 1240

Query: 548  EKPTQDEVRSITKKCFCHNFITK---FPNSY----DTILGPHGTLLSGGQKQRIAIARAL 600
              P  +            + +      P S+    D  +   G   S G++Q +A+ARAL
Sbjct: 1241 -DPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLALARAL 1299

Query: 601  IKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGN 660
            ++   ILILDEATS++D  ++  +        + +  T++ +AHRL TI   + ++VL +
Sbjct: 1300 VRSTRILILDEATSSVDYATDARVQARIAA--EFRQATVLCVAHRLRTIISYDRILVL-D 1356

Query: 661  DGSVAEVGKFKELYA 675
             G VAE      L+A
Sbjct: 1357 QGRVAEFDTPYRLFA 1371

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 113/241 (46%), Gaps = 27/241 (11%)

Query: 466 NLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMS 525
           +L F I  G  + ++G  G GK+++ + +  Y   TTG + V+G         SL     
Sbjct: 553 DLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---------SL----- 598

Query: 526 IVQQEPVLMSGTIRDNITYGL-VEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGT 584
           +    P + + TIRDNI +G   ++   DEV      C        FP    T +G  G 
Sbjct: 599 LFCGVPWIQNATIRDNIIFGSSFDQTRYDEV---VNACALEADFKIFPAGDKTEVGERGI 655

Query: 585 LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            LSGGQK RI++ARA+ K   I + D+  SA+D      I      L + ++ T I   H
Sbjct: 656 TLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILATH 714

Query: 645 RLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAEDQEI 704
           +L+ ++ +  VI LG DGS  ++G   EL+ +   +   L+      S   Q  AE+ E+
Sbjct: 715 QLALVQEASRVIFLGQDGSF-DMGTPAELH-EKNPQFRNLM------SLSSQTNAEESEM 766

Query: 705 D 705
           +
Sbjct: 767 E 767

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
           Anc_8.303 YDR135C
          Length = 1546

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 136/642 (21%), Positives = 274/642 (42%), Gaps = 87/642 (13%)

Query: 116 LLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVG 175
           LL A +   +  ++  + P+++ I++ +     +NPD  +  +      + ++  +S + 
Sbjct: 286 LLLAATFKVIHDILAFTQPQLLKILI-QFVTAYTNPDLELPIIKGFMISIAMF-LVSFIQ 343

Query: 176 VSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDA 235
            S L     N     +       + + + + + +K++    E    +  GD+++ +S D 
Sbjct: 344 TSFLHQYFLNSFNTGM------NIRSAMSSVIYQKSLVLSNEASGTSSTGDVVNLMSVDV 397

Query: 236 YV---VSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLI 292
                V++      S  F+  LC  V +  ++  S  +  F+L    P+    SY  R+ 
Sbjct: 398 QRLQDVAQWCNIIWSGPFQITLC-LVSLYKLLGNSMWIGVFILIFMMPI---NSYLMRIQ 453

Query: 293 RNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAE-----QKEIKRYNHAIRHIFNVGKQS 347
           +   +   +     T++  E  + IK+++ +  E     + E  R    ++++  +G   
Sbjct: 454 KKLQKIQMKNKDERTRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYV 513

Query: 348 AFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTF 407
           AF + +F ++   L   S   V  +     L   L    LT + + +    +    +++F
Sbjct: 514 AFTHFQF-NIVPFLVSCSTFAVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF 572

Query: 408 YSEIMQGAGAASRLFEL----------TDRIPSISPTLGKKFVPNKGEIEFK---NVSFS 454
               ++ + + +RLF              R+P+         V N G++  K   + +F 
Sbjct: 573 ----IEASISINRLFSFLTNEELQKDAVQRLPN---------VKNTGDVSIKLGDDATFL 619

Query: 455 YPTRASNQI-FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
           +  +   ++  KN++F+   G   CIVG  G GKS +   +L       G   V G D++
Sbjct: 620 WKRKPEYKVALKNINFQARKGELTCIVGKVGSGKSALIQSILGDLFRVKGFATVHG-DVA 678

Query: 514 KVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPN 573
            VS            Q P +M+GT+++NI +G   K  +       K C     ++  P+
Sbjct: 679 YVS------------QVPWIMNGTVKENILFG--HKFDKKFYEKTIKACALTIDLSILPD 724

Query: 574 SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFG--- 629
              T++G  G  LSGGQK R+++ARA+  +    + D+  +A+D    +  I +  G   
Sbjct: 725 GDSTLVGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEHVLGPNG 784

Query: 630 ------KLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSK 683
                 K++ +  IT+++IA          + I L ++G + + GK++E+ +DPGS L K
Sbjct: 785 LLHSKTKVLATNKITVLNIA----------DYITLLDNGEIIQRGKYEEVTSDPGSPLCK 834

Query: 684 LLHEKATRSERQQNTAEDQEIDPEETINIENSTPESDITQEL 725
           L++E   + E    T     +  E + N+    P  D  +EL
Sbjct: 835 LINEYGKKHESTPGTMVSSSMSKEPSPNV----PLEDELREL 872

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/355 (23%), Positives = 145/355 (40%), Gaps = 27/355 (7%)

Query: 203  LRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAY----VVSRSLTQKVSDGFKAMLCGSV 258
            L + ++   +     FF+   +G +++R S+D Y    ++ R+ +Q  S+  K       
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFT--- 1065

Query: 259  GIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNS--RDLQEATGSLT-KVAEEQFS 315
                ++ I      F+ F+ P   L   Y    +R +   R L   T S T    +E   
Sbjct: 1066 ----LVVICVSTWQFIFFIVPMSFLYIYYQQYYMRTSRELRRLDSVTRSPTISHFQETLG 1121

Query: 316  GIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSY 375
            GI T++ +  E + I      + +  +    S   N         LG +  L     G Y
Sbjct: 1122 GISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLGIY 1181

Query: 376  LVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRL---FELTDRIPSI- 431
             +  G+++ G +   + Y      S+  +     E+     +  R+    EL    PSI 
Sbjct: 1182 RLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPSIV 1241

Query: 432  ---SPTLGKKFVPNKGEIEFKNVSFSYPTRAS-NQIFKNLSFKIDAGSNVCIVGPSGRGK 487
                P +     P  G ++F +    Y  RA  + + K+++  I     + IVG +G GK
Sbjct: 1242 EDKRPDVNW---PQDGAVKFNHYYTRY--RADLDYVLKDITLDIKPREKIGIVGRTGAGK 1296

Query: 488  STIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNI 542
            S++   L R    + G I VDG +  ++    LR  +SI+ Q+  +  GT+RDNI
Sbjct: 1297 SSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNI 1351

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 69/115 (60%), Gaps = 3/115 (2%)

Query: 573  NSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLM 632
            N+ +T L   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T     
Sbjct: 1424 NALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETIRSAF 1483

Query: 633  KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
            K++  TI++IAHRL+TI  S+ ++VL + G + E    + L  D  S    L  +
Sbjct: 1484 KNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGDKDSLFYSLCEQ 1535

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/252 (28%), Positives = 117/252 (46%), Gaps = 28/252 (11%)

Query: 464 FKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRH 523
           F +LSF++  G  + I G  G GK+++ + L  + + T G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEV-RSITKKCFCHNFITKFPNSYDTILGPH 582
             +    P + + TIRDNIT+G    P  + + R + + C     ++  P    T +G  
Sbjct: 637 -MLFCGAPWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGER 692

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGKLMKSKSITII 640
           G  LSGGQK RI +AR + K   I + D+  SA+D     +I  +   GKL      T I
Sbjct: 693 GITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKLGDK---TRI 749

Query: 641 SIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYAD--PGSELSKLLHEKATRSERQQNT 698
              H++S   ++  VI LG DGS  ++G   EL       + L KL  +  T SE + + 
Sbjct: 750 LATHQISLTEQASRVIYLGTDGSF-DIGTVDELKTRNVQFANLMKLASQ--TESESKDDN 806

Query: 699 AEDQEIDPEETI 710
              ++ D E+ +
Sbjct: 807 ISSEKFDREDQL 818

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 89/363 (24%), Positives = 162/363 (44%), Gaps = 20/363 (5%)

