Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.796.8ON50850826350.0
TPHA0J002606.8ON51550914440.0
TDEL0G046306.8ON50350714330.0
SAKL0E00792g6.8ON51150712801e-172
KNAG0E027706.8ON50852812051e-161
NDAI0G00860singletonON52352911881e-158
Skud_16.56.8ON51552411871e-158
YPL272C6.8ON51752511471e-152
Smik_6.4806.8ON51652511381e-151
Suva_16.336.8ON51852611331e-150
CAGL0A01089g6.8ON53555011321e-149
TPHA0M001806.8ON50351710971e-145
KAFR0B065106.8ON50851910511e-138
NCAS0D021806.8ON5155198551e-108
TBLA0A072206.8ON5095278381e-106
KLTH0C11572g6.8ON5185157682e-95
Ecym_30116.8ON5095167291e-89
Kwal_56.223416.8ON5195186933e-84
ACR018C6.8ON4784776145e-73
Kpol_1032.1singletonON2462433204e-33
Kpol_191.16.8ON1391361875e-16
Kwal_27.98985.119ON4603051125e-05
CAGL0K00737g5.119ON4572991115e-05
Kpol_1010.495.119ON481129980.003
KLTH0C02178g5.119ON464123960.004
TDEL0E051105.119ON469123890.024
Ecym_24835.119ON461308870.051
YGR212W (SLI1)5.119ON468119840.12
TPHA0H009605.119ON476140790.41
ACL144C7.354ON549112780.67
Skud_7.5485.119ON47599760.96
Ecym_13641.454ON437150751.2
Suva_7.5065.119ON466291742.0
TBLA0D023208.4ON83279697.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.79
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...  1019   0.0  
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   560   0.0  
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   556   0.0  
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   497   e-172
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   468   e-161
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              462   e-158
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   461   e-158
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   446   e-152
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   442   e-151
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   441   e-150
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   440   e-149
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   427   e-145
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   409   e-138
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      333   e-108
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   327   e-106
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   300   2e-95
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   285   1e-89
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   271   3e-84
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   241   5e-73
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   127   4e-33
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    77   5e-16
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    48   5e-05
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    47   5e-05
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    42   0.003
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    42   0.004
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    39   0.024
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    38   0.051
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    37   0.12 
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    35   0.41 
ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON} Syn...    35   0.67 
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    34   0.96 
Ecym_1364 Chr1 (747171..748484) [1314 bp, 437 aa] {ON} similar t...    33   1.2  
Suva_7.506 Chr7 (873531..874931) [1401 bp, 466 aa] {ON} YGR212W ...    33   2.0  
TBLA0D02320 Chr4 (588496..590994) [2499 bp, 832 aa] {ON} Anc_8.4...    31   7.1  

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/508 (97%), Positives = 495/508 (97%)

Query: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLV 60
           MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLV
Sbjct: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLV 60

Query: 61  NALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLR 120
           NALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLR
Sbjct: 61  NALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLR 120

Query: 121 HIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHI 180
           HIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHI
Sbjct: 121 HIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHI 180

Query: 181 TDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL 240
           TDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL
Sbjct: 181 TDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL 240

Query: 241 DIITFNSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFIC 300
           DIITFNSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFIC
Sbjct: 241 DIITFNSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFIC 300

Query: 301 GIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNNI 360
           GIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNNI
Sbjct: 301 GIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNNI 360

Query: 361 NVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKKM 420
           NVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKKM
Sbjct: 361 NVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKKM 420

Query: 421 KFTSDDKASNTKIIQINDVSEFXXXXXXXXXXXXXELNFTHSISNSDFMSLSYTYCKETG 480
           KFTSDDKASNTKIIQINDVSEF             ELNFTHSISNSDFMSLSYTYCKETG
Sbjct: 421 KFTSDDKASNTKIIQINDVSEFKINSSKSSKVSIKELNFTHSISNSDFMSLSYTYCKETG 480

