Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.806.7ON1019101944820.0
ZYRO0F00440g6.7ON103969216630.0
TDEL0G046406.7ON101768716270.0
NCAS0F001806.7ON101870416100.0
KAFR0L003306.7ON102871915130.0
NDAI0K029106.7ON106372915140.0
Skud_5.346.7ON101970715060.0
YEL055C (POL5)6.7ON102270614820.0
Smik_5.326.7ON102070514480.0
Suva_5.136.7ON102370714271e-180
CAGL0B03553g6.7ON102169914271e-180
KNAG0E009706.7ON100470214051e-177
SAKL0E00770g6.7ON104772113991e-176
TPHA0J002506.7ON102469813761e-173
KLLA0D00792g6.7ON102070813511e-169
ACR020C6.7ON100271112931e-161
Ecym_30096.7ON102772612791e-158
TBLA0A072106.7ON104171312341e-152
Kwal_56.223346.7ON100871411411e-139
KLTH0C11594g6.7ON100671210841e-130
CAGL0L02827g8.623ON684171930.023
CAGL0L08360g2.217ON94684772.2
YKL101W (HSL1)2.479ON1518104736.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.80
         (1019 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...  1731   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   645   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   631   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   624   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   587   0.0  
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   587   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   584   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   575   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   562   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   554   e-180
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   554   e-180
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   545   e-177
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   543   e-176
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   534   e-173
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   525   e-169
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   502   e-161
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   497   e-158
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   479   e-152
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   444   e-139
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   422   e-130
CAGL0L02827g Chr12 complement(330885..332939) [2055 bp, 684 aa] ...    40   0.023
CAGL0L08360g Chr12 complement(920859..923699) [2841 bp, 946 aa] ...    34   2.2  
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    33   6.0  

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa] {ON}
            complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score = 1731 bits (4482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/1019 (86%), Positives = 879/1019 (86%)

Query: 1    MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNS 60
            MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNS
Sbjct: 1    MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNS 60

Query: 61   ARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120
            ARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG
Sbjct: 61   ARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120

Query: 121  IMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQ 180
            IMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQ
Sbjct: 121  IMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQ 180

Query: 181  TVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLPLESQGWKL 240
            TVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLPLESQGWKL
Sbjct: 181  TVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLPLESQGWKL 240

Query: 241  NDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPILLGQDSTTNDEH 300
            NDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPILLGQDSTTNDEH
Sbjct: 241  NDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPILLGQDSTTNDEH 300

Query: 301  VXXXXXXXXXXXXXXXXXXXWKMVVDESFFNEKSSSERKYLGFLIIQKSLELVPAQLVES 360
            V                   WKMVVDESFFNEKSSSERKYLGFLIIQKSLELVPAQLVES
Sbjct: 301  VSKKQKSKTTSSTSIKFQSFWKMVVDESFFNEKSSSERKYLGFLIIQKSLELVPAQLVES 360

Query: 361  LFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPIVKVILFGENGATNF 420
            LFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPIVKVILFGENGATNF
Sbjct: 361  LFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPIVKVILFGENGATNF 420

Query: 421  DXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQFVLDTILHVVRNHKL 480
            D                 EEETLSQIFIMLSNEIKGSSESIQKDQFVLDTILHVVRNHKL
Sbjct: 421  DKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQFVLDTILHVVRNHKL 480

Query: 481  EMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAITTSTRSWQYTALEL 540
            EMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAITTSTRSWQYTALEL
Sbjct: 481  EMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAITTSTRSWQYTALEL 540

Query: 541  ISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQXXXXXXXXXXXXXXXYAGD 600
            ISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQ               YAGD
Sbjct: 541  ISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQLRGLECLLSMSLLQLYAGD 600

Query: 601  VDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPE 660
            VDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPE
Sbjct: 601  VDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPE 660

Query: 661  EVKVLVDVLNARENKEGFAQLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
            EVKVLVDVLNARENKEGFAQLF                                      
Sbjct: 661  EVKVLVDVLNARENKEGFAQLFEGEGEYEVDEEEGDEQENDDEEKDKDKDAEDDEMEDDE 720

Query: 721  XXXXXXXXXXXXXXXXXKINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXX 780
                             KINKETTSALAKALNLPDNIINENGEVDLDAL           
Sbjct: 721  SSSESDDDSDESDEDIEKINKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDD 780

Query: 781  XXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFK 840
                                   QLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFK
Sbjct: 781  DDDESEEEDDESMDDEKMMELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFK 840

Query: 841  HRIIDLLETYIKYVEKITSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKIS 900
            HRIIDLLETYIKYVEKITSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKIS
Sbjct: 841  HRIIDLLETYIKYVEKITSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKIS 900

Query: 901  KLLKVKLFKINLTFFDNGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFL 960
            KLLKVKLFKINLTFFDNGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFL
Sbjct: 901  KLLKVKLFKINLTFFDNGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFL 960

Query: 961  SKLLIETTNADERSYAFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSATTD 1019
            SKLLIETTNADERSYAFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSATTD
Sbjct: 961  SKLLIETTNADERSYAFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSATTD 1019

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/692 (49%), Positives = 477/692 (68%), Gaps = 16/692 (2%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62
           KVNRD FY+LASDL +ERV++AV+LI++LSAL+     +E+ YVL RLISGL+S RNSAR
Sbjct: 4   KVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSAR 63

Query: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGIM 122
           LGFSLCL+EVV +ALD+       L S D +L+++   L  D+V   KK  KGKDERGI+
Sbjct: 64  LGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGIL 123

Query: 123 FGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQTV 182
           FG+MF LQA+LNEPLF  +F D+ GK+S FA+RF  +L ELAV KNWLRE CL+TL+QTV
Sbjct: 124 FGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLFQTV 183

Query: 183 EKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIH----TNGK--KIASSLPLESQ 236
           ++ +P ++S  + S++ LLDKY+LT+TNEGLAIYL L H     NGK  K+ SSL LE  
Sbjct: 184 QRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLALEFA 243

Query: 237 GWKLNDPLAKGNLPTLTQVLLNSNINQSETPQGN---AANWSPRLHFVWDILLPILLGQD 293
            WK NDPL+KGNLP L++VL ++  N SE   G+   +ANW+PRLHFVWDIL+PIL    
Sbjct: 244 AWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPILAPGK 303

Query: 294 STTNDEHVXXXXXXXXXXXXXXXXXXXWKMVVDESFFNEKSSSERKYLGFLIIQKSLELV 353
           S                          ++  VDE+FF+EK+SSERKYLGFL+  +++E+V
Sbjct: 304 SDEEIPSKKSHKKKKKDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFIRAVEVV 363

Query: 354 PAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KITPIVKVILF 412
            +Q ++S F QN +R++INQS+D+KR+L+KISQK L++I++ACEKD + KI   ++ +LF
Sbjct: 364 SSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCLEAMLF 423

Query: 413 GENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSE-SIQKDQFVLDTI 471
           G +G  +FD                     L ++F MLS ++    E + Q  QFVLDT+
Sbjct: 424 GPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQHYQFVLDTV 483

Query: 472 LHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAITTSTR 531
           LH VR H+LE++   I   LL  ++ LAFF K+ E IS++A+ER FS+LSEL  I    +
Sbjct: 484 LHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLFSILSEL-TIQKDGQ 542

Query: 532 SWQYTALELISNKEASGS-PLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQXXXXXXXXX 590
           SWQ+  L+LI +KEA G+ P+N+ +D+DL AI+ + ++ L+ ++  SD+ Q         
Sbjct: 543 SWQHYTLKLILSKEAEGNEPINK-LDEDLKAIETEALDILQNIS--SDSPQSRGLEWLLS 599

Query: 591 XXXXXXYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLAQRKAVLKKIALVAW 650
                 Y+GD +S+SIVE+LC FY E  ++S SLVGITEILL+LLAQ+KA+L+K++LV W
Sbjct: 600 NCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEILLSLLAQKKALLRKLSLVVW 659

Query: 651 EQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           EQFV  +G +E+K+L++VL+ARENKEGFA+LF
Sbjct: 660 EQFVSEVGEQELKILLEVLDARENKEGFAKLF 691

 Score =  252 bits (644), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 190/284 (66%), Gaps = 10/284 (3%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXX------XXXXXXXXXXXXXXXX 791
            KI++E TSALAKALNLP+NI+N+ GEVD++ L                            
Sbjct: 757  KIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEEEE 816

Query: 792  XXXXXXXXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYI 851
                        QLS+IFKRRKEALS V +GN+RK++VKE+RENVI FKHRI+D+LE YI
Sbjct: 817  SMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEAYI 876

Query: 852  KYVEKITSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKIN 911
            K+ ++I  +   D+  +K+   N +F+ +  M+ C+Q TLD+PLADKISKLLK +L+KI 
Sbjct: 877  KHADRIALQDNNDEANSKDTFKN-LFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKIK 935

Query: 912  LTFFDNGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNAD 971
            ++ F  G + ++  +L QL+  H+ L+TSKPGQ  +LYFS CST+SLFL K+L+E  N++
Sbjct: 936  ISAF-KGAIDSKR-LLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVE-NNSE 992

Query: 972  ERSYAFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNS 1015
            + + ++ Q+ID+Y + +K+WLL G+FG  VF DF+NWL S+K +
Sbjct: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKT 1036

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/687 (49%), Positives = 464/687 (67%), Gaps = 7/687 (1%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62
           +VNRD FYKLASDL EERVQ+AVALI++LSAL   +   E+ YVL RLI+GLSS+RNSAR
Sbjct: 4   RVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRNSAR 63

Query: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLD-SVATGKKLKKGKDERGI 121
           LGFSLCLTEV+NLAL+ +      L SID FLD++  TL L  S    KK  KGKDERG+
Sbjct: 64  LGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIKGKDERGL 123

Query: 122 MFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQT 181
           +FG+MF LQALL+EPLF KVFI K   IS FA+RF  +L +LAV K+WLREPCLFTL+Q 
Sbjct: 124 LFGKMFGLQALLSEPLFEKVFISKEKGISDFALRFMDELCQLAVFKSWLREPCLFTLFQA 183

Query: 182 VEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASS---LPLESQGW 238
            E+ +P  D    + +++LLD+Y+LTLTNEGLAIYL L++ + +  +SS   +  ES+ W
Sbjct: 184 YERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQMDFESKSW 243

Query: 239 KLNDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPILLGQDSTTND 298
           K NDPLA+GNLP L+QVL +S++   +     A+NW+PRLHFVWDILLPI+   +S    
Sbjct: 244 KSNDPLARGNLPLLSQVLRDSSVATEDESSPKASNWTPRLHFVWDILLPIITQDNSRRES 303

Query: 299 EHVXXXXXXXXXXXXXXXXXXX-WKMVVDESFFNEKSSSERKYLGFLIIQKSLELVPAQL 357
           E                      W+M VDES FNEK+S+ERK+LG +I QK+LE+ P +L
Sbjct: 304 EDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIFQKALEVTPHKL 363

Query: 358 VESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KITPIVKVILFGENG 416
           V   F QNV+R++IN ++D+KR+L KIS KVLNSI++ C+K    K+ P +  ILFG +G
Sbjct: 364 VGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVPCLSAILFGPHG 423

Query: 417 ATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQ-FVLDTILHVV 475
           + NFD                 +E  L+++F +LS+ +  SS   QK+Q F+LDT+LH V
Sbjct: 424 SINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQKNQQFILDTMLHAV 483

Query: 476 RNHKLEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAITTSTRSWQY 535
           R+HK E+N   I+  +L P+I LAFF  ++E  SN+AKERF+S+LSE+  +     S+Q 
Sbjct: 484 RSHKSELNKDIIVTSILRPIISLAFFTVKDEHTSNLAKERFYSILSEITHLNNEGPSYQN 543

Query: 536 TALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQXXXXXXXXXXXXXX 595
            AL++I ++ A+G  L  ++D  L  +K + +  L+ ++      Q              
Sbjct: 544 MALDIIRDEIAAGKELTTKLDDTLEDVKSEALRTLQAISNNEKNPQLRGLEMLISMCLLQ 603

Query: 596 XYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLAQRKAVLKKIALVAWEQFVP 655
            Y+G+ ++VS++E+LC FY + +++S SLVGITEILL+LLAQ+KAVL+K++L AW+QFV 
Sbjct: 604 LYSGESEAVSVIEELCAFYQDTDENSTSLVGITEILLSLLAQKKAVLRKLSLSAWQQFVS 663

Query: 656 FIGPEEVKVLVDVLNARENKEGFAQLF 682
            IG  E+K L+DVL ARENK+GF+QLF
Sbjct: 664 EIGEAELKALLDVLPARENKKGFSQLF 690

 Score =  235 bits (599), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 185/281 (65%), Gaps = 15/281 (5%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLD-----ALXXXXXXXXXXXXXXXXXXXXXXX 792
            KI+KE TSALAKALNLPDNI+N+ GEVDL+     A                        
Sbjct: 747  KIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDEDS 806

Query: 793  XXXXXXXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIK 852
                       QLS+IFKRRK+ALS++++GNQRK + KESRE+VIAFK R+ID+LE Y+K
Sbjct: 807  MDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIYVK 866

Query: 853  YVEKITSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINL 912
            +VEK   + L+++  N  ++ +C+ +++  M++CIQ T D+ LA++I+KLL+ K+FK+  
Sbjct: 867  FVEK---QSLKEE--NYSKISSCL-LLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKT 920

Query: 913  TFFDNGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADE 972
            + F      +Q+ ++  L+  HE + T KPGQH ++Y+SVCST+SLFL+K++IE  N+D 
Sbjct: 921  SAF--CGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIE--NSDS 976

Query: 973  RSYAFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
            +  A   +ID+Y E  K+W   G+FGP +F+DF NWL+S+K
Sbjct: 977  KDAAVHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
           YEL055C
          Length = 1018

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/704 (47%), Positives = 477/704 (67%), Gaps = 25/704 (3%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61
           KVNRD FYKLASDL EER Q+A++L+K+L+ L  P E E E+ YV+NRLI GL+S+R+SA
Sbjct: 4   KVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETE-EWTYVVNRLIKGLASDRSSA 62

Query: 62  RLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGK---KLKKGKDE 118
           RLGFSLCLTEV+NLAL  K+     L++IDDFL ++ KTL LD+ A  K   K KKG+DE
Sbjct: 63  RLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRDE 122

Query: 119 RGIMFGRMFALQALLNEPLFAKVFI-DKNGK--ISKFAIRFQTQLVELAVLKNWLREPCL 175
           RG++FG+MF LQA+ NEP+F+ VF+  K+GK  I+ FA +F  ++V+LA+ KNW++E CL
Sbjct: 123 RGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESCL 182

Query: 176 FTLYQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIH--TNGKKI-ASSLP 232
           FTL+QT++K +PY +     S++ LLD + L+LT+EGLA+YL++++  TN  K+  SS+ 
Sbjct: 183 FTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSSIE 242

Query: 233 LESQGWKLNDPLAKGNLPTLTQVLLNSNINQSE-----TPQGNAANWSPRLHFVWDILLP 287
            ++ GWK NDPL++GNLP LT+VL +S++ Q       + + NA+NW+PRLHFVWDILLP
Sbjct: 243 FKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWDILLP 302

Query: 288 ILLGQDSTT--NDEHVXXXXXXXXXXXXXXXX-XXXWKMVVDESFFNEKSSSERKYLGFL 344
           IL+    TT  N +H+                    W+MVVDESFFNEK+SSERKYLGFL
Sbjct: 303 ILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERKYLGFL 362

Query: 345 IIQKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KI 403
           I  K++++V    + + F  N +RS+INQS D+KR+LHK+SQ  LN+IIE C++D++ K+
Sbjct: 363 IFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQEDSSNKL 422

Query: 404 TPIVKVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQK 463
              V  ++FG +G+ NFD                 + +TL+ +F + ++ I   SE+ QK
Sbjct: 423 VKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKSENKQK 482

Query: 464 DQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSEL 523
           +++VLDT+LH+VR HK  +    I+  LL P+I  AFF KENE ++ +AKERF S+L+EL
Sbjct: 483 NRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFSSILAEL 542

Query: 524 AAITTS--TRSWQYTALELISNKEASGS-PLNQEMDQDLIAIKEKGIECLKEVTKKSDTV 580
            ++       SWQY AL++I  KE +G   L  ++D++L  IK    + + ++ K   + 
Sbjct: 543 TSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKIIKSPQSP 602

Query: 581 QXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDD--SVSLVGITEILLALLAQR 638
           Q               ++G+ +S+S +E+L  FY E + D  S SLVGITEILL+LLAQ+
Sbjct: 603 QLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDTESTSLVGITEILLSLLAQK 662

Query: 639 KAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           KAVL+K++L+ WEQF+  +G EE+ +L+DVL ARENK+GFA LF
Sbjct: 663 KAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLF 706

 Score =  219 bits (559), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 126/275 (45%), Positives = 171/275 (62%), Gaps = 15/275 (5%)

Query: 739  INKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 798
            I+KE TSALAKALNLP+NI+N+ GEVD+  L                             
Sbjct: 759  IDKEATSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMMLLD 818

Query: 799  XXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858
                 QLSEIFKRRKEALS+ ++GNQRK++ KESRENVIAFK R++DLL  Y+KYVEK+ 
Sbjct: 819  D----QLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKL- 873

Query: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918
                  Q  +  Q    +   +  MV C+Q TLD+ LADK+SKLLK ++FKI  + F N 
Sbjct: 874  ------QTADHSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNS 927

Query: 919  NVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAFS 978
              +N   VL  LK +HE L+T KPGQH  LY+++ S++SLF SK+ + ++   + + A++
Sbjct: 928  --ANPVEVLEYLKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASST--DETNAYN 983

Query: 979  QLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
            +LID Y   +K W+ K +FGP  F DF+NWL S+K
Sbjct: 984  KLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1028

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/719 (46%), Positives = 465/719 (64%), Gaps = 39/719 (5%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62
           KVNRD FYKLAS+L EER+Q+AV++I++LSALK  +  +E+ YVL RLI GLSS+R  AR
Sbjct: 7   KVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRTGAR 66

Query: 63  LGFSLCLTEVVNLALD--RKDQPLTCLRSIDDFLDMVDKTLVLDSV-ATGKKLKKGKDER 119
           LGFSLCLTEV+NLA+D   K   L  L +ID +L ++ +TL +D+      K  KGKDER
Sbjct: 67  LGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGKDER 126

Query: 120 GIMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLY 179
           G++FG+MF L+ALLNEPLF+K F+      S F  RF  +L++LA  KNW+REPCLFTL+
Sbjct: 127 GLLFGKMFGLKALLNEPLFSKTFLPNKKVASNFCERFMVELLDLASRKNWIREPCLFTLF 186

Query: 180 QTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTN---GKKIASS---LPL 233
           QTVEK +P+ D  +I+ ++ LLD +K TLTNEGLAIYL L+H     GK+       L L
Sbjct: 187 QTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKIKLLVL 246

Query: 234 ESQGWKLNDPLAKGNLPTLTQVLLNSNINQSETP-QGNAANWSPRLHFVWDILLPILLGQ 292
           ++  WKLNDPLA+GNLP LTQVL  S++   E   +  +ANW PRLHFVWDILLP +   
Sbjct: 247 KNSSWKLNDPLARGNLPRLTQVLRESSLASEEKKVEVMSANWQPRLHFVWDILLPTVSTI 306

Query: 293 DSTTNDEHVXXXXXXXXXXXXXXXXX--XXWKMVVDESFFNEKSSSERKYLGFLIIQKSL 350
           +S ++++H+                     W+M VDESFFNEK+SSERKYLGF I ++++
Sbjct: 307 ESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKYLGFSIFERAI 366

Query: 351 ELVPAQL-VESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKD-TTKITPIVK 408
            +V   L  E+ F QN +RS+INQS+D  R+LHKIS +V+N+I++ACE+  +TK+ P++ 
Sbjct: 367 SIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEESPSTKLIPVIH 426

Query: 409 VILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIK-GSSESIQKDQFV 467
            ILF  NG+TNFD                    TL Q+F ML+++IK G+SE  +K QF+
Sbjct: 427 SILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGTSEDFKKTQFI 486

Query: 468 LDTILHVVRNHKLEM--------NIGTIIIQLLTPVIDLAFFL------KENE---RISN 510
           LD++LH+VR+HK ++            II   + P++ LAFF       KE+E   ++  
Sbjct: 487 LDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDIAKKEDESDNQVDE 546

Query: 511 IAKERFFSLLSELAAITTST-RSWQ-YTALELISNKEASGSPLNQEMDQDLIAIKEKGIE 568
           +AKER FS+LSEL   T     SWQ YT LE+I  +  + + L  +MD DL  +++  I+
Sbjct: 547 LAKERLFSVLSELTTTTNKQLHSWQYYTLLEIIDRENENPNSLINKMDDDLKTVRDNAIK 606

Query: 569 CLKEVTKKSDTVQXXXXXXXXXXXXX---XXYAGDVDSVSIVEDLCTFYDERED--DSVS 623
            +K +  K++                     Y+GD DSV+ +E+L TFY+   D  +  +
Sbjct: 607 VIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEELITFYNASRDVEEKRT 666

Query: 624 LVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           +VGITEILL+LLAQ+KAVLKK++L+ WEQFV  I  + + +L+DVL ARENK+GFA+LF
Sbjct: 667 MVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLDVLPARENKQGFAELF 725

 Score =  240 bits (612), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 177/279 (63%), Gaps = 29/279 (10%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            KI+KE TSALAKALNLPD+IINENGEV+ D L                            
Sbjct: 777  KIDKEATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKMMELDD----- 831

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QL+EIFKRRKEALSSV++GNQRK++VKESRE+VIAFKHR+ DLL  YIK+ E  
Sbjct: 832  ------QLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAE-- 883

Query: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
                      + E       + +  M++C+Q TLD+ LADKISKLLK K++K+      N
Sbjct: 884  ----------DSELPAKYAILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTK---N 930

Query: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977
                  E V   + ++HE L+TSKPGQ+   ++S+CS++S+FLSKLL+  +N  E +Y  
Sbjct: 931  MEEITAEQVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYG- 989

Query: 978  SQLIDIYGELSKKWLLK-GRFGPIVFMDFYNWLNSKKNS 1015
             +++DIY E +KKW+LK  +FG  +F+DFYNWL+SKK++
Sbjct: 990  -KIVDIYSETTKKWVLKDSKFGSNIFIDFYNWLSSKKST 1027