Query: 191  LLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGF 250
            L+  L  R    +    + + +H    F D   +G +++R + D  ++   LT+ +   F
Sbjct: 942  LVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLR-MF 1000

Query: 251  KAMLCGSVGIGMM-ISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKV 309
                    G+ +M I   P  +  +  L    +L + ++    R   R        +   
Sbjct: 1001 SYQFTVIWGVIIMSIIYLPWFAVAVPLLVVVFILVSDHYQCSAREIKRLEAVQRSFVLNN 1060

Query: 310  AEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVV 369
              E  SG+ T++++ AE + +K+ +  I  + N      + + ++ S+  ++G ++ L  
Sbjct: 1061 FNEVISGVDTIKAYHAEARFLKKSDILIDRM-NEMTFPLYASQRWVSI--LIGMIAVLFA 1117

Query: 370  LAYGSYLVLHGSLSI-----GDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAG-----AAS 419
            L   S L + G  +I     G L  Y++      +++    T     M  A      A S
Sbjct: 1118 LII-SILCVTGWFNISPASTGVLLTYVLQLPNLFNTLLRAMTQLENDMNSAERVLSYANS 1176

Query: 420  RLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCI 479
               E   RIP ++P    K  P +G I F NV+ +Y       + +++SF I +G  + I
Sbjct: 1177 LPKEAPYRIPEMAP---PKAWPERGAITFDNVALAYRP-GLPLVLQDVSFHISSGEKIGI 1232

Query: 480  VGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIR 539
             G +G GKSTI + L R    + G + +DG DI+ +   +LR  +SI+ Q+P+L  GTIR
Sbjct: 1233 CGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIR 1292

Query: 540  DNI 542
             N+
Sbjct: 1293 KNL 1295

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 62/104 (59%), Gaps = 3/104 (2%)

Query: 576  DTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSK 635
            D  +   G+  S G++Q +A+ARAL+++  ILILDEATS++D E++  I      + + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARI--VQEFQ 1475

Query: 636  SITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGS 679
              TI+ +AHRL TI   + ++V+   G VAE      LY + GS
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLYNEQGS 1518

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 116/231 (50%), Gaps = 9/231 (3%)

Query: 448 FKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFV 507
           F++ S  +    ++   KN+S      S   I+GP+G GKS++   LL   N  +G+I+V
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 508 ---DGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFC 564
              + +D  ++    +   M+   Q P L+SGTI+DN+ +G  E   + +   + K C  
Sbjct: 713 PTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--EIFNKQKFDDVMKSCCL 770

Query: 565 HNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              I        T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA+D E+   I
Sbjct: 771 DKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYI 830

Query: 625 --NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKEL 673
                 G +MK ++  I S  H +S + +  + +V+ + G V   GK  +L
Sbjct: 831 YEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGKPSDL 879

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 111/241 (46%), Gaps = 36/241 (14%)

Query: 474 GSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVL 533
           GS++ I+GP+  GKS+I  +L         +I+        VS  +    M I Q+   +
Sbjct: 598 GSSLLILGPNSCGKSSIQRIL--------AEIWPIYNKTGLVSIPAESDLMCIAQRPYFI 649

Query: 534 MSGTIRDNITYGL-----VEKPTQD-EVRSITKKCFCHNFITKFPN-SYDTILGPHGTLL 586
             GT RD I Y +      EK  +D E+  I K+      + +    SY   +     +L
Sbjct: 650 QGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVADWKDIL 709

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRL 646
           SGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  L K +    ISI+ R 
Sbjct: 710 SGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISISQRP 765

Query: 647 STIRRSENVI-----------VLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQ 695
           S I+  + ++            LG+D ++  +       A+  S  SKL    A   ER+
Sbjct: 766 SLIKYHDYLLEITSGTQWQYQTLGSDEAITSIE------AEIESLESKLTQLDAWEKERE 819

Query: 696 Q 696
           +
Sbjct: 820 E 820

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 99/421 (23%), Positives = 180/421 (42%), Gaps = 49/421 (11%)

Query: 291 LIRNNSRDLQEA---TGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQS 347
           L R+ SR   E    T    +   E FS IK ++ F  E   I   NH +R   +  ++ 
Sbjct: 535 LARSTSRFQHEGLLVTDKRIQNLNELFSSIKIIKCFTWEDNFI---NHILRTRDSEVRKM 591

Query: 348 AFINAKFFSLTAVLGDMS--FLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGL- 404
             I+   +S  A++  ++   +  +++  ++    +     LTA +    +T  S+FGL 
Sbjct: 592 KLISV-IWSCNAIIWYLTPTLITSISFAYFIFCERA----TLTAPI---AFTALSLFGLL 643

Query: 405 -------STFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457
                  S+  + I+Q   +  R+    D  P +          +     F   +  +  
Sbjct: 644 KMPLDQLSSTINYIVQSVISLRRIQSFLDE-PDMDKQKNLLLSKDGTYFMFSGATIGWSI 702

Query: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDG---QDISK 514
                I +NL+ K  +     + GP+G GKS +   LL   +   G+I V     +    
Sbjct: 703 NNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHVPSLASKHELM 762

Query: 515 VSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNS 574
           +    L   +S   Q P +++ +I++NI +G   +        + + C   N +    + 
Sbjct: 763 IHGDGLTNSISYCSQIPWIINDSIKNNILFG--SEFNLKRYNDVIRACCLTNDLRLLQDG 820

Query: 575 YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF---GKL 631
            ++I+G  G  LSGGQ+QR+++ARA+  K   +ILD+  SA+D +    I Y     G L
Sbjct: 821 DNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPL 879

Query: 632 MKSKSITIISIAHRLS-TIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKAT 690
           MK +  T I ++H +   I+++  +++L N  +  +          PG     LL +KA 
Sbjct: 880 MKGR--TCILVSHNVELVIKKAAYLLILDNRTTAYK--------GPPGD----LLKDKAL 925

Query: 691 R 691
           R
Sbjct: 926 R 926

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/305 (20%), Positives = 133/305 (43%), Gaps = 38/305 (12%)

Query: 202  RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261
            R+   +++  +     FF+   +G +++  S D   +   L+  +   F   L   + + 
Sbjct: 1092 RIFIKILRNVVSSKLIFFEKTPIGSIMNNFSKDIRSLDFELSPFIEGTFSCTLQTLMSLI 1151

Query: 262  MMISISPQLSAFLLFLTPPVM--LSASYFGRLIRNNSRDLQEATGSLTKVA-----EEQF 314
            ++  ++P       F+ P +   L   + G      SR+L+    S+TK        E  
Sbjct: 1152 LITYVNPN------FIFPAIFIFLFCCFIGHSYLCCSRELKRYE-SITKTPIYQHFSESL 1204

Query: 315  SGIKTVQSFVAEQKEIK-------RYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFL 367
            +G+ ++++F  E + IK        YN +  +++      +F          ++G ++  
Sbjct: 1205 AGLVSIRAFGDELRFIKVIFTRVDEYNKSFFYLWEANNWLSF-------RIELIGSIT-- 1255

Query: 368  VVLAYGSYLVLHGSLSIGDLTA--YMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELT 425
             +LA G +L+ + ++    L    +     +T S+++ +  FY+ +     +  RL+E T
Sbjct: 1256 -ILATGLFLLSNANMVDSGLAGITFTYAIAFTESALWMIK-FYATMEMNMNSVERLYEYT 1313

Query: 426  --DRIP-SISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGP 482
              ++ P S   T      PN G+I+FKNV+  Y      ++ ++++F I     + +VG 
Sbjct: 1314 NLEQEPYSRCITNVDNQWPNSGDIKFKNVTLRYSPELP-KVLQDVTFVIGDKEKIGVVGR 1372

Query: 483  SGRGK 487
            +G GK
Sbjct: 1373 TGAGK 1377

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 102/239 (42%), Gaps = 58/239 (24%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           I+ ++VSF Y    ++ + K+++  +   S + +VG +G GK+T+  +++    PT G  
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKG-- 587

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
                                V + P L  G              TQ  V S+       
Sbjct: 588 --------------------YVSRNPRLRIGYF------------TQHHVDSMDLNTSAV 615