Query: 481 SNICIHYPDAYDMEKFVERFQSFVADQQ 508
           SNICIHYPDAYDMEKFVERFQSFVADQQ
Sbjct: 481 SNICIHYPDAYDMEKFVERFQSFVADQQ 508

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/509 (53%), Positives = 363/509 (71%), Gaps = 9/509 (1%)

Query: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDD--ATLLTNSEPLLLDSRLVN 61
           FR L +YE+ ++ ++   Q+NG IFSAKY     +   +D  ATLLT +E   + SR +N
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFIN 62

Query: 62  ALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRH 121
           AL  ++ ++PEL TT+N KLEFE + EIKT D+I+S+KF+S KDEFVNC  GAPPYLLRH
Sbjct: 63  ALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLRH 122

Query: 122 IFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHIT 181
           IFN++KF PGSGKPLW L ++DDS+V+FHGQDVLFDI++AA+FH+ F   L         
Sbjct: 123 IFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTS-E 181

Query: 182 DLEYIYRY-DATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL 240
            L  I+R  D +KS  +  FP++IY++P L +P KTIDLV+LQT+ F KS     I KPL
Sbjct: 182 KLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKPL 241

Query: 241 DIITFNSEPMK-YIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFI 299
           +II FN EPMK +   + +D + + S+LCGTTVFG+I+ +RF+YL SIA  ENVC +S +
Sbjct: 242 NIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVCTKSLV 301

Query: 300 CGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNN 359
           CGI +LCLK +IKDF+ +ITFSI +NLR+SIE  ++FGLFYK + +E PLS IDD V+  
Sbjct: 302 CGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFKL 361

Query: 360 INVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKK 419
              YNGYD SN  + ET+P +EE+ + YQF QI+  +S  +K+RMRAWRRNGFNDDDIK 
Sbjct: 362 KTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIKM 421

Query: 420 MKFTSDDKASNTKIIQINDVSEFX----XXXXXXXXXXXXELNFTHSISNSDFMSLSYTY 475
           MKF S DK ++ KIIQIND+S+                  +L+FTHS+    FMSLSYT+
Sbjct: 422 MKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSYTH 481

Query: 476 CKETGSNICIHYPDAYDMEKFVERFQSFV 504
           CK TGSNICIH+P+ YD+E FVE+FQ+F+
Sbjct: 482 CKSTGSNICIHFPEVYDLELFVEKFQNFI 510

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/507 (54%), Positives = 357/507 (70%), Gaps = 9/507 (1%)

Query: 3   SFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLVNA 62
           SFR LG +EKK++ Q+L G  NG++F A Y S   +  +DDATLLT  +  L  S L   
Sbjct: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMY-STTPEEWSDDATLLTYKDSRLNLSLLSRT 60

Query: 63  LQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRHI 122
           L KM+  H EL TT+NEKLEF  VKEIK  ++I +V F S KDEFVNC  GAPPYLLRHI
Sbjct: 61  LAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120

Query: 123 FNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHITD 182
           FN+  F PGSG  LW++ V+D++LV+FHG DVLFDIF+AANFHK+FL+TLNS+     + 
Sbjct: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSG-SK 179

Query: 183 LEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPLDI 242
           L  I++ +         FP++IY+N KLR+P K  DL NLQTQSFFKS Y NA+KKPLD 
Sbjct: 180 LSTIFKLEKAVLP---PFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDY 236

Query: 243 ITFNS-EPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFICG 301
           I  N  + +K  +    D +   + LCGTT+FG I   R E L+ I + +N+C++SF+CG
Sbjct: 237 INSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCG 296

Query: 302 IALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNNIN 361
           I +LCLK ++K++TGSITF +PV+LR S+E  S+FG+FYK I VECPLSLIDD+ +N++ 
Sbjct: 297 ITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLT 356

Query: 362 VYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKKMK 421
           VYNGYD+S VK+PE DP ++E+ LEYQFKQ++D V   +++RM+AW + GFNDDDIK+MK
Sbjct: 357 VYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMK 416