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/729 (46%), Positives = 463/729 (63%), Gaps = 50/729 (6%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61
           KVNRD FYKLASDL EER+QSAV+LIK+LS L  P ++E E+ YVLNRLI GL+S+RNSA
Sbjct: 4   KVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIE-EWTYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDS--VATGKKL----KKG 115
           RLGFSLCLTE +NLAL   D     ++SI++FLD++ KTL +DS  VAT  K     KKG
Sbjct: 63  RLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKKKG 122

Query: 116 KDERGIMFGRMFALQALLNEPLFAKVFI--DKNGKISKFAIRFQTQLVELAVLKNWLREP 173
           +DERGI+FG++FALQALLNEPLF+ +F+  DK    S   IR+  +L  L   KNW+RE 
Sbjct: 123 RDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIRES 182

Query: 174 CLFTLYQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNG-----KKIA 228
           C FTLYQT+EK +PY D  + + ++ LLDKY+LTL+ EGLAIYL +I+ +      +K  
Sbjct: 183 CFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEKTL 242

Query: 229 SSLPLESQGWKLNDPLAKGNLPTLTQVLLNSNI----NQSETPQGN----AANWSPRLHF 280
           S + L +  WK N+PLA+GNLP LT +L +SN+    +  + P  N     ANW+PRLHF
Sbjct: 243 SDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPRLHF 302

Query: 281 VWDILLPIL---LGQDSTTNDEHVXXXXXXXXXXXXXXXXXXX----WKMVVDESFFNEK 333
           VWDILLPIL     ++ T +D+                         W+M +DESFFNEK
Sbjct: 303 VWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDESFFNEK 362

Query: 334 SSSERKYLGFLIIQKSLELVP---AQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLN 390
           +SSERKYLGFLI QK+++ +    A+L+ + F +N +RS+INQS+D KR+LHK+SQ  ++
Sbjct: 363 ASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQIAID 422

Query: 391 SIIEACEKD-TTKITPIVKVILFGEN--GATNFDXXXXXXXXXXXXXXXXXEEETLSQ-- 445
           +I++ CE D + K+ P +  +LF  N  G+ NFD                    TL Q  
Sbjct: 423 TIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSSTLRQLI 482

Query: 446 -IFIMLSNEIKGSSESIQKDQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKE 504
            +FI   N +    E    +QF LDTILHVVR+HK E +  +++  LL P++ LAFF K+
Sbjct: 483 KLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFFSKD 542

Query: 505 NERISNIAKERFFSLLSELAAITTSTR------SWQYTALELISNKEASGS-PLNQEMDQ 557
           NE ++ +AKER +S+LSEL   T+S +      SW Y  L+LI   E SG+  L  ++D 
Sbjct: 543 NEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNKLDA 602

Query: 558 DLIAIKEKGIECLKEVTKKSD---TVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFY 614
           DL  IK  G++ L E++  +    T Q               ++GD +S+S +E+L  FY
Sbjct: 603 DLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELVEFY 662

Query: 615 -DEREDDSVSLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARE 673
            + ++++S SLVGITEILL+LLAQ+KA+L+K++L  WE F+  IG  E+ VL+ VL  RE
Sbjct: 663 SNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVLPVRE 722

Query: 674 NKEGFAQLF 682
           NK+GFA LF
Sbjct: 723 NKQGFAHLF 731

 Score =  235 bits (599), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 183/278 (65%), Gaps = 10/278 (3%)

Query: 739  INKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 798
            I+KE TSALAKALNLP+NI+NE GEVDL  L                             
Sbjct: 790  IDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESMDDEK 849

Query: 799  XXXXX-QLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLSEIFKRRKEALS++++GNQRK++VKESRENVIAFKHR+ID+L  Y+KYVE +
Sbjct: 850  MMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYVEGL 909

Query: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
            T   L  +  N E+  N + + +  M++C++ TLD+ LADK+ KL+K KLFKI  + F  
Sbjct: 910  T---LTTE--NGEKFGN-LLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSNFQI 963

Query: 918  GNV-SNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYA 976
             ++ ++ + V+  L+  HE L+TSK GQ  SLY+S+CST S+FL K+L+   + D +  A
Sbjct: 964  ESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESND-KEIA 1022

Query: 977  FSQLIDIYGELSKKWLL-KGRFGPIVFMDFYNWLNSKK 1013
            + +LID+YGE +K W++ KG+FG   F DFYNWL+S++
Sbjct: 1023 YGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
           YEL055C (REAL)
          Length = 1019

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/707 (46%), Positives = 456/707 (64%), Gaps = 35/707 (4%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61
           KVNRD F+KLASDL EER+ +AVALIKDLSAL+ PS+ E E+ YVLNRLI GL+S+RNSA
Sbjct: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAE-EWSYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSLCLTEVVNLALDR-KDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120
           RLGFSLCLTEVVNL ++    Q    L S ++FLD +   L +      KK  KGKDERG
Sbjct: 63  RLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDERG 122

Query: 121 IMFGRMFALQALLNEPLFAKVFID--KNGKISKFAIRFQTQLVELAVLKNWLREPCLFTL 178
           I+FG++F L++LLNEPLF+++F+D  K G  ++F IRF  QL++LA+ KNW+REPCLF+L
Sbjct: 123 ILFGKLFGLKSLLNEPLFSEIFVDDIKKGN-TEFVIRFMEQLIDLALRKNWIREPCLFSL 181

Query: 179 YQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKK-IASSLPLESQG 237
           +QT++  +P+++ S    ++ + DKY LTLTNEGL+ YL L + + +  I S+L L + G
Sbjct: 182 FQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNSG 241

Query: 238 WKLNDPLAKGNLPTLTQVLLNSNI-------NQSETPQGNAANWSPRLHFVWDILLPILL 290
           WK NDPLA+GNLP LT+VL +S++        Q    Q N ANW+PRLHFVWD+LLP L 
Sbjct: 242 WKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKN-ANWNPRLHFVWDVLLP-LF 299

Query: 291 GQDSTTNDEHVXXXXXXXXXXXXXXXXX--XXWKMVVDESFFNEKSSSERKYLGFLIIQK 348
           G     N EH+                     WKM VDESFFNEK+SSERKYLGFLII  
Sbjct: 300 GSGKLENTEHITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDA 359

Query: 349 SLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KITPIV 407
           + + VP   + S F QNV+R++INQS D++R+L+KI+Q  L SI++ACE+D   K+ P +
Sbjct: 360 TFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCL 419

Query: 408 KVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQFV 467
             +LFG +G+ NFD                     L+Q+      +++     +    F+
Sbjct: 420 NAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFI 479

Query: 468 LDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFL-----KENERISNIAKERFFSLLSE 522
           LD++LH++R HK+E+N   II  +LTP+I +AFF      +E E++  +AKER +S+L E
Sbjct: 480 LDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGE 539

Query: 523 LA------AITTSTRSWQYTALELISNKEAS-GSPLNQEMDQDLIAIKEKGIECLKEVTK 575
           L       +      SWQY  L LI + E S  + L   +D+ L  IK + I  L E++ 
Sbjct: 540 LTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEIS- 598

Query: 576 KSDTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLALL 635
           KS+T Q               YAG+ DS+S++E+LC F    + D+ S+VGITEILL+ L
Sbjct: 599 KSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF---TKHDNNSMVGITEILLSFL 655

Query: 636 AQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           AQ+KA+L+K++L+ W+QF+  +G EE+++L+DVL ARENK+GFAQLF
Sbjct: 656 AQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702

 Score =  245 bits (625), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 135/277 (48%), Positives = 179/277 (64%), Gaps = 19/277 (6%)

Query: 739  INKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 798
            I+KE T AL KAL+LPDNI+N+ GEVD++ L                             
Sbjct: 753  IDKEATGALIKALHLPDNIVNDKGEVDMNQLGGLSDDDDDEDEESMDDEKMMELDD---- 808

Query: 799  XXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858
                 QLSEIFKRRKEALS++++GNQRK++VKESRENVI+FKHRI+D+L  Y+KY EK+ 
Sbjct: 809  -----QLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLA 863

Query: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFD-- 916
                 +   N E  L+ +   +  M++CI+ TLD+PLADKISKLLK K+FKI    F   
Sbjct: 864  IANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKIL 923

Query: 917  NGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYA 976
            + N+     ++  LK+ HEL++TSKPGQHAS++FS CSTSSLFLSKL  E    +    A
Sbjct: 924  DKNI----ELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNN----A 975

Query: 977  FSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
              +LID+Y   +K+W+LKG+F   VF+DF NWL+SKK
Sbjct: 976  LDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKK 1012

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
           POL5DNA Polymerase phi; has sequence similarity to the
           human MybBP1A and weak sequence similarity to B-type DNA
           polymerases, not required for chromosomal DNA
           replication; required for the synthesis of rRNA
          Length = 1022

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/706 (45%), Positives = 449/706 (63%), Gaps = 33/706 (4%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62
           KVNRD F+KLASDL EER+ +AVALIKDLSAL   +  +E+ YVLNRLI GLSS+RNSAR
Sbjct: 4   KVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRNSAR 63

Query: 63  LGFSLCLTEVVNLALDR-KDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGI 121
           LGFSLCLTEV+NLA++    Q    L S ++FL  +   L ++     KK  KGKDERGI
Sbjct: 64  LGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDERGI 123

Query: 122 MFGRMFALQALLNEPLFAKVFI-DKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQ 180
           +FG++F L++LLNEPLF+++F+ D     ++F IRF  QL++LA+ KNW++EPC FTL+Q
Sbjct: 124 LFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFTLFQ 183

Query: 181 TVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKK-IASSLPLESQGWK 239
           T++  +P++D S  E ++ + DKY LTLTNEGL+ YL L +   +  I S L L++ GWK
Sbjct: 184 TMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNPGWK 243

Query: 240 LNDPLAKGNLPTLTQVLLNSNI------NQSETPQGNAANWSPRLHFVWDILLPILLGQD 293
            NDPLA+GNLP LT+VL NS++         ET +    NW+PRLHFVW +LLP L G  
Sbjct: 244 DNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLP-LFGNG 302

Query: 294 STTNDEHVXXXXXXXXXXXXXXXXX--XXWKMVVDESFFNEKSSSERKYLGFLIIQKSLE 351
              N  H+                     WKM VDESFFNEK+SSERKYLGFLII  + +
Sbjct: 303 KLENTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAAFK 362

Query: 352 LVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KITPIVKVI 410
            VP   +   F QNV+R++INQS D++R+L+KISQ  L+SI++ACE+D+  ++ P +  +
Sbjct: 363 AVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCLNAM 422

Query: 411 LFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQFVLDT 470
           LFG +G+ NFD                     L+Q+  +   +++     +    F LD+
Sbjct: 423 LFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKKGVLSHTLFALDS 482

Query: 471 ILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKEN-----ERISNIAKERFFSLLSELAA 525
           ILH+VR HK+E+N   I+  +L P++ +AFF   +     E++  +AKER +S+L EL  
Sbjct: 483 ILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGEL-T 541

Query: 526 ITTSTR-------SWQYTALELISNKEAS--GSPLNQEMDQDLIAIKEKGIECLKEVTKK 576
           I    R       SWQY  L+LI + E S  G  +N  +D++L  IK + I CL +V  +
Sbjct: 542 INKEIRCKDPEINSWQYLTLKLILDIENSHVGDLIN-PLDENLENIKNEAISCLSKVC-R 599

Query: 577 SDTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLA 636
           S T Q               YAGD DS+S++E+LC F     +   S+VGITEILL+LLA
Sbjct: 600 SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENN---SMVGITEILLSLLA 656