Query: 566 NFITK-FP----NSYDTILGPHG----------TLLSGGQKQRIAIARALIKKPTILILD 610
           ++++K FP      Y   LG  G           LLSGGQK R+A A   +  P IL+LD
Sbjct: 616 DWMSKTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLD 675

Query: 611 EATSALDVESEGAI-----NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSV 664
           E ++ LD     A+     N+T G LM S  I++I   H  S I  SE+  V   DG++
Sbjct: 676 EPSNHLDTAGLDALIDALKNFTGGVLMVSHDISVID--HVCSEIWVSEDGTVKRFDGTI 732

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 129/283 (45%), Gaps = 51/283 (18%)

Query: 409 SEIMQGAGAAS----RLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYP-------T 457
           +E++QG    +    RL  +   IPS     G K +        K ++F  P       +
Sbjct: 569 TEVVQGTVQNNFNGVRLENVDIVIPSTRAKNGTKLI--------KKLTFQVPPSIDPLSS 620

Query: 458 RAS-----NQIFKNLS--FKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQ 510
           RA      N+I  ++S  F   AGS++ I+GP+G GKS+I  ++   + P   +      
Sbjct: 621 RADSVQDFNEITNDISIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIW-PIYNK------ 673

Query: 511 DISKVSSKSLRRHMSIVQQEPVLM-SGTIRDNITYGLVEKPTQDEVRSITKKCFCH---- 565
             + + SK    ++  V Q+P     GT+RD I Y +      D  R +  K        
Sbjct: 674 --NGLLSKPTEANLLCVPQKPYFTRGGTLRDQIIYPMSSDEFFD--RGLKDKLLVQVLRE 729

Query: 566 ---NFITKFPN--SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
              +++ K     SY   +     +LSGG+KQR+  AR +  KP  ++LDEAT+A+  + 
Sbjct: 730 VKLDYLLKRDKGWSYLDTVSDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADM 789

Query: 621 EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGS 663
           E   +Y F  ++K      I+I+ R S I+  + ++ + +D S
Sbjct: 790 E---DYLFN-VLKRYRFNFITISQRPSLIKYHDLLLEISDDNS 828

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 134/305 (43%), Gaps = 47/305 (15%)

Query: 420 RLFELTDRIPSISPTLGKKFV--------PNKGEIEFKNVSFSYPTRASNQIFKNLSFKI 471
           RL  +   IPS+    G K +        P+  ++  K  S    T  SN     L F  
Sbjct: 581 RLENIDIMIPSVRGKSGIKLIKKLTFQIPPHLDQLSSKTSSLQDITSMSNI---PLPFLS 637

Query: 472 DAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEP 531
              S++ I+GP+G GKS+I  ++   +      I+     +SK  S SL   + I Q+  
Sbjct: 638 GQASSLLILGPNGCGKSSIQRIIAEIW-----PIYNKNGLLSKPDSSSL---LCIPQKPY 689

Query: 532 VLMSGTIRDNITYGL-----VEKPTQDEVR-SITKKCFCHNFITKFPN-SYDTILGPHGT 584
               GT RD I Y +      +   +D+V   I  +      + + P  SY   +     
Sbjct: 690 FTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDEVTEWKD 749

Query: 585 LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
           +LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E   +Y F  L K +  + I+I+ 
Sbjct: 750 VLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFNMLKKFR-FSFITISQ 805

Query: 645 RLSTIRRSENVI------------VLGNDGSVAEVG-KFKELYADPGSELSKLLHEKATR 691
           R S I+  + ++             LG D ++  +  + +EL      +L K+   K  R
Sbjct: 806 RPSLIKYHDMLLEIADRDGKWQLQTLGTDEAITTIDHEIEELQI----KLQKVEEWKKQR 861

Query: 692 SERQQ 696
            E QQ
Sbjct: 862 DELQQ 866

>TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1011

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 85/321 (26%), Positives = 146/321 (45%), Gaps = 61/321 (19%)

Query: 446 IEFKNVSFSYPT---------RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLL- 495
           + F+NVS+S            +++ +I +N+S     G  + I+G SG GK+T+  +L  
Sbjct: 388 LTFENVSYSITESEGIRRDEGKSNVKILQNVSGVAKPGEIMAIMGGSGAGKTTLLDILAM 447

Query: 496 --RYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQ-----------EPVLMSGTIRDNI 542
             +     +G I ++G+ + K      R+ +  V Q           E VL S  +R   
Sbjct: 448 KDKTDGDVSGAIKINGKQLEK---SYFRKLIGFVDQYDYLFPTLSVYETVLNSALLRLPS 504

Query: 543 TYGLVEKPTQ-----DEVRSITKKCFCHNFITKFPNSYDTILG-PHGTLLSGGQKQRIAI 596
           +     K  +     DE+R +  K              D ++G  +   +SGG+K+R++I
Sbjct: 505 SMSFAAKQLRVLQVLDELRILEIK--------------DRLIGNDYQRGISGGEKRRVSI 550

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITII-SIAHRLSTIRRSEN- 654
           A  L+  P+ILILDE TS LD  +   +     +L ++ + TII SI    S I  S N 
Sbjct: 551 ACELVTSPSILILDEPTSGLDSNNANNVINCLVRLAQNHNRTIIVSIHQPRSNIFYSFNK 610

Query: 655 VIVLGN-----DGSVAEVGKFKE---LYADPGSELSKLLHEKATRSERQQNTA---EDQE 703
           +I+L N      G  + V KF E   LY  PG  ++  L +    +ER    +    ++ 
Sbjct: 611 LILLSNSRLIYSGEASNVTKFLEANKLYCPPGYNVADYLIDITVTNERVDADSVNKNNER 670

Query: 704 IDPEETINIENSTPESDITQE 724
           I+P  ++   N++ + ++ QE
Sbjct: 671 IEPMASVG--NNSSKQELGQE 689

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 86/190 (45%), Gaps = 51/190 (26%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           + F ++SFSY     N +++NL F +D  S + +VGP+G GKST+  ++     P +G++
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
                           RH                 ++  G+  + +QD++  +TK     
Sbjct: 453 ---------------SRHT----------------HVKLGVYSQHSQDQL-DLTKSAL-- 478

Query: 566 NFI-TKFPN------SYDTILGPHGT----------LLSGGQKQRIAIARALIKKPTILI 608
            F+  K+PN       +   LG +G            LS GQ+ R+  A   +++P +L+
Sbjct: 479 EFVRDKYPNISQDFQYWRGQLGRYGLTGEGQTVQMGTLSEGQRSRVVFALLALEQPNVLL 538

Query: 609 LDEATSALDV 618
           LDE T+ LD+
Sbjct: 539 LDEPTNGLDI 548

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 137/306 (44%), Gaps = 55/306 (17%)

Query: 397 TGSSIFGLSTFYSEIMQGAGAASRLFE-----LTDRIPSISPTLGKKFVPNKGEIEFKNV 451
           T  S+  L TF S  +    + S LF+     L D + ++  +  K    N   + F+N+
Sbjct: 329 TSMSLLALITFVSFYI----SKSTLFKNGTIHLVDEVETLDESFLKS--DNAAALSFENI 382

Query: 452 SFSYPTRASNQ-IFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLL--RYYNPTTGQIFVD 508
           +++  +  +++ I K +S  I  G  + ++G SG GK+T+  +L   R     TG I V+
Sbjct: 383 TYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQVTGSIKVN 442

Query: 509 GQDISKVSSKSLRRHMSIVQQ-----------EPVLMSGTIRDNITYGLVEKPTQ----- 552
           G DI +   K   + +  V Q           E VL S  +R   ++    K T+     
Sbjct: 443 GSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRSFSFAAKQTRVYQVL 499

Query: 553 DEVRSITKKCFCHNFITKFPNSYDTILGPHGTL-LSGGQKQRIAIARALIKKPTILILDE 611
           +E+R +  K              D ++G      +SGG+K+R++IA  L+  P IL LDE
Sbjct: 500 EELRILDIK--------------DRVIGNDFERGISGGEKRRVSIACELVTSPLILFLDE 545

Query: 612 ATSALDVESEGAINYTFGKLMKSKSITIISIAH--RLSTIRRSENVIVLGN-----DGSV 664
            TS LD  +   +     +L K+ + T++   H  R +  +  + +++L N      G  
Sbjct: 546 PTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMVYSGDA 605