Query: 422 FTSDDKASNTKIIQINDVSEFXXXXXX--XXXXXXXELNFTHSISNSDFMSLSYTYCKET 479
           F SDD A+NTK+IQINDVS+                ELN T S+     MSLSYT+  E 
Sbjct: 417 FGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTH-SEK 475

Query: 480 GSNICIHYPDAYDMEKFVERFQSFVAD 506
           G +ICIHYPD Y+ME FVE FQSF+ D
Sbjct: 476 GLDICIHYPDGYNMESFVECFQSFIED 502

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  497 bits (1280), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 342/507 (67%), Gaps = 8/507 (1%)

Query: 3   SFRQLGTYEKKLVGQALAGQSNGIIFSAKYIS--NAQDGLTDDATLLTNSEPLLLDSRLV 60
           SFR L + EKKL  Q L  + NG++F+A Y +  + ++  +D+ATLLT  +  L +S + 
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65

Query: 61  NALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLR 120
            AL+K++  + EL TT+N+ LEF+ VK I   D++  V+FDS KDE VNCH G PPYLLR
Sbjct: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125

Query: 121 HIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHI 180
           HIF++NKF     KPLW++ ++D+++V+FHG DVLFDIFAAANFHKLF + LN +  +  
Sbjct: 126 HIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDGP 185

Query: 181 TDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL 240
           T LE +++ D+  S     FP++IYEN KLR+P    DL  LQTQSFFKS Y   IKKPL
Sbjct: 186 T-LECLFKNDSKAS----FFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPL 240

Query: 241 DIITFN-SEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFI 299
           D I  N +  +KY +    D +  A+ LCGTTVFG+I+ +R   L  I + EN+C+ SF+
Sbjct: 241 DFINTNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFV 300

Query: 300 CGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNN 359
           C IALLCLK ++ +F  S+TFSIPV+LR +I   S FGL YK +LVECPL+LIDD+V+  
Sbjct: 301 CAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQG 360

Query: 360 INVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKK 419
           +NVYNGYD  N K    DP +EE  LEYQF++    V  T+K+R RAW R+GFNDDDIK+
Sbjct: 361 LNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKR 420

Query: 420 MKFTSDDKASNTKIIQINDVSEFXXXXXXXXXXXXXELNFTHSISNSDFMSLSYTYCKET 479
           MKF   ++  + +II++N+V+EF             ++ FT S +   FMSLS  + + +
Sbjct: 421 MKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERS 480

Query: 480 GSNICIHYPDAYDMEKFVERFQSFVAD 506
           G N+CIHYPD Y+M+ FVE FQSF+ +
Sbjct: 481 GLNVCIHYPDGYNMDVFVECFQSFMEE 507

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  468 bits (1205), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 252/528 (47%), Positives = 344/528 (65%), Gaps = 44/528 (8%)

Query: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDD-ATLLTNSEPLLLDSRL 59
           M+S R L ++EKKL+ Q++ G  NG  F A+Y S  ++G +D+ ATLLT  +  L    L
Sbjct: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEY-STFKEGWSDEEATLLTVKDSRLCLGLL 59

Query: 60  VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLL 119
             AL+ ++ KH EL  T+NE+ EFE +K+IKTSD+I++++FDS KDE +NC LGAPPYLL
Sbjct: 60  TKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLL 119

Query: 120 RHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLN--SMDD 177
           RHIFN ++F PGSGKPLW+L ++DDSL  FHGQD LFD+F+ ANFH+L L+ +N  S   
Sbjct: 120 RHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRP 179

Query: 178 EHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIK 237
           +    L+Y++++     +     P++IY+NPKL IP    DL NLQTQSFFKS YVN +K
Sbjct: 180 QKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVK 239

Query: 238 KPLDIIT--------FNSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIAR 289
           KP++ +T         NS  MKY      D ++  S LCG TVFG ++ +RF+YLN+I  
Sbjct: 240 KPIEFLTNTDVSFLSLNSN-MKY-----NDILDINSKLCGNTVFGCVSNERFKYLNTIIN 293