Query: 637 QRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           Q+KA+L+K++L+ W+QF+  +G EE+++L+D+L ARENK+GFAQLF
Sbjct: 657 QKKALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLF 702

 Score =  253 bits (647), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 135/278 (48%), Positives = 182/278 (65%), Gaps = 14/278 (5%)

Query: 739  INKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 798
            I+KE TSAL KALNLPDNI+N+ GEVDLD L                             
Sbjct: 755  IDKEATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDD--- 811

Query: 799  XXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858
                 QLSEIFKRRKEALSS+++GNQRK +VK+SRENVI+FKHR++D+L  Y+KY EK+T
Sbjct: 812  -----QLSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLT 866

Query: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918
                 +   N    L+ +   +  M++C+  TLDRPLADKISKLLK K+FKI +T F + 
Sbjct: 867  LANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDM 926

Query: 919  NVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAFS 978
            N   +  ++  LK  H+L++TSKPGQHA++++S+CSTSSLFLSKL +E    D+      
Sbjct: 927  NKDIE--LMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDK----LD 980

Query: 979  QLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSA 1016
            +LID+Y   +K+W+ KG+ GP +F+DF NWL+SKK + 
Sbjct: 981  ELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTV 1018

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
           YEL055C (REAL)
          Length = 1020

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/705 (46%), Positives = 458/705 (64%), Gaps = 33/705 (4%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61
           KVNRD F+KLASDL EER+ +AVALI+DLSAL  PS+ E E+ YVLNRL+ GL+S+RNSA
Sbjct: 4   KVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAE-EWLYVLNRLVKGLASDRNSA 62

Query: 62  RLGFSLCLTEVVNLALDR-KDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120
           RLGFSLCLTEV+NLA++    Q    L S +DFL+ +   L ++    GKK  KGKDERG
Sbjct: 63  RLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVKGKDERG 122

Query: 121 IMFGRMFALQALLNEPLFAKVFID--KNGKISKFAIRFQTQLVELAVLKNWLREPCLFTL 178
           I+FG++F L++LLNEPLF+++FI   +NG  + F IRF  +L++LA+ KNW++EPC FTL
Sbjct: 123 ILFGKLFGLKSLLNEPLFSEIFIKNFENGN-TDFFIRFTEELIDLALKKNWIKEPCFFTL 181

Query: 179 YQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKK-IASSLPLESQG 237
           +QT++  +P+ID S    ++ + DKY +TLTNEGL+ YL L +   K  I S+L L++ G
Sbjct: 182 FQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYGGDKNLIPSTLDLKNLG 241

Query: 238 WKLNDPLAKGNLPTLTQVLLNSNI------NQSETPQGNAANWSPRLHFVWDILLPILLG 291
           WK +DPLA+GNLP LT+VL +S++         +T +    NW+PRLHFVWDILLP L G
Sbjct: 242 WKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWDILLP-LFG 300

Query: 292 QDSTTNDEHVXXXXXXXXXXXXXXXXX--XXWKMVVDESFFNEKSSSERKYLGFLIIQKS 349
                N EHV                     WKM +DESFFNEK+SSERKYLGFLII  +
Sbjct: 301 SGKLENTEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLGFLIIDAA 360

Query: 350 LELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKD-TTKITPIVK 408
            + VP   + S F QNV+R++INQS D++R+L+KI+Q  L SI++ACE+D T K+ P + 
Sbjct: 361 FKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTNKLVPCLN 420

Query: 409 VILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQFVL 468
            +LFG +G+ NFD                     L+Q+  +   +++ S   +    F+L
Sbjct: 421 SMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSKRDLTHTHFIL 480

Query: 469 DTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFL-----KENERISNIAKERFFSLLSEL 523
           D+ILH++R HK+E++   ++  +LTP+I +AFF      +E E++  +AKER FS+L EL
Sbjct: 481 DSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDDQELEQLHELAKERLFSILGEL 540

Query: 524 A------AITTSTRSWQYTALELISNKEASGSP-LNQEMDQDLIAIKEKGIECLKEVTKK 576
                  +      SWQ+  L+LI + E S    L   +D++L   KE+ I  L E+++ 
Sbjct: 541 TMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTKEEAISSLAEISRS 600

Query: 577 SDTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLA 636
           S T Q               YAG+ DS+S++E+LC F    +D + S+VGITEILL+LLA
Sbjct: 601 S-TAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEF---SKDKNNSMVGITEILLSLLA 656

Query: 637 QRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQL 681
           Q+KA+LKK++L+ W+QF+  +G EE++VL+DVL ARENK+GFAQL
Sbjct: 657 QKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQL 701

 Score =  245 bits (626), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 135/276 (48%), Positives = 179/276 (64%), Gaps = 16/276 (5%)

Query: 739  INKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 798
            I+KE TSAL KALNLPDNI+N+ GEVD+D L                             
Sbjct: 753  IDKEATSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDG--- 809

Query: 799  XXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858
                 QLSEIFKRRKEALS++++GNQRK++VKESRENVI+FKHRI+D+L  Y+KY EK+ 
Sbjct: 810  -----QLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLA 864

Query: 859  -SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
             + K ED       L   V+ ++  +++CI  TLDRPLADKISKLLK K+FKI +  F  
Sbjct: 865  LANKSEDSSSIGSPLSKLVYFII-PILKCINETLDRPLADKISKLLKGKIFKIKVNAFK- 922

Query: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977
              +     V+  LK+ H++L+TSKPGQH ++++S CSTSSLFLSKL +E    D+     
Sbjct: 923  -EMDKNIEVMDLLKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGNDK----L 977

Query: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
             +LID+Y   +K+W  +G+FG  VF+DF NWL+SKK
Sbjct: 978  DELIDLYAATTKEWTNRGKFGANVFIDFINWLSSKK 1013

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
           YEL055C (REAL)
          Length = 1023

 Score =  554 bits (1427), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 323/707 (45%), Positives = 458/707 (64%), Gaps = 36/707 (5%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61
           KVNRD F+KLASDL EER+ +AVALIKDLSAL+ PS+ E E+ YVLNRLI GL+S+RNSA
Sbjct: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSE-EWSYVLNRLIKGLASDRNSA 62

Query: 62  RLGFSLCLTEVVNLALDR-KDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120
           RLGFSLCLTEV+NLA++    Q    L S++DFLD +   L ++   TGKK  KGKDERG
Sbjct: 63  RLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDERG 122

Query: 121 IMFGRMFALQALLNEPLFAKVFID--KNGKISKFAIRFQTQLVELAVLKNWLREPCLFTL 178
           I+FG++F L++LLNEPLF+ +F++  K G  ++F IRF  QL++LA+ KNW++EPCL++L
Sbjct: 123 ILFGKLFGLKSLLNEPLFSGIFVEDLKRGN-TEFIIRFMEQLIDLALRKNWIKEPCLYSL 181

Query: 179 YQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKK-IASSLPLESQG 237
           +QT++  +P ++ S    ++   DKY LTLTNEGL+ YL L + + K  + S+L L++ G
Sbjct: 182 FQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYESDKDLVPSTLGLKNLG 241

Query: 238 WKLNDPLAKGNLPTLTQVLLNSNI-------NQSETPQGNAANWSPRLHFVWDILLPILL 290
           WK NDPLA+GNLP LT+VL +S +        Q  T +    NW+PRLHFVW+ILLP L 
Sbjct: 242 WKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLP-LF 300

Query: 291 GQDSTTNDEHVXXXXXXXXXXXXXXXXX--XXWKMVVDESFFNEKSSSERKYLGFLIIQK 348
           G     N EH+                     W+M VDESFFNEK+SSERKYLGFLII  
Sbjct: 301 GSGKLENAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360

Query: 349 SLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKD-TTKITPIV 407
           + + VP   +   F +NV+R++INQS D++R+L+KI+Q  L+SII+ACE+D   K+ P +
Sbjct: 361 TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420

Query: 408 KVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQFV 467
             +LFG +G+ NFD                     L+Q+F +   +++   + +    FV
Sbjct: 421 SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQEKKDDLPHTHFV 480

Query: 468 LDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFL-----KENERISNIAKERFFSLLSE 522
           LD++LH++R HK E+N   II  +L+P++ +AFF      KE+E++  +AKER +S+L E
Sbjct: 481 LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540

Query: 523 LAAITTSTR-------SWQYTALELISNKEASG-SPLNQEMDQDLIAIKEKGIECLKEVT 574
           L  I    R       SWQ+  L LI + E S    L   +D+ L   K + I  L E++
Sbjct: 541 L-TINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEIS 599

Query: 575 KKSDTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLAL 634
            KS+T Q               YAG+ DS+S++E+LC F    +D++ S+VGITEILL+L
Sbjct: 600 -KSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF---AKDENSSMVGITEILLSL 655

Query: 635 LAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQL 681
           LAQ+KA+LKK++L+ W+QF+  +G +E+++L+DVL  RENK+GFA L
Sbjct: 656 LAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702

 Score =  248 bits (632), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 178/275 (64%), Gaps = 11/275 (4%)

Query: 739  INKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 798
            I+KE TSAL KALNLPDNI+N+ GEVD+D L                             
Sbjct: 754  IDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMMELDD 813

Query: 799  XXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858
                 QLSEIFKRRKEALSS+++GNQRK++VKESRENVIAFKHRI+D+L  Y+K+ EK+ 
Sbjct: 814  -----QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLA 868

Query: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918
                 +  I     L+ +   +  M++CI+ TLDRPLADKISKLLK K+FKI  + F   
Sbjct: 869  IANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFK-- 926

Query: 919  NVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAFS 978
            ++     +L  LK+ H+ ++TSKPGQHA+++FS CSTSSLFLSKL ++    D+    F 
Sbjct: 927  DLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDK----FD 982

Query: 979  QLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
             LID+Y   +K+W  KG+FG  +F+DF NWL+SKK
Sbjct: 983  DLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKK 1017

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  554 bits (1427), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 311/699 (44%), Positives = 451/699 (64%), Gaps = 24/699 (3%)

Query: 1   MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRN 59
           M KVNRD FYKLASDLPEER+Q+AV +IKDLSAL+ P E+E E+ Y +NRL+ GL S+RN
Sbjct: 1   MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIE-EWNYTINRLVKGLGSSRN 59

Query: 60  SARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDER 119
           SARLGFS+CL+E +NLAL   D+    L SI+++L ++++TL  D    GKK +KGKDER
Sbjct: 60  SARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGAD-FDEGKK-RKGKDER 117

Query: 120 GIMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLY 179
           GI+FG++F LQALLNEPLF+ VF+ K+G IS F   F  +++ L+  KNW+REP LF+LY
Sbjct: 118 GILFGKLFGLQALLNEPLFSNVFVTKDG-ISNFVPVFVQEMINLSKCKNWIREPALFSLY 176

Query: 180 QTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGK----KIASSLPLES 235
           QT+EK +  +  S I +L+  LD+  LT+TNEGLAIYL L+  + K    +IA  + L++
Sbjct: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIA-EIKLQN 235

Query: 236 QGWKLNDPLAKGNLPTLTQVLLNSNI-----NQSETPQGNAANWSPRLHFVWDILLPILL 290
           QGWK NDPLAKGNLP+LT+VLL+++      +  +  Q   ANW+PRLHFVW+ LL  ++
Sbjct: 236 QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTII 295

Query: 291 GQDSTTN--DEHVXXXXXXXXXXXXXXXXXXXWKMVVDESFFNEKSSSERKYLGFLIIQK 348
               + N  D+HV                   W+MVVDE++FN+K+SSERKYLGFLI Q+
Sbjct: 296 NGSHSLNVEDKHV-SKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQR 354