Query: 665 AEVGKF 670
             VG+F
Sbjct: 606 IRVGEF 611

>KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 139/331 (41%), Gaps = 73/331 (22%)

Query: 320 VQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYG----SY 375
           +++ V  ++ +KR++   R +  V     F+N     +   + DM    ++AYG    SY
Sbjct: 256 LEACVWLEEYLKRFD---RTLVLVSHSQDFLNG----VCTNMLDMRLQKLMAYGGNYDSY 308

Query: 376 LVLHGSLSIGDLTAYMMYTEYTG--SSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISP 433
           +     L    +  Y    E           +  Y+ +++ A +  ++ +  +    I P
Sbjct: 309 VKTRSELETNQMKQYTKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQP 368

Query: 434 TLGKK-FVPNKGEIE--------FKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSG 484
               K F     E+E        F ++SFSY   + N ++++L F +D  S + +VGP+G
Sbjct: 369 VAADKVFSFRFPEVERLPPPVLAFDDISFSYDGNSENNLYEHLDFGVDMDSRIALVGPNG 428

Query: 485 RGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITY 544
            GKST+  ++       TGQ+      +S+ S                        ++  
Sbjct: 429 VGKSTLLKIM-------TGQLTTQSGRVSRHS------------------------HVKL 457

Query: 545 GLVEKPTQDEVRSITKKCFCHNFI-TKFPN------SYDTILGPHGT----------LLS 587
           G+  + +QD++  +TK      F+  K+P+       +   LG +G            LS
Sbjct: 458 GVYSQHSQDQL-DLTKSAL--EFVRDKYPHVSQDFQYWRGQLGRYGLTGEGQTVQMGTLS 514

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDV 618
            GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 515 EGQRSRVVFALLALEQPNVLLLDEPTNGLDI 545

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 258

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 136/317 (42%), Gaps = 45/317 (14%)

Query: 320 VQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYG----SY 375
           +++ V  ++ +KR++   R +  V     F+N     +   + DM    + AYG    SY
Sbjct: 258 LEACVWLEEYLKRFD---RTLVLVSHSQDFLNG----VCTNMLDMRLQKLTAYGGNYDSY 310

Query: 376 LVLHGSLSIGDLTAYMMYTEYTG--SSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISP 433
           +     L    +  Y    E           +  Y+ +++ A +  ++ +  +    + P
Sbjct: 311 VKTRSELETNQMKQYHKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLVQP 370

Query: 434 TLGKK-FVPNKGEIE--------FKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSG 484
            +  + F     E+E        F  +SFSY  +  N +++NL+F +D  S V +VGP+G
Sbjct: 371 VVSDRVFSFRFPEVERLPPPVLAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGPNG 430

Query: 485 RGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGT---IRDN 541
            GKST+  ++       TG++   G  +S+ +   L  +    Q +  L       +RD 
Sbjct: 431 VGKSTLLKIM-------TGELTPQGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK 483

Query: 542 ITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALI 601
             YG + +  Q          +    + ++  + +      GT LS GQ+ R+  A   +
Sbjct: 484 --YGHISEDFQ----------YWRGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLAL 530

Query: 602 KKPTILILDEATSALDV 618
            +P +L+LDE T+ LD+
Sbjct: 531 DQPNVLLLDEPTNGLDI 547

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 260

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 21/203 (10%)

Query: 467 LSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI 526
           L F   +GS++ I+GP+G GKS+I  ++   + P   +        + + S     ++  
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIW-PVYNK--------NGLLSIPSENNIFF 681

Query: 527 VQQEPVL-MSGTIRDNITYGLVEKPTQD------EVRSITKKCFCHNFITKFPN-SYDTI 578
           + Q+P     GT+RD I Y +      D      E+  I  +      + +    +Y   
Sbjct: 682 IPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDA 741

Query: 579 LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSIT 638
           +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K     
Sbjct: 742 IADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFN 797

Query: 639 IISIAHRLSTIRRSENVIVLGND 661
            ISI+ R + I+  E ++ +G +
Sbjct: 798 FISISQRPTLIKYHEMLLEIGEN 820

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 118/283 (41%), Gaps = 68/283 (24%)

Query: 417 AASRLFELTDRIPSISPTLGKKFVPNKGE---------IEFKNVSFSYPTRASNQIFKNL 467
           A SR+ +L +++P + P   +K +  K           I+ ++VSF Y    S  + K++
Sbjct: 496 AQSRIKKL-EKLPVLEPPEEEKSITFKFADCEKLSPPIIQLQDVSFGYDE--SQLLLKDV 552

Query: 468 SFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIV 527
           +  +   S + +VG +G GK+T+  +++    P TG                       V
Sbjct: 553 NLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGH----------------------V 590

Query: 528 QQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITK-FP----NSYDTILGPH 582
            + P L  G              TQ  + S+       ++++K FP      Y   LG  
Sbjct: 591 SRNPRLRIGYF------------TQHHIDSMDLNASAVDWMSKTFPGKTDEEYRRHLGAF 638

Query: 583 G----------TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-----NYT 627
           G           LLSGGQK R+A A   +  P ILILDE ++ LD     A+     N++
Sbjct: 639 GITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNHLDTAGLDALVQALKNFS 698

Query: 628 FGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670
            G LM S  I++I        I  SE+  V   DG++ +  K+
Sbjct: 699 GGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSH 423

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 21/203 (10%)

Query: 467 LSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI 526
           L F   +GS++ I+GP+G GKS+I  ++   + P   +        + + S     ++  
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIW-PVYNK--------NGLLSIPPENNIFF 681

Query: 527 VQQEPVL-MSGTIRDNITYGLVEKPTQD------EVRSITKKCFCHNFITKFPN-SYDTI 578
           + Q+P     GT+RD I Y +      D      E+  I  +      + +    +Y   
Sbjct: 682 IPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTYLDA 741

Query: 579 LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSIT 638
           +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K     
Sbjct: 742 VADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFN 797

Query: 639 IISIAHRLSTIRRSENVIVLGND 661
            ISI+ R + I+  E ++ +G +
Sbjct: 798 FISISQRPTLIKYHEMLLEIGEN 820

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 21/203 (10%)

Query: 467 LSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI 526
           L F   +GS++ I+GP+G GKS+I  ++   + P   +        + + S     ++  
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIADVW-PVYNK--------NGLLSIPSENNIFC 681

Query: 527 VQQEPVL-MSGTIRDNITYGLVEKPTQD------EVRSITKKCFCHNFITKFPN-SYDTI 578
           + Q+P     GT+RD I Y +      D      E+  I  +      + +    +Y   
Sbjct: 682 IPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTYLDA 741

Query: 579 LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSIT 638
           +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K     
Sbjct: 742 VADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFN 797

Query: 639 IISIAHRLSTIRRSENVIVLGND 661
            ISI+ R + I+  E ++ +G +
Sbjct: 798 FISISQRPTLIKYHEMLLEIGEN 820

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 87/190 (45%), Gaps = 51/190 (26%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           + F ++SF Y +  S  +++NL+F +D  S + +VGP+G GKST+  ++     P +G++
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
                           RH                 ++  G+  + +QD++  +TK     
Sbjct: 453 ---------------SRHT----------------HVKLGVYSQHSQDQL-DLTKSAL-- 478

Query: 566 NFI-TKFPN------SYDTILGPHG----------TLLSGGQKQRIAIARALIKKPTILI 608
            F+  K+P+       +   LG +G            LS GQ+ R+  A   +++P +L+
Sbjct: 479 EFVRDKYPSVSQDFQYWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLL 538

Query: 609 LDEATSALDV 618
           LDE T+ LD+
Sbjct: 539 LDEPTNGLDI 548

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {ON}
           Anc_3.534
          Length = 609

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 51/190 (26%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           + F ++SFSY     + +++NL F +D  S + +VGP+G GKST+  ++     P +G++
Sbjct: 392 LAFDSISFSYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMPQSGRV 451

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
                           RH                 ++  G+  + +QD++  +TK     
Sbjct: 452 ---------------SRHT----------------HVKLGVYSQHSQDQL-DLTKSAL-- 477

