Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.826.6ON62623192e-40
Klac_YGOB_Anc_6.66.6ON61622152e-24
Sklu_YGOB_Anc_6.66.6ON61622152e-24
Kthe_YGOB_Anc_6.66.6ON62612118e-24
TPHA0J002306.6ON62622056e-23
Skud_16.66.6ON62622056e-23
Kwal_56.223336.6ON62622047e-23
TDEL0G046506.6ON62621986e-22
ZYRO0F00418g6.6ON62601979e-22
Smik_6.4796.6ON62621952e-21
Suva_16.346.6ON62601935e-21
NDAI0I027406.6ON66591917e-21
TBLA0A072006.6ON65621892e-20
YPL271W (ATP15)6.6ON62601882e-20
CAGL0A01111g6.6ON69611882e-20
KNAG0E027906.6ON65631866e-20
KAFR0B064906.6ON66611666e-17
NCAS0D022006.6ON85601616e-16
Ecym_30086.6ON61621397e-13
ACR021W6.6ON62621381e-12
Suva_8.1895.474ON62626591.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.82
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...   127   2e-40
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    87   2e-24
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    87   2e-24
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    86   8e-24
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    84   6e-23
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       84   6e-23
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    83   7e-23
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    81   6e-22
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    80   9e-22
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    80   2e-21
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    79   5e-21
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    78   7e-21
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    77   2e-20
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    77   2e-20
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    77   2e-20
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    76   6e-20
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    69   6e-17
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    67   6e-16
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    58   7e-13
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    58   1e-12
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...    27   1.9  

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score =  127 bits (319), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 61 QQ 62
          QQ
Sbjct: 61 QQ 62

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 87.4 bits (215), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (83%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MS WRKAG+T+N YV++AA TVR ALK EL+TN+VLARSK+EAKF+ FENG    EPVP+
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPL 59

Query: 61 QQ 62
          ++
Sbjct: 60 KK 61

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 87.4 bits (215), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 52/62 (83%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAG+TYN Y++IAA+TVR ALK E +T  VL+RSK+EAKF+ FENG P  +P+P+
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59

Query: 61 QQ 62
          ++
Sbjct: 60 KK 61

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 85.9 bits (211), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 48/61 (78%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAG+TYN Y+ IAAQTVR ALKN+L+T  VL RSKTEA+F+ +E G P  E  P+
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 61 Q 61
          +
Sbjct: 61 K 61

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 83.6 bits (205), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MS WRKAG+TY+ Y+ +AA+TVR++LKN+LKTN+VL+RSKT+ K+  FE G  K EP  I
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

Query: 61 QQ 62
            
Sbjct: 61 SD 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 83.6 bits (205), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAGI+Y  Y+N+AAQT+R +LK EL+T +VL+RSKT+A +  ++NGA   EP PI
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 61 QQ 62
           +
Sbjct: 61 TK 62

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 83.2 bits (204), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 47/62 (75%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAG+TYN Y+ IAAQTVR ALK E +T  VL RSKTEA+FV +ENG    E  P+
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 61 QQ 62
          ++
Sbjct: 61 KE 62

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 80.9 bits (198), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 50/62 (80%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          M+AWRKAG+TYN Y+++AA+TVR ALK EL+   VLARSKT+A++V +E G+   + VP+
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 61 QQ 62
          Q+
Sbjct: 61 QE 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 80.5 bits (197), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 47/60 (78%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAG+TYN Y+++AA+TVR ALK E +T  VL+R + ++K+  FE G P+GEP P+
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 79.7 bits (195), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 48/62 (77%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAGI+Y  Y+N+AA+ +R +LK EL+T +VL+RSKT+A +  ++NGA   EP PI
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 61 QQ 62
           +
Sbjct: 61 TK 62

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 79.0 bits (193), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (76%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAG++Y  Y+N+AAQT+R +LK EL+T  VL+RS+T+A +  ++NG    EPV I
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 78.2 bits (191), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 47/59 (79%)

Query: 4  WRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPIQQ 62
          WRKAGITY+ Y++IAA+T+R ALK EL+T TV+ARS T+A F  +++GAP  EP  +Q+
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 77.4 bits (189), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAGITYN Y+ IAA+TVR ALK EL+T  V+ RS TEA+F  +  G+P  +P  +
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

Query: 61 QQ 62
          ++
Sbjct: 61 KE 62

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 77.0 bits (188), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAGI+Y  Y+N+AAQ +R +LK EL+T +VL RS+T+A +  ++NG    EP PI
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 77.0 bits (188), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 49/61 (80%)

Query: 2  SAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPIQ 61
          +AWRKAG++Y+ ++ IAA+TVR++LK EL+T  V+ R KT+A +  +E G+PK +P+P+Q
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 62 Q 62
          +
Sbjct: 69 E 69

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 76.3 bits (186), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 47/63 (74%), Gaps = 1/63 (1%)

Query: 1  MSA-WRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVP 59
          MSA W+KAGITY  Y+N+ A+T+R ALKNEL+T  VL+R  T+A +  +E G PK +P P
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 60 IQQ 62
          +Q+
Sbjct: 61 LQE 63

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 68.6 bits (166), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 45/61 (73%)

Query: 2  SAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPIQ 61
          S WRKAG+TY  Y++IA++T+R+ LK E +T  V +RS TEA   +++NG+P  +P P+Q
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 62 Q 62
          +
Sbjct: 63 K 63

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 66.6 bits (161), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 43/60 (71%)

Query: 2  SAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPIQ 61
          +  RKAG+TY  Y+ +A++T+R +LK EL+T  V+ARS T+A +  +E G+P  +P P+Q
Sbjct: 22 ATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQ 81

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 58.2 bits (139), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAG++YN Y+ +AA+ VR ALK ELK   VL+RS TEAK +++++GA   + VP+
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVPL 59

Query: 61 QQ 62
          ++
Sbjct: 60 KK 61

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 57.8 bits (138), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (72%)

Query: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60
          MSAWRKAG+TYN Y+ +AA+TVR ALK EL++  VL RS TEAK + + +     E VP+
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 61 QQ 62
          ++
Sbjct: 61 RK 62

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score = 27.3 bits (59), Expect = 1.9,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 6   KAGITYNGYVNIAAQTVRKALKNELK 31
           + GI YN Y+ + A+ ++  LKN +K
Sbjct: 108 QTGIFYNSYLYVHAKNIQSKLKNSIK 133

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.125    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,078,474
Number of extensions: 169391
Number of successful extensions: 374
Number of sequences better than 10.0: 21
Number of HSP's gapped: 374
Number of HSP's successfully gapped: 21
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)