Query: 349 SLELVPA--QLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPI 406
           +  ++ +   +V+SL GQN +RS+INQ ++ KR L+KI+ + +  I+E+CE DTTKI P+
Sbjct: 355 AFPMLKSYEDVVDSL-GQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKILPV 413

Query: 407 VKVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQF 466
            + + FG++G+  FD                   E LS++F +LS ++   SE     QF
Sbjct: 414 FETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEKSFSQF 473

Query: 467 VLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAA- 525
           +LD++LH+VRN K E++   +  ++L  ++ LAFF  +NE +  ++KER FS+LSEL + 
Sbjct: 474 ILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFSILSELNSL 533

Query: 526 -ITTSTRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQXXX 584
            ++ S    QY  ++L+      G  +  E+D +L   +   +  L E+ K +D      
Sbjct: 534 HLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATDKPYLRG 593

Query: 585 XXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDER-EDDSVSLVGITEILLALLAQRKAVLK 643
                       Y GD +SV  +++L   Y++   DD   L  ITEILL+LLAQ+KA+LK
Sbjct: 594 LGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPLSSITEILLSLLAQKKALLK 653

Query: 644 KIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           K ++  WEQ VP++  +E+ +L+D+L ARENK+GFAQLF
Sbjct: 654 KASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLF 692

 Score =  224 bits (572), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 175/281 (62%), Gaps = 15/281 (5%)

Query: 739  INKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 798
            I+KETTSALAKAL+LP +IIN NGEVD++ L                             
Sbjct: 756  IDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDD--- 812

Query: 799  XXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858
                 QLSEIFKRRKEALS++ +GN+RK +VKESRE+VIAFKHRI+DLL  YIK+VEK+ 
Sbjct: 813  -----QLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMI 867

Query: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918
             R+  D+  +K   LNC+      M++CI+ TLD+ LA+K++KLLK +LFKI +T    G
Sbjct: 868  QREDVDEN-SKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVT----G 922

Query: 919  NVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAFS 978
               +   V+   + IH+  + +KPGQ   LY+SVCS++SL+ SK+L++  NAD +   + 
Sbjct: 923  IKLDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVD--NADYQQGVYE 980

Query: 979  QLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSATTD 1019
             L+D Y    K+WL   +F   +F+DF NWL SKK    T+
Sbjct: 981  TLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQGPKTN 1021

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
           YEL055C
          Length = 1004

 Score =  545 bits (1405), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 307/702 (43%), Positives = 456/702 (64%), Gaps = 29/702 (4%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62
           KVNRD FYKLASDLPEER+Q+AV+LIK+LS+L     + E+ YV+NRLI GLSS+RN AR
Sbjct: 4   KVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRNGAR 63

Query: 63  LGFSLCLTEVVNLALDRKD-QPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGI 121
           LGFSLCLTEVV+LA+   D +    L+S+D FL ++ KT  +D     KK +KGK+ERG+
Sbjct: 64  LGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDP-QDEKKKRKGKEERGL 122

Query: 122 MFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQT 181
           MFG++FALQALLNEPLF+ +FI K+GKI+KF  +F  +LV LA  KNW+++PCLFTLYQT
Sbjct: 123 MFGKLFALQALLNEPLFSDIFI-KDGKITKFTTKFIDELVNLASRKNWIKQPCLFTLYQT 181

Query: 182 VEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLPLESQGWKLN 241
           +E+ +PY D S+++++V +LD  K TLTNEGLAIYL  I         S+ + ++GWK N
Sbjct: 182 IERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVTNKGWKYN 241

Query: 242 DPLAKGNLPTLTQVLLNSN--INQSETPQGNAANWSPRLHFVWDILLPILLGQDS----T 295
           +PL KGNL  +++V+  S   ++ +ET + N ANW P+LHFVWDILLPIL          
Sbjct: 242 NPLLKGNLSLVSEVVRESAVVVDDNET-KTNNANWHPKLHFVWDILLPILYNDPREEPLK 300

Query: 296 TNDEHVXXXXXXXXXXXXXXXXXXXWKMVVDESFFNEKSSSERKYLGFLIIQKSLELVPA 355
              +H                    WK +VDE++F++K+SSERK+LG LI  K+L  VP+
Sbjct: 301 KKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIFLKALPTVPS 360

Query: 356 QLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KITPIVKVILFGE 414
           + +   F QN++R +INQ +D++R LHKI++K L SI++ CE D   K+ P+V  +LFG 
Sbjct: 361 KWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVPVVGALLFGT 420

Query: 415 NGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGS-SESIQKDQFVLDTILH 473
           NG+ NFD                 E++++ ++F + ++E+    +E++    F+LDT+LH
Sbjct: 421 NGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAVL--HFILDTLLH 478

Query: 474 VVRNHKLEM---NIGTIIIQ-LLTPVIDLAFFL------KENERISNIAKERFFSLLSEL 523
           ++R+HKL +   +I T ++  LL P++ L FF       ++   +S IA+ER +S+LSEL
Sbjct: 479 ILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATETSPEDKINVSEIARERIYSILSEL 538

Query: 524 AAITTS-TRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQX 582
           +++ T    SWQ+  L  ++  E   + L   +D+DL  +K+ G+  +  ++ K+D    
Sbjct: 539 SSVPTGDAHSWQFHILNELTTVENELT-LTNALDEDLTTVKDTGLSVIHSLSVKNDK-SS 596

Query: 583 XXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDERED--DSVSLVGITEILLALLAQRKA 640
                         Y+G+ DSV+ ++++C +  E +   +S+SLVGITEILL LLAQ+K 
Sbjct: 597 RGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVGITEILLGLLAQKKT 656

Query: 641 VLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           VL K +L+ WEQ +  +G +E+ +++DVL+ARENKEGF+ LF
Sbjct: 657 VLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLF 698

 Score =  215 bits (548), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 118/276 (42%), Positives = 173/276 (62%), Gaps = 22/276 (7%)

Query: 739  INKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 798
            I+++T  ALAKAL LP+N++NE+GEV  + +                             
Sbjct: 747  IDRQTACALAKALKLPENVVNEDGEVKFNEIDDLEDESSDDESMDDEAMMALDG------ 800

Query: 799  XXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858
                 QL++IFKRRK+ALS V +GN RK++V++SRE+VI FK R+ID+L  Y+KYVEK+ 
Sbjct: 801  -----QLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKL- 854

Query: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918
               LED+ + KE+ L  V   +  M++C+Q TLDRPLADKI KLLK K+FK+ +      
Sbjct: 855  --DLEDKDVMKEK-LQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPV---- 907

Query: 919  NVSNQESVLTQLKAIH-ELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977
            +  + E  +  L+ IH   L+  K GQ+ ++Y+S+CS++S+F  KLLIE+   D +  A 
Sbjct: 908  SAEDGERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESR--DNKDAAH 965

Query: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
            +++IDIY E +KKW+ K +F   VF DFYNWL+SK+
Sbjct: 966  NEVIDIYAETTKKWMDKKKFPTSVFFDFYNWLSSKR 1001

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  543 bits (1399), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 324/721 (44%), Positives = 451/721 (62%), Gaps = 57/721 (7%)

Query: 1   MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNS 60
           +EK+NRD FYKLASDL EERVQ+A++LIK+L++L+ ++   E+EYVLNRLI GLSSNRNS
Sbjct: 2   VEKINRDLFYKLASDLQEERVQAAISLIKELASLENND--SEWEYVLNRLIKGLSSNRNS 59

Query: 61  ARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120
           ARLGFSLCLTEV+++AL++       L SI++++ ++  TL+ ++V      K GK+ERG
Sbjct: 60  ARLGFSLCLTEVLSVALEK-----GYLNSIEEYIQLLQSTLLKETV------KNGKEERG 108

Query: 121 IMFGRMFALQALLNEPLFAKVFIDKNGKI-SKFAIRFQTQLVELAVLKNWLREPCLFTLY 179
           ++FGRMF LQALLNEPL +K+F+DK G + + F + F  +LV++A+ K W+REPCLFTL+
Sbjct: 109 LLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLF 168

Query: 180 QTVEKFMPYI-DSSYIESLVQLLDKYKLTLTNEGLAIYLSLIH---TNGKKIASS----- 230
           Q VEK  P++ D+  IES+ +LLD  KL+LTNEGLAIYL LIH      K I  S     
Sbjct: 169 QVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKN 228

Query: 231 LPLESQGWKLNDPLAKGNLPTLTQVLLN-SNINQSETPQGNAANWSPRLHFVWDILLPIL 289
           L L SQ WK NDPL KGNLPTL+ VL + S +  S   Q    +W+PRLHFVW+I+LPIL
Sbjct: 229 LELNSQ-WKNNDPLTKGNLPTLSAVLKDVSPVEDSGLKQ--KGSWAPRLHFVWNIILPIL 285

Query: 290 L--GQDSTTNDEHVXXXXXXXXXXXXXXXXXXX---WKMVVDESFFNEKSSSERKYLGFL 344
               Q+  ++DEH+                      WK VVDESFFNEKSS ERKYLGFL
Sbjct: 286 ARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFL 345

Query: 345 IIQKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKIT 404
           I++ + + VP  LV  LF +N++R++INQS+D+KR+LHKISQKVL SI+E CE    K  
Sbjct: 346 ILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTV 405

Query: 405 PIVKVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIF-IMLSNEIKGSSESIQK 463
           P ++ +LF ENG  NFD                   + LS +  + +S+     +E    
Sbjct: 406 PSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAAL 465

Query: 464 DQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFL-------KENERISNI----- 511
            +F+LD++LHVVR HK  ++  T +  L+T VI + FF        +EN+   +      
Sbjct: 466 TRFLLDSMLHVVRTHK-TVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEF 524

Query: 512 -AKERFFSLLSELAAITTS---TRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGI 567
            A+ER +S+L++L  ++     + SW Y  L+++ ++E S   L   +D  L  IK   +
Sbjct: 525 QARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQEQS-KELIHPLDDGLNKIKLDAL 583

Query: 568 ECL----KEVTKKSDTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDDSV- 622
             L    +E+       Q               Y GD +S+S++EDL TFY    D S  
Sbjct: 584 NDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEE 643

Query: 623 -SLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQL 681
            SL+G+ EILLALLAQ+KA+L++++L+ WE FV  +G  E++VL D+L+ARENKEGF  L
Sbjct: 644 NSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDILSARENKEGFTAL 703

Query: 682 F 682
           F
Sbjct: 704 F 704

 Score =  228 bits (581), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 173/280 (61%), Gaps = 14/280 (5%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            KI+KETTSALAKALNLPD IINENGEV+ + L                            
Sbjct: 781  KIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMELDD 840

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLS+IF+RRKEALS +++GN+RKL+ KESRENVIAFKH+++D+LE ++K+VE+ 
Sbjct: 841  ------QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVER- 893

Query: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
            TS+  E      E  L  V  M   +++C+Q T D+ LADK+SKL+K ++ K+ L    N
Sbjct: 894  TSKNKE----CGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLIN 949

Query: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977
             +   +E  ++ L A+H L++  K GQ  +LYFS CS  SLFLSKLL++ +  D     +
Sbjct: 950  DSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDS---IY 1006

Query: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSAT 1017
             +LIDIY    KKW  KG+FG   F DF NWL SKK +++
Sbjct: 1007 DRLIDIYLSTMKKWFSKGKFGTSFFFDFINWLASKKQTSS 1046