Query: 566 NFI-TKFPN------SYDTILGPHGT----------LLSGGQKQRIAIARALIKKPTILI 608
            F+  K+PN       +   LG +G            LS GQ+ R+  A   +++P +L+
Sbjct: 478 EFVRDKYPNISQDFQYWRGQLGRYGLTGEGQTVQMGTLSEGQRSRVVFALLALEQPNVLL 537

Query: 609 LDEATSALDV 618
           LDE T+ LD+
Sbjct: 538 LDEPTNGLDI 547

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 260

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 86/174 (49%), Gaps = 19/174 (10%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           + F N+SF+Y     + +++NL F +D  S + +VGP+G GKST+  ++       TGQ+
Sbjct: 391 LAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIM-------TGQL 443

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKC-FC 564
                 +S+ +   L  +    Q +  L    +          +  +D+  SI++   + 
Sbjct: 444 MAQAGRVSRHTHVKLGVYSQHSQDQLDLTKSAL----------EFVRDKYSSISQDFQYW 493

Query: 565 HNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
              + ++  + ++     GT LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 494 RGQLGRYGLTGESQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 259

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 92/190 (48%), Gaps = 19/190 (10%)

Query: 474 GSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVL 533
           GS++ I+GP+  GKS+I  ++         +I+        +S  S    M I Q+   +
Sbjct: 598 GSSLLILGPNSCGKSSIQRII--------AEIWPIYNKTGLLSIPSESDMMCIAQRPYFI 649

Query: 534 MSGTIRDNITYGLV-----EKPTQDEVRSITKKCFCHNFITKFPNSYDTI--LGPHGTLL 586
             GT RD I Y +      EK  +D       K    +++ K  ++ + +  +     +L
Sbjct: 650 QGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKLDYLLKRADALNYLDHVADWKDVL 709

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRL 646
           SGG+KQR+  AR +  +P  ++LDEAT+A+  + E   +Y F  L K +    ISI+ R 
Sbjct: 710 SGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFNMLKKFR-FNFISISQRP 765

Query: 647 STIRRSENVI 656
           S I+  + ++
Sbjct: 766 SLIKYHDYLL 775

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 51/190 (26%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           + F ++SFSY     N +++ L+F +D  S + +VGP+G GKST+  ++     P +G++
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
                           RH                 ++  G+  + +QD++  +TK     
Sbjct: 451 ---------------SRHT----------------HVKLGVYSQHSQDQL-DLTKSPL-- 476

Query: 566 NFI-TKFPN------SYDTILGPHGT----------LLSGGQKQRIAIARALIKKPTILI 608
            F+  K+PN       +   LG +G            LS GQ+ R+  A   +++P +L+
Sbjct: 477 EFVRDKYPNISQDFQYWRGQLGRYGLTGEAQTSQMGTLSEGQRSRVVFALLALEQPNVLL 536

Query: 609 LDEATSALDV 618
           LDE T+ LD+
Sbjct: 537 LDEPTNGLDI 546

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 259

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 129/308 (41%), Gaps = 49/308 (15%)

Query: 458  RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLR--YYNPTTGQIFVDGQDISKV 515
            + + +I  N+   +  G+   ++G SG GK+T+   L         TG +F+DG    K 
Sbjct: 964  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KP 1019

Query: 516  SSKSLRRHMSIVQQEPV-LMSGTIRDNITY-GLVEKPTQDEVRSITKKCFCHNFIT--KF 571
              +S  R +   QQ+ + L + T+R+++ +   + +P   EV    K  +  + I   + 
Sbjct: 1020 RDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEM 1077

Query: 572  PNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALDVESEGAINYTFGK 630
                D I+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     K
Sbjct: 1078 EKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMRK 1137

Query: 631  LMKSKSITIISIAHRLSTIRRSE--NVIVLGNDGSVAEVGKFKE---------------- 672
            L       + +I H+ S I   E   ++ +   G     G+  E                
Sbjct: 1138 LCNQGQAILCTI-HQPSAILMQEFDRLLFMQRGGQTCYFGELGEGCHKMIDYFESHGSHK 1196

Query: 673  --------------LYADPGSELSKLLHEKATRSERQQNTAEDQEIDPEET-INIENSTP 717
                          + A PGS  ++  HE    SE  Q  A  +E+D  ET +  +NS  
Sbjct: 1197 CPPDANPAEWMLEVVGAAPGSHANQDYHEVWRNSEEYQ--AVQRELDWMETELPKKNSDA 1254

Query: 718  ESDITQEL 725
            E  + +E 
Sbjct: 1255 EQVVHKEF 1262

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 94/207 (45%), Gaps = 29/207 (14%)

Query: 467 LSFKIDAGSNVCIVGPSGRGKSTIASLLLRY---YNPTTGQIFVDGQDISKVSSKSLRRH 523
           L F    GS++ I+GP+  GKS+I  ++      YN   G + +  +D            
Sbjct: 676 LPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED----------EL 724

Query: 524 MSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH-------NFITKFPN--S 574
           M I Q+      GT RD I Y +      D  R +  K            ++ K     S
Sbjct: 725 MCIPQRPYFSKGGTFRDQIIYPMGSDEFFD--RGLKDKLLVQILADVKLEYLLKRDKGWS 782

Query: 575 YDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKS 634
           Y   +     +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +Y F K++K 
Sbjct: 783 YFDAVFDWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KMLKK 838

Query: 635 KSITIISIAHRLSTIRRSENVIVLGND 661
                ISI+ R S ++  + ++ +  D
Sbjct: 839 YRFNFISISQRPSLVKYHDLLLEISED 865

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 107/222 (48%), Gaps = 18/222 (8%)

Query: 458  RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP--TTGQIFVDGQDISKV 515
            R S +I  N+   +  G+   ++G SG GK+T+   L         TG IFVDG    K+
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDG----KL 921

Query: 516  SSKSLRRHMSIVQQEPV-LMSGTIRDNITY-GLVEKPTQ---DEVRSITKKCFCHNFITK 570
              +S  R +   QQ+ + L + T+R+++ +  ++ +P      E R   ++    N +  
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVI--NVLEM 979

Query: 571  FPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALDVESEGAINYTFG 629
             P + D I+G  G  L+  Q++R+ I   L+ KP +LI LDE TS LD ++  +I     
Sbjct: 980  EPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQLIR 1038

Query: 630  KLMKSKSITIISIAHRLST--IRRSENVIVLGNDGSVAEVGK 669
            KL  ++   I+   H+ S   I+  + ++ L   G     G+
Sbjct: 1039 KL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 118/251 (47%), Gaps = 31/251 (12%)

Query: 428 IPSISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQI--FK-----NLSFKIDAGSNVCIV 480
           IPS     G K +   G + F+  S   P+  S+ I  FK     N+      G+++ I+
Sbjct: 581 IPSRRAGRGAKLI---GTLTFQIPSVIEPSSKSSSIQDFKKNFDPNVPLIDSTGASLLIL 637

Query: 481 GPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLM-SGTIR 539
           GP+  GKS+I  ++   + P   +       +  + + S   ++  V Q P     GT R
Sbjct: 638 GPNSCGKSSIQRIITEVW-PVYNK-----NGLLSIPAPS---NLFCVPQRPYFTRGGTFR 688

Query: 540 DNITYGL-----VEKPTQDE-VRSITKKCFCHNFITK-FPNSYDTILGPHGTLLSGGQKQ 592
           D I Y +      ++  +D+ +  I K+      + +    SY   +     +LSGG+KQ
Sbjct: 689 DQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGCSYMDAVADWKDVLSGGEKQ 748

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRS 652
           R+  AR L  +P  ++LDEAT+A+ V+ E   +Y F  L+K      I+I+ R S I+  
Sbjct: 749 RMNFARILFHRPRFVVLDEATNAISVDME---DYLFN-LLKRYRFNFITISQRPSLIKYH 804

Query: 653 ENVIVLGNDGS 663
           + ++ + + GS
Sbjct: 805 DMLLEVDSSGS 815

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 103/236 (43%), Gaps = 40/236 (16%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           I+ ++VSF Y  +  N + K+++  +   S + +VG +G GK+T+  +++    P  G +
Sbjct: 531 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYV 588