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  534 bits (1376), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 298/698 (42%), Positives = 448/698 (64%), Gaps = 33/698 (4%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61
           +V+RD FYKLASD+PEER+ S V ++ +L  L    E EKE+ YV++RL+ GL SNRNSA
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 62  RLGFSLCLTEVVNLALDR--KDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGK--D 117
           RLGFS+CLTE ++L L R   ++P  CL+ + D+L  VD    L +V TGK   K K  D
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERP-RCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKD 120

Query: 118 ERGIMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFT 177
           ERG +FGR+FA + LLNEPLF+ +F        KF I FQ ++++L  +KNWL EPC F+
Sbjct: 121 ERGTLFGRLFAYKVLLNEPLFSLLFD------QKFLIEFQERVIQLGSMKNWLLEPCFFS 174

Query: 178 LYQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIA-SSLPLESQ 236
           LYQ +EK +P +D  Y ++ V  +D++KLT+TNEGL++YL L     KK   S   LE+ 
Sbjct: 175 LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLL----AKKFTLSDFTLENS 230

Query: 237 GWKLNDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPILLGQDSTT 296
            WK NDPL KGNL  + +V+L++N++ + +      NW+PRLH++WDI+L      +   
Sbjct: 231 AWKANDPLQKGNLSVMAKVMLDTNVDGANS--NTNKNWAPRLHYIWDIILREFFDNEQHG 288

Query: 297 ND-EHVXXXXXXXXXXX-XXXXXXXXWKMVVDESFFNEKSSSERKYLGFLIIQKSLELVP 354
           +D +HV                    W+ VVDESFFN+K+S ERKY G+LI QK++E VP
Sbjct: 289 SDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQKAVESVP 348

Query: 355 AQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPIVKVILFGE 414
           A  VE  F QN++RSMINQ++D+KRML+K+SQK LN+++  CE +  K+TP++  +LF E
Sbjct: 349 ASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLTALLFSE 408

Query: 415 NGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQ------FVL 468
            G+ NFD                 +   L+ +  + ++ +  S ++ + ++      F+L
Sbjct: 409 EGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNPRLKFIL 468

Query: 469 DTILHVVRNHK--LEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAI 526
           D++L+++R+ K  LE +   I++++L   I LAFF K+NE I+NIAKER  S+L+EL  +
Sbjct: 469 DSLLNLIRSQKALLETD-KEIVMEILESTIQLAFFQKDNEYINNIAKERLSSMLAELIVL 527

Query: 527 TTSTRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTK-KSDTVQXXXX 585
            ++  SW Y ALE+I  KE S + ++  +D  L+A+K + ++ LK++++ KS + Q    
Sbjct: 528 PSTDGSWPYLALEIIVTKEKSETLIDS-LDDSLVAVKAESLDILKKISELKSKSSQLLGI 586

Query: 586 XXXXXXXXXXXYAGDVDSVSIVEDLCTFYDERED-DSVSLVGITEILLALLAQRKAVLKK 644
                      Y+GD +S+ I+EDL TFY E  + ++ +  G+TEILL+LLAQRK++L+K
Sbjct: 587 ESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFTGVTEILLSLLAQRKSLLRK 646

Query: 645 IALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           ++L+ WEQF+  IG EE+ +L++ L+ARENKEGF+ LF
Sbjct: 647 LSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684

 Score =  248 bits (632), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 182/280 (65%), Gaps = 9/280 (3%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            +I+KETTSALAKALNLPDNIINENGEV+++ L                            
Sbjct: 746  QIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKMME 805

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLSEIFKRRK+ALS+V++GNQRKLDVKESRENVIAFKHRIID+LE YIK++E++
Sbjct: 806  LDD---QLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQL 862

Query: 858  TSRKLEDQPI----NKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLT 913
            +  + +   +      EQ L  +  +++A   C+Q TLD+PL +KI KL K +  KI  T
Sbjct: 863  SLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFT 922

Query: 914  FFDNGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADER 973
             F++   S +  ++  L+ IH  L T+KPGQ ++ Y+  CS++SL+L + LI+TT   E+
Sbjct: 923  LFEDIETSTE--IMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEK 980

Query: 974  SYAFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
            +  F +L+D+Y   +K W+ +G++G  +F+DFYNWL SKK
Sbjct: 981  TKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKK 1020

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  525 bits (1351), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 295/708 (41%), Positives = 447/708 (63%), Gaps = 39/708 (5%)

Query: 1   MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVE---KEFEYVLNRLISGLSSN 57
           + +VNRD F+K+AS+L +ER+++A+ LI ++S +   E E   +E+EYV+ RL+ GL+SN
Sbjct: 7   VSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLASN 66

Query: 58  RNSARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKD 117
           R  ARLGFS+CLTEV+ LAL+R+D     L SI  FL+ +++TL       G   K GK+
Sbjct: 67  RGGARLGFSMCLTEVIALALERRD----ILPSIYAFLNQLEQTL-----PAGTAFKNGKE 117

Query: 118 ERGIMFGRMFALQALLNEPLFAKVFI--DKNGKISKFAIRFQTQLVELAVLKNWLREPCL 175
           ERG++FG+MFALQ+LLNEP+F+K+F+  D N    +F + +  +L++LA+ K WLREPCL
Sbjct: 118 ERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPCL 177

Query: 176 FTLYQTVEKFMPYI--DSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLPL 233
           +++YQT++K    +  D + I  ++ LLD+ KLTLTNEGL+IYL + +      +SSL +
Sbjct: 178 YSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYL-MFNAQRDTYSSSLVI 236

Query: 234 ESQGWKLNDPLAKGNLPTLTQVLLNS-NINQSETPQGNAANWSPRLHFVWDILLPIL--- 289
            + GWK NDPL+KGN+  L  VL +   + +S+  Q     W+PRLH+VWDILLP+L   
Sbjct: 237 HNSGWKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQ--KGTWAPRLHYVWDILLPLLEDD 294

Query: 290 --LGQ--DSTTNDEHVXXXXXXXXXXXXXXXXXXXWKMVVDESFFNEKSSSERKYLGFLI 345
              GQ  +S  + +                     W+ VVDESFFNEKSS+ERKYLGFLI
Sbjct: 295 GSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERKYLGFLI 354

Query: 346 IQKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITP 405
           +++++++   +L++ L  QN+LR +INQS D++RML+KIS + L SI+  CE+   K+ P
Sbjct: 355 LEEAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECERSPAKVVP 414

Query: 406 IVKVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEI---KGSSESIQ 462
           +V+V  FG NG+ NFD                 E+E L  +  +L +++   + + +S  
Sbjct: 415 LVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQSTKDSFN 474

Query: 463 KDQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLK-ENERISNIAKERFFSLLS 521
             +F+ DT LH+ R HK  +     +  LL+ +I  AFF + +N ++S +AKER +S+L 
Sbjct: 475 LTRFIFDTFLHITRAHKTRLE-SHWVKPLLSAIIKAAFFNESDNSKLSELAKERLYSILG 533

Query: 522 ELAAITTST----RSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEV---T 574
           EL +  + +     +W Y AL++I   E SGS L+ ++D+DL ++++  I+ LK+     
Sbjct: 534 ELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKSAIKSLKQNHSDN 593

Query: 575 KKSDTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLAL 634
           K +   +               YAGD +SVSI++DL +FY+E + +S  LVGITEILL+L
Sbjct: 594 KNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEECDKESTDLVGITEILLSL 653

Query: 635 LAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           +AQRK++LKK++L+ WE FV  IG  E+ VL+  L ARENK+GFA LF
Sbjct: 654 VAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFADLF 701

 Score =  202 bits (513), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 164/276 (59%), Gaps = 11/276 (3%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            KI KE TSALAKALNLPD+I+ E+G+V L                               
Sbjct: 754  KIEKEATSALAKALNLPDSIVGEHGDVQLG--NNEEEDSDEDSDEDDDFSGEDESMDDEA 811

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLSEIFKRRKEAL SV +GN+RK++V+ESRENVI+FKHR++D+LE Y+K  ++ 
Sbjct: 812  MMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDRA 871

Query: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
             +R      I  E+  N   +++  +++C+QHTLD+ LADK +KL+K++L K+  T    
Sbjct: 872  VARN-NTSIITVEEWNNLSSIIL-PLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKE 929

Query: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977
                  E +   L+ +H+L++T+KPGQ   L+FS CS +SLFLSKL + +  + E     
Sbjct: 930  EKTVTSE-IFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGGSHE----- 983

Query: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
              LID+Y + SK W+  G+     F+DF NWL +K+
Sbjct: 984  -NLIDLYADTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL055C
           (POL5)
          Length = 1002

 Score =  502 bits (1293), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 294/711 (41%), Positives = 436/711 (61%), Gaps = 47/711 (6%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62
           +VNRD FYKL SDL +ERVQSA+ALI +L+ L   E  KE+EYVL RL+ GL+S+  SAR
Sbjct: 4   QVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNKSAR 63

Query: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGIM 122
           LGFSLCLTEV   AL+        + S +++L+ ++  L +D      K+K GK+ERG +
Sbjct: 64  LGFSLCLTEVAAAALENGH-----IGSAEEYLERLEAALPVD------KVKNGKEERGQL 112

Query: 123 FGRMFALQALLNEPLFAKVFIDKNGKISK-FAIRFQTQLVELAVLKNWLREPCLFTLYQT 181
           FGRMF LQA+LNEPLF++VF+  +G+I + FA +F  +LV+LA+ K WLR+PCLFTLYQ 
Sbjct: 113 FGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQV 172

Query: 182 VEKFMPY-IDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHT--------NGKKIASSLP 232
           +E+  P   D+ ++ +++ LLD++ LT T+EGLAIYL L +         +  KI  +LP
Sbjct: 173 IERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALP 232

Query: 233 LESQGWKLNDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPILLGQ 292
           L  + WK ++PLAKGN   L  VL +  + + + P+     W+PRLHFVWD+LLP LL +
Sbjct: 233 LVKR-WKADNPLAKGNAKALASVLKDDALIEGDGPKQKGV-WTPRLHFVWDLLLP-LLAE 289

Query: 293 DSTTNDEHVXXXXXXXXXXXXXXXXXXX------WKMVVDESFFNEKSSSERKYLGFLII 346
           +  + D HV                         W++VVDESFF+EK+SSERKYLG LI+
Sbjct: 290 EKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIM 349

Query: 347 QKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPI 406
           +K++  VP+ LV+ +F +N LR++INQS++T R LHK+S   L +I+ ACE D +K+ P+
Sbjct: 350 EKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPV 409

Query: 407 VKVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQF 466
           +  I FG NG  NFD                     L+Q+  +L  +++  +  I K +F
Sbjct: 410 LTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEHENTDISKIKF 469

Query: 467 VLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF------LKENERISNIAKERFFSLL 520
           +LDT+LHV+R HK + ++ +    LL  ++  AFF       +++E I  +++ER FS+L
Sbjct: 470 ILDTLLHVIRAHKWKAHL-SWTNPLLLALVRYAFFSAPSHLSEQSEEIITLSRERLFSVL 528

Query: 521 SELAAIT---TSTRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKS 577
            EL  ++       SW Y  LEL+  +E    PL  ++D +L  +    ++ L+++  KS
Sbjct: 529 GELIPLSKHDMGAPSWAYATLELLL-QEKEKHPLALQLDAELETVTSNALKILRKIINKS 587