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP--TQDEVRSITKKCF 563
             +G           R  +    Q  V      +  + +  V+ P  T +E R       
Sbjct: 589 SSNG-----------RLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYR------- 630

Query: 564 CHNFITKFPNSYDTILGPHG----TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
               +  F      I G  G     LLSGGQK R+A A   +  P IL+LDE ++ LD  
Sbjct: 631 --RHLGSF-----GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNT 683

Query: 620 SEGAI-----NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670
              A+     N++ G LM S  I++I    +   I  SEN  V   DG++ +   +
Sbjct: 684 GLDALVESLKNFSGGVLMVSHDISVIDSVCK--EIWVSENGTVRRFDGTIHDYKDY 737

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSH 421

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 112/277 (40%), Gaps = 75/277 (27%)

Query: 417 AASRLFELTDRIPSISPTLGKKFVPNKGE---------IEFKNVSFSYPTRASNQIFKNL 467
           A SR+ +L +++P + P  G+K V  K           I+ ++V+F Y    +N + K++
Sbjct: 495 AQSRIKKL-EKLPVLEPPEGEKSVSFKFPECSKLSPPIIQLQDVTFGY--NENNLLLKDV 551

Query: 468 SFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIV 527
           +  +   S + +VG +G GK+T+  +++    P  G                       V
Sbjct: 552 NLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKG----------------------YV 589

Query: 528 QQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITK-FP----NSYDTILGPH 582
            + P L  G               Q  V ++        +++K FP      Y   LG  
Sbjct: 590 SRNPRLRLGYF------------AQHHVDAMDLNASAVEWMSKTFPGRSDEEYRRHLGSF 637

Query: 583 G----------TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-----NYT 627
           G           LLSGGQK R+A A   +  P +LILDE ++ LD     A+     N+T
Sbjct: 638 GITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTSGIDALVDALKNFT 697

Query: 628 FGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSV 664
            G LM         ++H +S I    N I +  DGS 
Sbjct: 698 GGVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   TI+ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSH 422

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 101/243 (41%), Gaps = 65/243 (26%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           I+ ++VSF Y  +  N + K+++  +   S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
             +G                             R  I Y      TQ  V S+       
Sbjct: 590 SRNG-----------------------------RLRIGYF-----TQHHVDSMDLTTSAV 615

Query: 566 NFITK-FP----NSYDTILGPHG----------TLLSGGQKQRIAIARALIKKPTILILD 610
           ++++K FP      Y   LG  G           LLSGGQK R+A A   +  P ILILD
Sbjct: 616 DWMSKTFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILD 675

Query: 611 EATSALDVESEGAI-----NYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVA 665
           E ++ LD     A+     N++ G LM         ++H +S I    N I +  +G+V 
Sbjct: 676 EPSNHLDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVK 726

Query: 666 EVG 668
           + G
Sbjct: 727 KFG 729

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] {ON}
            highly similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011w SNQ2 multidrug resistance protein
          Length = 1507

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 124/273 (45%), Gaps = 25/273 (9%)

Query: 440  VPNKGEIEFKNVSFSYPTRAS-NQIFKNLSFKIDAGSNVCIVGPSGRGKSTIA-SLLLRY 497
            + +KG   ++NV ++ P      Q+  N+S     G+   ++G SG GK+T+  +L  R 
Sbjct: 851  LESKGIFIWRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLAQRN 910

Query: 498  YNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSG-TIRDNITY--------GLVE 548
                TG + V+G+ I      S  R    VQQ+ + +S  T+R+++ +         + E
Sbjct: 911  VGIITGDMLVNGKPI----DISFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPE 966

Query: 549  KPTQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI 608
            +   + V  I K       +       D ++G  G  L+  Q+++++I   L+ KP +L+
Sbjct: 967  EEKMEHVERIIK-------VLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLL 1019

Query: 609  -LDEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEV 667
             LDE TS LD +S  AI     KL K+    + +I    +T+    + ++L   G   + 
Sbjct: 1020 FLDEPTSGLDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKG--GQT 1077

Query: 668  GKFKELYADPGSELSKLLHEKATRSERQQNTAE 700
              F ++  +  + LS      A +    +N AE
Sbjct: 1078 VYFGDIGDNSKTLLSYFERNGARKCSPSENPAE 1110

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 106/253 (41%), Gaps = 26/253 (10%)

Query: 463 IFKNLSFKIDAGSNVCIVGPSGRGKSTI----ASLLLRYYNPTTGQIFVDGQDISKVSSK 518
           I  ++S    AG  V ++G  G G S++    A  + ++     G+I  DG    ++  +
Sbjct: 177 ILNDVSGLARAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKR 236

Query: 519 SLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFC------HNFITKFP 572
                +   +Q+      T++  + + +  K     V  ++++ +       H  I    
Sbjct: 237 YKPDVIYNGEQDVHFPHLTVQQTLDFAIACKTPSKRVNDVSREEYIASTRDLHATIFGLR 296

Query: 573 NSYDTILGPHGTL-LSGGQKQRIAIARALIKKPTILILDEATSALD----VESEGAINYT 627
           ++Y T +G      +SGG+++R++IA AL+ K +I   D AT  LD    +E   AI  T
Sbjct: 297 HTYHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRIT 356

Query: 628 FGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687
              L  +  +TI          + SEN+    +  +V   G  +++Y  P  E     + 
Sbjct: 357 TNLLGSTAFVTI---------YQASENIYETFDKVTVLYTG--RQIYFGPIDEAKDYFYR 405

Query: 688 KATRSERQQNTAE 700
                  +Q TAE
Sbjct: 406 MGYECPPRQVTAE 418

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 99/203 (48%), Gaps = 21/203 (10%)

Query: 467 LSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSI 526
           L F   +GS++ I+GP+  GKS+I  ++   + P   +       +  + S++   ++  
Sbjct: 631 LPFLQGSGSSLLILGPNSCGKSSIQRIIAEIW-PVYNK-----NGLLSIPSEN---NIFC 681

Query: 527 VQQEPVL-MSGTIRDNITYGLVEKPTQD------EVRSITKKCFCHNFITKFPN-SYDTI 578
           + Q+P     GT+RD I Y +      D      E+  I  +      + +    +Y   
Sbjct: 682 IPQKPYFSKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTYLDA 741

Query: 579 LGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSIT 638
           +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K     
Sbjct: 742 VADWKDLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFN 797

Query: 639 IISIAHRLSTIRRSENVIVLGND 661
            ISI+ R + I+  E ++ +G +
Sbjct: 798 FISISQRPTLIKYHEMLLEIGEN 820

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 113/275 (41%), Gaps = 72/275 (26%)

Query: 417 AASRLFELTDRIPSISPTLGKKFVPNKGE---------IEFKNVSFSYPTRASNQIFKNL 467
           A SR+ +L +++P + P    K +  K           I+ ++VSF Y  +  N + K++
Sbjct: 495 AQSRIKKL-EKLPVLEPPEQDKIIDFKFPECDKLSPPIIQLQDVSFGYDEK--NLLLKDV 551

Query: 468 SFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIV 527
           +  +   S + +VG +G GK+T+  +++    P  G                       V
Sbjct: 552 NLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKG----------------------FV 589

Query: 528 QQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITK-FP----NSYDTILGPH 582
            + P L  G              TQ  V S+       ++++K FP      Y   LG  
Sbjct: 590 SRNPRLRIGYF------------TQHHVDSMDLTTSAVDWMSKSFPGKTDEEYRRHLGSF 637

Query: 583 G----------TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-----NYT 627
           G           LLSGGQK R+A A   +  P IL+LDE ++ LD     A+     N+ 
Sbjct: 638 GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVDALKNFN 697

Query: 628 FGKLMKSKSITII-SIAHRL-----STIRRSENVI 656
            G LM S  I++I S+   +      T++R E  I
Sbjct: 698 GGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 79/354 (22%), Positives = 143/354 (40%), Gaps = 59/354 (16%)

Query: 350 INAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYS 409
           IN +  ++   + +   ++ LA     ++H    I  LT Y        + IF L T   
Sbjct: 451 INNEEVNMREFIVNKRLMLSLADAGSRLMHSFKDIAQLTGYT-------NRIFTLLTVLH 503

Query: 410 EIMQGAGAASRLFELT-DRIPSISPTLGKKFVP-----NKGEIEFKNVSFSYPT---RAS 460
            +     +   L E   D + SI P+   + V      N   I F+N+    P+   R  
Sbjct: 504 RVHSSVYSYGALAEDDGDSVDSIDPSANSELVCGTVQRNFNGIRFENIDVVIPSKFGRDG 563

Query: 461 NQIFKNLSFKI------------------------DAGSNVCIVGPSGRGKSTIASLLLR 496
            ++   L F++                          GS++ I+GP+G GK++I  ++  
Sbjct: 564 IKLINRLRFQVPPVIGLDNNNSDSQINLSQKLMFKGPGSSMLILGPNGSGKTSIQRII-- 621

Query: 497 YYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQD--- 553
                  +I+        +S  + R  + I Q+   +  GT R+ I Y +      D   
Sbjct: 622 ------AEIWPIYNKNGLLSVPAERELICIPQKPYFIQGGTFREQIIYPMSADQYFDLGY 675

Query: 554 ---EVRSITKKCFCHNFITKFPN-SYDTILGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
              E+  + K+      + +     Y   +     +LSGG++QR+  AR +  KP  ++L
Sbjct: 676 RDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKDVLSGGERQRMNFARIMFHKPKFVVL 735

Query: 610 DEATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGS 663
           DEAT+A+  + E   +Y F  ++K      I+I+ R S I+  +  + +G D S
Sbjct: 736 DEATNAISADME---DYLFN-MLKRYRFNFITISQRPSLIKYHDLALEIGADES 785

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 126/304 (41%), Gaps = 49/304 (16%)

Query: 446  IEFKNVSFSYPTRA-SNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLR--YYNPTT 502
              ++N+ +    +  + +I  N+   +  G+   ++G SG GK+T+   L         T
Sbjct: 893  FHWRNLCYDVQIKTETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVIT 952

Query: 503  GQIFVDGQDISKVSSKSLRRHMSIVQQEPV-LMSGTIRDNITY-GLVEKPTQDEVRSITK 560
            G +F+DG    K   +S  R +   QQ+ + L + T+R+++ +   + +P   EV    K
Sbjct: 953  GDVFIDG----KPRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEK 1006

Query: 561  KCFCHNFIT--KFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +  + I   +     D I+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD
Sbjct: 1007 NAYVEDIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1066

Query: 618  VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSE--NVIVLGNDGSVAEVGKFKE--- 672
             ++  AI     KL       + +I H+ S I   E   ++ +   G     G+  E   
Sbjct: 1067 SQTAWAICQLMRKLCNQGQAILCTI-HQPSAILMQEFDRLLFMQRGGQTCYFGELGEGCH 1125

Query: 673  ---------------------------LYADPGSELSKLLHEKATRSERQQNTAEDQEID 705
                                       + A PGS  ++  HE    SE  Q  A  +E+D
Sbjct: 1126 KMIDYFESHGSHKCPPDANPAEWMLEVVGAAPGSHANQDYHEVWRNSEEYQ--AVQRELD 1183

Query: 706  PEET 709
              ET
Sbjct: 1184 WMET 1187

>YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Putative
            transporter of the ATP-binding cassette (ABC) family,
            implicated in pleiotropic drug resistance; the authentic,
            non-tagged protein is detected in highly purified
            mitochondria in high-throughput studies
          Length = 1333

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 146/315 (46%), Gaps = 20/315 (6%)

Query: 444  GEIEFKNVSFSYP-TRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLL-RYYNPT 501
            G   +KNVSF+ P +    ++  ++S     G+   ++G SG GK+T+ + L  R     
Sbjct: 727  GVFIWKNVSFTIPHSSGQRKLLDSVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTI 786

Query: 502  TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSG-TIRDNITYGLVEKPTQDEVRSITK 560
            TG + VDG  +      S +R    VQQ+ + ++  T+++++ +    +  Q  +    K
Sbjct: 787  TGDMLVDGLPM----DASFKRRTGYVQQQDLHVAELTVKESLQFSARMRRPQS-IPDAEK 841

Query: 561  KCFCHNFIT--KFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +    I+  +     + ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS LD
Sbjct: 842  MEYVEKIISILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGLD 901

Query: 618  VESEGAINYTFGKLMKSKSITIISIAHRLSTI-RRSENVIVLGNDGSVAEVGKFKELYAD 676
             +S  A+     +L  +    + +I    +T+  + + +++LG  G     G   E+  +
Sbjct: 902  SQSAWAVVKMLKRLALAGQSILCTIHQPSATLFEQFDRLLLLGKGGQTIYFG---EIGKN 958

Query: 677  PGSELSKLLHEKATRSERQQNTAED--QEIDPEETINIENSTPESDITQELLENP-IKEA 733
              S +       A + ++ +N AE   + I    T +++ + P  DI Q+  E   I E 
Sbjct: 959  SSSVIKYFEKNGARKCQQNENPAEYILEAIGAGATASVQQNWP--DIWQKSHEYANINEK 1016

Query: 734  IMDVAADNKPITPRK 748
            I D+  D    T  K
Sbjct: 1017 INDMIKDLSSTTLHK 1031

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 109/266 (40%), Gaps = 51/266 (19%)

Query: 463 IFKNLSFKIDAGSNVCIVGPSGRG-----KSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517
           I KN+S    +G  V ++G  G G     KS            TTG I  DG     +  
Sbjct: 45  ILKNVSLLAKSGEMVLVLGRPGAGCTSFLKSAAGETSQFAGGVTTGHISYDG-----IPQ 99

Query: 518 KSLRRHMSIVQQEPVLMSG---------TIRDNITYGLVEKPTQDEVRSITKKCF----- 563
           K + +H     +  V+ +G         T++  + + +  K     V ++TK+ +     
Sbjct: 100 KEMMQHY----KPDVIYNGEQDVHFPHLTVKQTLDFAISCKMPAKRVNNVTKEEYITANR 155

Query: 564 ---------CHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
                     H F TK  N  D I G     +SGG+++R++IA AL  K +I   D AT 
Sbjct: 156 EFYAKIFGLTHTFDTKVGN--DFISG-----VSGGERKRVSIAEALAAKGSIYCWDNATR 208

Query: 615 ALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY 674
            LD  S  A+   F + +++ +  ++     ++  + SEN+    +  +V   G  ++++
Sbjct: 209 GLD--SSTALE--FARAIRTMT-NLLGTTALVTVYQASENIYETFDKVTVLYAG--RQIF 261

Query: 675 ADPGSELSKLLHEKATRSERQQNTAE 700
               +E              +Q+TAE
Sbjct: 262 CGKTTEAKDYFENMGYLCPPRQSTAE 287

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 100/238 (42%), Gaps = 55/238 (23%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           I+ ++VSF Y  ++   + K+++  +   S + +VG +G GK+T+  +++    PT+G +
Sbjct: 532 IQLQDVSFGYEEQSL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
             +G                             R  I Y      TQ  V S+       
Sbjct: 590 SRNG-----------------------------RLRIGYF-----TQHHVDSMDLNTSAV 615

Query: 566 NFITK-FP----NSYDTILGPHG----------TLLSGGQKQRIAIARALIKKPTILILD 610
           ++++K +P      Y   LG  G           LLSGGQK R+A A   +  P IL+LD
Sbjct: 616 DWMSKTYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLD 675

Query: 611 EATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVG 668
           E ++ LD     A+     K        ++ ++H +S I    N I +  DG+V + G
Sbjct: 676 EPSNHLDTTGLEALVDALKKFTGG----VLMVSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 112/268 (41%), Gaps = 68/268 (25%)

Query: 404 LSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGE---------IEFKNVSFS 454
           +  F     + + A SR+ +L +++P + P   +K +  K           I+ ++VSF 
Sbjct: 482 IDKFRYNAAKSSEAQSRIKKL-EKLPVLEPPEQEKSIDFKFPDCEKLSPPIIQLQDVSFG 540

Query: 455 Y-PTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
           Y P +    + K+++  I   S + +VG +G GK+T+  ++L    P +G          
Sbjct: 541 YSPDKL---LLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSG---------- 587