Query: 578 -----DTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDDS-VSLVGITEIL 631
                +  Q               +AGDVDS S +E+L +FY+     +   LVGITEIL
Sbjct: 588 TKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEIL 647

Query: 632 LALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           L+L+AQ+K++L+K+ LV WE F+  +G EE+++L++ L+ARENK GFAQLF
Sbjct: 648 LSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLF 698

 Score =  208 bits (530), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 119/278 (42%), Positives = 163/278 (58%), Gaps = 22/278 (7%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            KI+KE TSALA AL LPDNI++E+G V  +                              
Sbjct: 744  KIDKEATSALAHALRLPDNILDEDGNVGFEE--------------MDDEEEEEESMDDEA 789

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLSEIFKRRK+AL+ + +GNQRK++ KESR++VIAFKHR++D+LE Y K VE+ 
Sbjct: 790  MMELDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERS 849

Query: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
             ++  +        +L+    M   MV+ IQ TLDRPLA+KISKLLK  + K+    +  
Sbjct: 850  VTKNKKLSATMSANMLS----MAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKE 905

Query: 918  GNVS-NQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYA 976
                 N+ES+LT L+ +H  +++ KPGQ   L+FS CS++SLFLSK+LI   +    S  
Sbjct: 906  FTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTS-- 963

Query: 977  FSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKN 1014
              Q+I IY    K W + G+FGP  F+DF NWL SKK+
Sbjct: 964  -EQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKS 1000

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
           Ashbya gossypii ACR020C
          Length = 1027

 Score =  497 bits (1279), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 289/726 (39%), Positives = 434/726 (59%), Gaps = 63/726 (8%)

Query: 1   MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNS 60
           M++VNRD FY+LASD+ EERV++AV ++ +LS +   + E+E++YVL RLI GL+S R  
Sbjct: 1   MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG 60

Query: 61  ARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120
           ARLGFS+CL+EVV L L++       L S++ ++  +      + +A G  +K GK+ERG
Sbjct: 61  ARLGFSMCLSEVVTLGLEKGR-----LESVEVYIGQL-----FEKLADGH-VKNGKEERG 109

Query: 121 IMFGRMFALQALLNEPLFAKVFIDKNGKIS--KFAIRFQTQLVELAVLKNWLREPCLFTL 178
           ++FG++F LQALLNEPLF ++F+D  GK+   +F + F   LV+LA+ K WLREPCLFTL
Sbjct: 110 LVFGKLFGLQALLNEPLFGRIFMD--GKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTL 167

Query: 179 YQTVEKFMP-YIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTN--------GKKIAS 229
           YQ +EK    + +  ++E++ +LLD +KLTLTNEGLAIYL LI+            KI S
Sbjct: 168 YQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILS 227

Query: 230 SLPLESQGWKLNDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPIL 289
            + L S  WK NDPL+KGN+  L+ VL    I   +       +W+PRLHFVWDIL+PIL
Sbjct: 228 KITLRS-CWKNNDPLSKGNVTILSSVL-KDIIPVEDNVMKQKGSWAPRLHFVWDILIPIL 285

Query: 290 LGQDSTTND-EHV-----XXXXXXXXXXXXXXXXXXXWKMVVDESFFNEKSSSERKYLGF 343
             Q       EHV                        W++VVDESFFN K+SSERKYLG 
Sbjct: 286 CRQQEIPGAAEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYLGL 345

Query: 344 LIIQKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKI 403
           LII+K+++ VP+  V S+F +N++R++INQS+++ R LHKIS  VL +I+  CE D TK+
Sbjct: 346 LIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKV 405

Query: 404 TPIVKVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQK 463
            P+V  + FG NG+ NFD                 + E L+ +  ++ +EI   S  + K
Sbjct: 406 LPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSK 465

Query: 464 DQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF------------------LKEN 505
            +++LD +LH+V+ HKL+ ++      LL+ ++ L+FF                    E+
Sbjct: 466 VRYLLDILLHIVQAHKLKADM-FWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHADADAES 524

Query: 506 ERISNIAKERFFSLLSELAAITTSTR-----SWQYTALELISNKEASGSPLNQEMDQDLI 560
           ++I  +++ER FS+L +L  I TS +     +W Y  L+++  +E   S L  ++D++L 
Sbjct: 525 KKIPVLSRERLFSILGQL--IPTSKQNVDGPTWPYVTLQIVIAEEHRRS-LIFKLDEELQ 581

Query: 561 AIKEKGIECLKEVTKKS----DTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDE 616
             KE  ++ + ++ KKS       +               Y+GD +S SI+E+L TFY  
Sbjct: 582 QTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKS 641

Query: 617 REDDSVSLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKE 676
            +     LVGITEILL+++AQ+KAVL+++ L+ WE  +  I  +E+ +L D+L+ RENK+
Sbjct: 642 IDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQ 701

Query: 677 GFAQLF 682
           GFA LF
Sbjct: 702 GFAALF 707

 Score =  225 bits (573), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 170/277 (61%), Gaps = 18/277 (6%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            KINKETTSALA AL LP+N+I+ENG+V  +                              
Sbjct: 767  KINKETTSALADALKLPENMIDENGDVGFED-----------FDDGDEEEEEEESMDDEA 815

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLSEIFKRRKEALS V +GN+RKL+V+ESRE+VI+FKHR++D+LE Y KYV ++
Sbjct: 816  MMELDGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRL 875

Query: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
              +    Q     +LLN +  M++ +++CIQ T+DRPLA+K +KLLK  + K+ L  F  
Sbjct: 876  AGK---SQQCEASKLLN-IHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKG 931

Query: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977
                  E V   L+ IH  ++  KPGQ   LYF  CSTSSLFL K+L+  T  DE +Y  
Sbjct: 932  CVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILV-VTKPDEVTY-- 988

Query: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKN 1014
            +++IDIY +  K W +KG+FGP  F+DF NWL SK++
Sbjct: 989  NRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKRS 1025

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
           YEL055C
          Length = 1041

 Score =  479 bits (1234), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 294/713 (41%), Positives = 428/713 (60%), Gaps = 38/713 (5%)

Query: 1   MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSE-------VEKEFEYVLNRLISG 53
           M+ VNRD FY+LASDL EER+QS V L+K+L  LK +        V KE+ YV+NRLI+G
Sbjct: 1   MQVVNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLING 60

Query: 54  LSSNRNSARLGFSLCLTEVVNLALDRKDQPL--TCLRSIDDFLDMVDKTLVLDSVATG-- 109
           L+SNR  ARLGFSLCLTEV+NLAL +K + +    L  I  FL ++  TL + S   G  
Sbjct: 61  LASNRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEP 120

Query: 110 KKLKKGKDERGIMFGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNW 169
           +KL KGKDERG++FG++FALQ+LLN+P+F K+F   N  I      F  +L+ L+ LKNW
Sbjct: 121 RKLLKGKDERGLLFGKLFALQSLLNDPIFGKIFNKDNKAI---LFEFIYELIALSNLKNW 177

Query: 170 LREPCLFTLYQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIAS 229
           ++EP LFTL+  ++K + ++D S I  L+ +L    LTLTNEGL+IY+ LI+TN      
Sbjct: 178 IKEPTLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPHISPE 237

Query: 230 SLPLE---SQGWKLNDPLAKGNLPTLTQVLLN-SNINQSETPQGNAANWSPRLHFVWDIL 285
            + ++   +  WK NDP  K N+  L++VLLN S  +QSE    N ANW+PRLH+VWD++
Sbjct: 238 DIQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSEKHTSN-ANWTPRLHYVWDVI 296

Query: 286 LPILLGQDSTTNDEHVXXXXXXXXXXXXXXXX-XXXWKMVVDESFFNEKSSSERKYLGFL 344
           LPILL   S+  D+ +                    W+ V+DESFFNEK+S ERKYLGFL
Sbjct: 297 LPILLNPKSS--DKLLNKNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKASHERKYLGFL 354

Query: 345 IIQKSLELV-PAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-K 402
           IIQK+  L+  A  +ES+F  N++RS+INQ  D+KR L+KIS K ++ I+  C+ ++  +
Sbjct: 355 IIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSNSELR 414

Query: 403 ITPIVKVILFGENGAT--NFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSES 460
           + P++   LF E  ++  NFD                   +TLS++F + ++++   + +
Sbjct: 415 LIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSKLDSFTTT 474

Query: 461 IQKDQFVLDTILHVVRNHKLEMNIGTIIIQ-LLTPVIDLAFFLKENE-RISNIAKERFFS 518
            +  QF+LD+ILH++R+HK ++ +    +  +L P+I L FF +  +  ISNI K+R  S
Sbjct: 475 TEL-QFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKETADVSISNILKDRLIS 533

Query: 519 LLSELAAITTSTRSWQYTALELISN-KEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKS 577
           +L++L  +  ++ S QY  L LI N  E   + LN + D  L+ +K+  I  LK   + S
Sbjct: 534 ILNDLTTVGENSSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVKDSAITTLKRAIEHS 593

Query: 578 D-TVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDE-------REDDSVSLVGITE 629
               +               Y  D+DS++ ++DLC FYD        + D +   +GI E
Sbjct: 594 KRDSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSNTIMKNDKNRPSLGIIE 653

Query: 630 ILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           ILLAL AQ+K++LKK+ L  WE F+  I   E   + DVL  RENKEGFA+LF
Sbjct: 654 ILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRENKEGFARLF 706

 Score =  227 bits (579), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 131/287 (45%), Positives = 177/287 (61%), Gaps = 12/287 (4%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            +I+KE TSALAKAL LPDNIIN+ GEVDL  L                            
Sbjct: 759  RIDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMDDEQ 818

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLS+IF RRKEALS++ +GN+RKLDVKESRENVIAFKHRI+D++E Y+K++E I
Sbjct: 819  MMELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKHIEII 878

Query: 858  T--SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFF 915
            T  S  +E    NK  +LN + +++ +++ CIQ TLDR LA+KISKLLK KLFKI L  F
Sbjct: 879  TKSSENIERTYFNK--ILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLVEF 936

Query: 916  DNGNVSNQESVLTQLKAIH-ELLITSKPGQHASLYFSVCSTSSLFLSKLLIET-TNADER 973
             +      E++L  +  +H E ++  K GQ+  LYF +CS SSLF  ++  ET TNAD  
Sbjct: 937  KDCGDLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNAD-- 994

Query: 974  SYAFSQLIDIYGELSKKWLLKG--RFGPIVFMDFYNWLNSKKNSATT 1018
               +  LID+YG+ +K W      +    +F DF+NWL+SK++  T+
Sbjct: 995  --LYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKRSVTTS 1039

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
           (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  444 bits (1141), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 276/714 (38%), Positives = 411/714 (57%), Gaps = 56/714 (7%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62
           ++NRD FYKLASDL EER+Q+ + L+  LS L+      E++YVL+RLI GLSS+RN AR
Sbjct: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDS--SEWQYVLDRLIKGLSSSRNGAR 62

Query: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGIM 122
           LGFSLCLTEVV LAL++       L  +D ++ +      L S  + + +K GK+ERG++
Sbjct: 63  LGFSLCLTEVVALALEK-----GVLARVDQYMHL------LISALSKENVKNGKEERGLL 111

Query: 123 FGRMFALQALLNEPLFAKVFI-DKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQT 181
           FG++F LQ LLNEPLF+KVF  D+N    +    + + L+++A+ K W+RE  LFTL+Q 
Sbjct: 112 FGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQA 171