Query: 514 KVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITK-FP 572
                        V + P L  G              TQ  V S+       ++++K FP
Sbjct: 588 ------------YVSRNPRLRIGYF------------TQHHVDSMDLSTSAVDWMSKTFP 623

Query: 573 ----NSYDTILGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                 Y   LG  G           LLSGGQK R+A A   +  P ILILDE ++ LD 
Sbjct: 624 GKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDT 683

Query: 619 ESEGAI-----NYTFGKLMKSKSITIIS 641
               A+     N+T G LM S  I++I+
Sbjct: 684 TGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534
           YER036C
          Length = 660

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 83/188 (44%), Gaps = 47/188 (25%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           + F N+SF+Y  +  + +++NL F +D  S + +VGP+G GKST+  ++       TG++
Sbjct: 443 LAFDNISFAYDGKKEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIM-------TGEL 495

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKC--F 563
                 +S        RH                 ++  G+  + +QD++  +TK    F
Sbjct: 496 MAQTGRVS--------RHT----------------HVKLGVYSQHSQDQL-DLTKSALEF 530

Query: 564 CHNFITKFPNSYDTILGPHGTL-------------LSGGQKQRIAIARALIKKPTILILD 610
             +  +     +    G  G               LS GQ+ R+  A   +++P +L+LD
Sbjct: 531 VRDKYSNISQDFQYWRGQLGRFGLTGEGQTVQMGTLSEGQRSRVVFALLALEQPNVLLLD 590

Query: 611 EATSALDV 618
           E T+ LD+
Sbjct: 591 EPTNGLDI 598

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 277 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 311

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar to
            uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15 ATP
            binding cassette (ABC) transporter of the plasma membrane
            general stress response factor implicated in cellular
            detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1462

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 121/258 (46%), Gaps = 28/258 (10%)

Query: 442  NKGE--IEFKNVSFSYPTRA-SNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYY 498
            NK E    ++NV +    ++ + +I  N+   +  G+   ++G +G GK+T+   L +  
Sbjct: 813  NKSEAIFHWRNVCYDVQIKSETRRILDNIDGWVKPGTLTALMGATGAGKTTLLDSLAQRV 872

Query: 499  NP--TTGQIFVDGQDISKVSSKSLRRHMSIVQQEPV-LMSGTIRDNITY-GLVEKPTQ-- 552
                 TG IFVDG    K+  +S  R +   QQ+ + L + T+R+++ +  ++ +P    
Sbjct: 873  TTGVLTGSIFVDG----KLRDESFARSIGYCQQQDLHLTTATVRESLLFSAMLRQPKSVP 928

Query: 553  -DEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI-LD 610
              E R   ++    N +   P + D I+G  G  L+  Q++R+ I   L  KP +L+ LD
Sbjct: 929  ASEKRKYVEEVI--NVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELAAKPNLLLFLD 985

Query: 611  EATSALDVESEGAINYTFGKLMKSKSITIISIAHRLST--IRRSENVIVLGNDGSVAEVG 668
            E TS LD ++  +I     KL  ++   I+   H+ S   I+  + ++ L   G     G
Sbjct: 986  EPTSGLDSQTAWSICQLMKKL-ANRGQAILCTIHQPSAMLIQEFDRLLFLQKGGQTVYFG 1044

Query: 669  KFKELYADPGSELSKLLH 686
                   D G +   ++H
Sbjct: 1045 -------DLGKDCKSMIH 1055

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 109/263 (41%), Gaps = 30/263 (11%)

Query: 456 PTRASN--QIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDIS 513
           PTR S+  QI K +   +D G  + ++G  G G +T   LL    + T G        IS
Sbjct: 113 PTRKSDIFQILKPMDGALDPGEVLVVLGRPGSGCTT---LLKSIASNTHGFNIAKDSTIS 169

Query: 514 K--VSSKSLRRHM--SIV---QQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHN 566
              +S K + RH    +V   + +  L   T+   +      K  Q+ ++ + ++ +  +
Sbjct: 170 YSGLSPKDINRHFRGEVVYNAETDIHLPHLTVYQTLLTVSRLKTPQNRIKGVDRETWARH 229

Query: 567 FITKFPNSY------DTILGPHGTL---LSGGQKQRIAIARALIKKPTILILDEATSALD 617
                  +Y      +T +G  G L   +SGG+++R++IA   I        D AT  LD
Sbjct: 230 MTDVVMATYGLSHTKNTKVG--GDLVRGVSGGERKRVSIAEVTICGSKFQCWDNATRGLD 287

Query: 618 VESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP 677
                A    F K +++++  + S A  ++  + S+N   L +   V   G   +++   
Sbjct: 288 ----AATALEFIKALRTQADILASTAC-IAIYQCSQNAYDLFDKVCVLYSG--YQIFFGS 340

Query: 678 GSELSKLLHEKATRSERQQNTAE 700
             +  +   E       +Q TA+
Sbjct: 341 AGDAKRYFEEMGYHCPSRQTTAD 363

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 97/237 (40%), Gaps = 62/237 (26%)

Query: 446 IEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQI 505
           I+ ++VSF Y    +N + K+++  +   S + +VG +G GK+T+  +++    P  G  
Sbjct: 532 IQLQDVSFGYD--ENNLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKG-- 587

Query: 506 FVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH 565
                                V + P L  G              TQ  V S+       
Sbjct: 588 --------------------FVSRNPRLRIGYF------------TQHHVDSMDLTTSAV 615

Query: 566 NFITK-FP----NSYDTILGPHG----------TLLSGGQKQRIAIARALIKKPTILILD 610
           ++++K FP      Y   LG  G           LLSGGQK R+A A   +  P IL+LD
Sbjct: 616 DWMSKSFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLD 675

Query: 611 EA-----TSALDVESEGAINYTFGKLMKSKSITII-SIAHRL-----STIRRSENVI 656
           E      T+ LD   E   N+  G LM S  I++I S+   +      T++R E  I
Sbjct: 676 EPSNHLDTTGLDALVEALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITIISIAH 644
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 128/276 (46%), Gaps = 23/276 (8%)

Query: 442  NKGEIEFKNVSFSYPTRASN-QIFKNLSFKIDAGSNVCIVGPSGRGKSTIA-SLLLRYYN 499
            ++G   +K+V ++ P +    Q+  N+S     G+   ++G SG GK+T+  +L  R   
Sbjct: 833  SEGVFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAGKTTLLNTLAQRNVG 892

Query: 500  PTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPV-LMSGTIRDNITYGL-VEKPTQDEVRS 557
              TG + V+G  I      S  R    VQQ+ + +   T+R+++ +   + +P  + +  
Sbjct: 893  IITGDMLVNGSPI----DASFERRTGYVQQQDIHIKEMTVRESLQFSARMRRP--ESIPD 946

Query: 558  ITKKCFCHNFIT--KFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATS 614
              K  +    I         D ++G  G  L+  Q+++++I   L  KP +L+ LDE TS
Sbjct: 947  SEKMSYVEKLIEILGMQEYADALVGDVGYGLNVEQRKKLSIGVELAAKPNLLLFLDEPTS 1006

Query: 615  ALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELY 674
             LD ++  AI     KL ++    + +I    +T+    + ++L   G        + +Y
Sbjct: 1007 GLDSQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGG-------QTVY 1059

Query: 675  ADPGSELSKLLHEKATRSERQQNTAEDQEIDPEETI 710
              P  E S++L +   R+  +Q   ED E +P E I
Sbjct: 1060 FGPIGEHSRVLLDYFERNGARQ--CEDSE-NPAEYI 1092

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 99/211 (46%), Gaps = 24/211 (11%)

Query: 462 QIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSLR 521
            I K L+F+   GS++ I+GP+G GK++I  ++   +      I+     +S   +  L 
Sbjct: 589 NINKKLAFQ-GPGSSMLILGPNGSGKTSIQRIIAEIW-----PIYNKNGLLSIPPASDL- 641

Query: 522 RHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCH-------NFITKFPNS 574
               + Q+   +  GT R+ I Y +      D       K   H       +++ K    
Sbjct: 642 --FCVPQKPYFIQGGTFREQIIYPMSADQYFD--MGYRDKELTHILGEVKLDYLLKRDKG 697