Query: 182 VEKFMPYIDSSY-IESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLP-LESQG-- 237
           VEK  P + S   ++++++LLD   LT T+EGLAIYL L+H    + + + P L  +G  
Sbjct: 172 VEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLH----RCSHTGPVLRKKGFL 227

Query: 238 --------WKLNDPLAKGNLPTLTQVLLNSNI--NQSETPQGNAANWSPRLHFVWDILLP 287
                   WK NDPL +GNLP ++  L +S    + S T +G    W+PRLHF WDI+L 
Sbjct: 228 DELNLKNPWKNNDPLKRGNLPAISNALKDSGARDDPSLTQKGV---WAPRLHFAWDIVLQ 284

Query: 288 ILL-GQDSTTNDEHVXXXXXXXXXXXXXXXXXXXWKMVVDESFFNEKSSSERKYLGFLII 346
            LL  ++S                          WK VVDESFFNEKSSSERKYLG L+ 
Sbjct: 285 TLLHAENSEITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLGILVF 344

Query: 347 QKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPI 406
           +K+ +L P + +  LF +N++R +INQ    +R LHKISQK L +I+E C+    K  P 
Sbjct: 345 EKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPS 404

Query: 407 VKVILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQF 466
              + FGE G  NFD                   + L  +   L + + G+ + + + +F
Sbjct: 405 FVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARF 464

Query: 467 VLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF-------LKENER----ISNIAKER 515
           +LD ILH+VR HK   +    +  +L  ++ L FF       +K+++     +S+IA ER
Sbjct: 465 ILDAILHLVRAHKAHAD-EVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASER 523

Query: 516 FFSLLSELAAITTSTRS--WQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEV 573
            FS+L++L  +   T S  W + A++L+   + +   L Q MD++L  I +  +  L  +
Sbjct: 524 LFSILADLLTVEQDTYSVCWPFIAVQLLKT-DTNQKTLLQSMDEELGDILDSSMTVLSSI 582

Query: 574 TKKSDTV---QXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDEREDD--SVSLVGIT 628
           ++K++     Q               YAG+V+S+S++EDL +F +E ED   S  L G  
Sbjct: 583 SQKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFI 642

Query: 629 EILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           EILL+L AQ+KA+ +K +L+AWE FV  +  +++ VL++VL  RENKEGF+ LF
Sbjct: 643 EILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFSNLF 696

 Score =  207 bits (528), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 115/276 (41%), Positives = 175/276 (63%), Gaps = 17/276 (6%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            KI+KE TSALAKALNLPD+I+++ GEV  +                              
Sbjct: 747  KIDKEATSALAKALNLPDSIVDDKGEVRFED----------LGDTDEEEEESEEDLDDEK 796

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLSEIFKRRKEALS + +GN+RK +VKESRENVIAFKHR++D+LE  ++++E  
Sbjct: 797  MMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE-- 854

Query: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
             S+  +D  I K  +L+ VF ++  +++CI+ TLD+PLA+KI+KLLK K+ K+  +F   
Sbjct: 855  -SKMKKDGHIEK-SVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSST 912

Query: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977
                ++++VL+ L+++HE ++  K GQ  +LYFS CST+S+FL++L+++T    E    +
Sbjct: 913  TEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELE---TY 969

Query: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
             +L  IY +    W + G+FG  +F++F NWL+ KK
Sbjct: 970  EELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKK 1005

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa]
           {ON} similar to uniprot|P39985 Saccharomyces cerevisiae
           YEL055C
          Length = 1006

 Score =  422 bits (1084), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 269/712 (37%), Positives = 402/712 (56%), Gaps = 51/712 (7%)

Query: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62
           +V+RD FYKLASDL EER+Q+ + L+  LS  K  +  +E+EYVLNRLI GLSS+RN AR
Sbjct: 5   EVDRDLFYKLASDLSEERLQAIIGLVTQLS--KVEKESREWEYVLNRLIKGLSSSRNGAR 62

Query: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGIM 122
           LG+ LCLTEVV  AL++     + L   D++L ++  TL  +++      K GK+ERGI+
Sbjct: 63  LGYCLCLTEVVASALEK-----SVLAHADEYLRLLLSTLSRENI------KNGKEERGIL 111

Query: 123 FGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQTV 182
           FG++F LQ LLNEPLF++VF  ++    +F + +   L+++A+ K W+RE  +FTLYQ +
Sbjct: 112 FGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAI 171

Query: 183 EKFMPYIDSSY-IESLVQLLDKYKLTLTNEGLAIYLSLIH----TNG----KKIASSLPL 233
           EK  P + S   +++L+ LLD   LT T+EGLA+YL L H    T G    K +   L L
Sbjct: 172 EKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKL 231

Query: 234 ESQGWKLNDPLAKGNLPTLTQVL--LNSNINQSETPQGNAANWSPRLHFVWDILLPILL- 290
            S  WK NDPL+KGNLP +   L  +NS+ + S   +G    W PRLHFVWDI+L     
Sbjct: 232 NSP-WKNNDPLSKGNLPAIANALKEINSSEDLSVKQKGI---WMPRLHFVWDIILTSFFE 287

Query: 291 -GQ-DSTTNDEHVXXXXXXXXXXXXXXXXXXXWKMVVDESFFNEKSSSERKYLGFLIIQK 348
            G+ +   ++                      WK VVDESFFNEKSSSERKYLGFL+ +K
Sbjct: 288 GGEYEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEK 347

Query: 349 SLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPIVK 408
           +  L P     +L  +N+ R +INQ   ++R LHK+SQ+VL +I++ C+    K  P  +
Sbjct: 348 AFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFE 407

Query: 409 VILFGENGATNFDXXXXXXXXXXXXXXXXXEEETLSQIFIMLSNEIKGSSESIQKDQFVL 468
            +   E+G+ +FD                  ++ L+ +  +L+N +  S     + +F+L
Sbjct: 408 TLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLRDHSRVRFLL 467

Query: 469 DTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF-LKENER----------ISNIAKERFF 517
           D +LH+VR HK   +    +  LL  ++   FF L EN+R          +S +A ER +
Sbjct: 468 DAMLHLVRAHKSAAD-KVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLY 526

Query: 518 SLLSEL--AAITTSTRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLK---- 571
           S+L++L  A   +    W    +E++ +K      LN  MD++L  I    I+  K    
Sbjct: 527 SILADLISADYKSEKVCWPRFTVEILMSKLKKNKLLNP-MDEELTEILNSSIKTFKTICS 585

Query: 572 EVTKKSDTVQXXXXXXXXXXXXXXXYAGDVDSVSIVEDLCTFYDE-REDDSVSLVGITEI 630
           E  K    +Q               Y+G+ DS+ +++DL +F+    E+ S S  G  EI
Sbjct: 586 EAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEI 645

Query: 631 LLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682
           LL+L AQ+KA+L+K +L+ WE FV     +++ VL+++L ARENKEGF++LF
Sbjct: 646 LLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEILPARENKEGFSKLF 697

 Score =  183 bits (465), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/276 (37%), Positives = 166/276 (60%), Gaps = 18/276 (6%)

Query: 738  KINKETTSALAKALNLPDNIINENGEVDLDALXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
            +I+KE TSAL KALNLP++I+N+NGEV  +                              
Sbjct: 744  QIDKEATSALVKALNLPESIVNDNGEVHFED-----------LEDTEDEEISDEDLDDEK 792

Query: 798  XXXXXXQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857
                  QLSEIFKRRKEALS + +GN+RK +VKESRENVIAFKHR++D+LE ++++ E  
Sbjct: 793  MMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAE-- 850

Query: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917
            +  K   +P  ++ + + +  ++  ++ C++ TLD+PLA+K++KLLK K+ K+ +T   +
Sbjct: 851  SELKQGGRP--EKSVTSKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKITTDTS 908

Query: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977
             +   +      LK++HE ++  K GQ  +LYFS CST+S+FL+KL +  +    R   +
Sbjct: 909  LDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRS---PRPETY 965

Query: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013
              L ++Y +   +W + G+F   +F++F NWL+ KK
Sbjct: 966  FTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKK 1001

>CAGL0L02827g Chr12 complement(330885..332939) [2055 bp, 684 aa]
           {ON} similar to uniprot|P29461 Saccharomyces cerevisiae
           YOR208w PTP2 protein-tyrosine-phosphatase
          Length = 684

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 75/171 (43%), Gaps = 15/171 (8%)

Query: 72  VVNLALDRKDQPLTCLRSIDDFLDMV--DKTLVLDSVATGKKLKKGKDERGIMFGRMFAL 129
            V   +D   +P+  L+ +D     V  D  LV+D  +  +       ++ +M   +   
Sbjct: 4   AVGATVDLSGKPMNTLKYVDGIFSAVSSDPVLVIDLASHSQSFLMQNKDKSVMKVNLKLP 63

Query: 130 QALLNEPL--FAKV----FIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQTVE 183
             LL  P+  FAK+      D+   +    IR    +V    + ++ R  CL T Y  +E
Sbjct: 64  TTLLKRPVYGFAKLIDITLDDERKALLLDLIRHTKTVVFFDNVSSFHR--CLMTTYYFIE 121

Query: 184 KFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLPLE 234
           KF+ Y+D+S    +V     Y L+ ++E  +I  S + T  KK   +L LE
Sbjct: 122 KFISYVDNSLGTEMV-----YVLSPSDEVNSIKFSPVETTSKKRRLNLKLE 167

>CAGL0L08360g Chr12 complement(920859..923699) [2841 bp, 946 aa]
           {ON} similar to uniprot|P40462 Saccharomyces cerevisiae
           YIL137c
          Length = 946

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 442 TLSQIFIMLSNEIKGSSESIQKDQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF 501
           T+    +ML++  +G      + + + DTI+  ++N KL+ N       L T +IDLA+F
Sbjct: 554 TIDNTILMLNHNGQGYFRVSYESETIYDTIVENLQNSKLDDN------NLKTILIDLAYF 607

Query: 502 LKENERISNIAKERFFSLLSELAA 525
           + + +   ++  +  F +LS  AA
Sbjct: 608 IGDKKYQKDVHIKGLFKILSAFAA 631

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
            HSL1Nim1p-related protein kinase that regulates the
            morphogenesis and septin checkpoints; associates with the
            assembled septin filament; required along with Hsl7p for
            bud neck recruitment, phosphorylation, and degradation of
            Swe1p
          Length = 1518

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 47/104 (45%), Gaps = 1/104 (0%)

Query: 137  LFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQTVEKFMPYIDSSYIES 196
            LF    ++    +    +  ++  V L  +    R+P +     T++K M  + SS++ +
Sbjct: 930  LFMSEHVEDEKPVKASDVSIESSYVPLTTVATSSRDPSVLAESSTIQKPMLSLPSSFLNT 989

Query: 197  LVQLLDKYKLTLTNEGLAIYLSLIHTNGKKIASSLPLESQGWKL 240
             +   +  ++ L ++G   +LS+     + +A S PL  Q  K+
Sbjct: 990  SMTFKNLSQI-LADDGDDKHLSVPQNQSRSVAMSHPLRKQSAKI 1032

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,551,326
Number of extensions: 3495554
Number of successful extensions: 12204
Number of sequences better than 10.0: 36
Number of HSP's gapped: 12277
Number of HSP's successfully gapped: 74
Length of query: 1019
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 899
Effective length of database: 39,721,479
Effective search space: 35709609621
Effective search space used: 35709609621
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)