Query: 290 HENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPL 349
            E +C++SFI GIA+LCLK M+K+ +G++TFSIPV+LR  ++ P DFGL+YK I VECPL
Sbjct: 294 QEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPL 353

Query: 350 SLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRR 409
           SLIDD    +             V E D  F+EK +EYQFK I+  V   +++R+  + +
Sbjct: 354 SLIDDDKSKDC-------MKGASVSEED--FDEKLMEYQFKNITGFVRNHLEQRLTRFSK 404

Query: 410 NGFNDDDIKKMKFTSDDK------ASNTKIIQIND-----VSEFXXXXXXXXXXXXXELN 458
            GFNDDDI++MKF  DDK      ++N   IQI D     V+EF               N
Sbjct: 405 TGFNDDDIRRMKF--DDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRA----CN 458

Query: 459 FTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506
            T S+++ + MSLSYTYC+E G NICIHYP+ Y ME FVE FQSF+ +
Sbjct: 459 LTKSLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  462 bits (1188), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 234/529 (44%), Positives = 343/529 (64%), Gaps = 32/529 (6%)

Query: 3   SFRQLGTYEKKLVGQALAGQSNGIIFSAKYIS----NAQDGLTDDATLLTNSEPLLLDSR 58
           S R L ++EKK++ Q L  + NGI ++A+Y+S    ++   L+D ATLL   +  L    
Sbjct: 2   SIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIGI 61

Query: 59  LVNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYL 118
           +   L++++ KH EL +T+NE  EF+ + +IK  D+I+ + FD+ KDE +NCH GAPPYL
Sbjct: 62  VTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPYL 121

Query: 119 LRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLN----- 173
           LRHIFN+ KF     KPLW+L +ID+++++FHG D+LFDIF+AANFHKLF + LN     
Sbjct: 122 LRHIFNKEKFE--LNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFLT 179

Query: 174 -SMDDEHITDLEYIYRYDATKSNRSISF---PRTIYENPKLRIPGKTIDLVNLQTQSFFK 229
            +    +   L+ +++ + +  N   +F   PR+I++NPKL +P  T DL NLQT+SFFK
Sbjct: 180 NTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSFFK 239

Query: 230 SFYVNAIKKPLDIIT---------FNSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDR 280
           + Y N IKKP+D+             S+  +Y   N +D +   S+LCGTTVFG ++  R
Sbjct: 240 TIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVSPTR 299

Query: 281 FEYLNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFY 340
           + YL  + + + +C+RSFICGI ++CLK  IK+++G+I FSIP+NLR  I+G  +FGLFY
Sbjct: 300 YNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFGLFY 359

Query: 341 KTILVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTM 400
           K + ++CPLSLIDD+ +     YNGY +S++   E D  F EK LEYQFKQ+++ +   +
Sbjct: 360 KDVKIDCPLSLIDDRNFK----YNGYKDSSIP-DENDLEFNEKLLEYQFKQVTEFIENVI 414

Query: 401 KERMRAWRRNGFNDDDIKKMKFTSDDK-ASNTKIIQINDVSEFXXXX--XXXXXXXXXEL 457
            ER++ W +  FNDDDIK+MKF  D+    N+KIIQIND +E                  
Sbjct: 415 LERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLGENDNNNKAFTLTNP 474

Query: 458 NFTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506
           NFT ++S ++FMS+S+  C+ETG N+CIHYPD Y ME FVE FQ+F+ +
Sbjct: 475 NFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIEE 523

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  461 bits (1187), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 243/524 (46%), Positives = 344/524 (65%), Gaps = 30/524 (5%)

Query: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYI-----SNAQDGLTDDATLLTNSEPLLL 55
           MT+FR L ++EKKL+ Q+L  Q NG IFS+ Y       N  D  +D+ TL TNS     
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKD-- 58

Query: 56  DSRL-----VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNC 110
           DSRL        L++++   P L  TVNE+ EFE +K++KTSDI+  ++F+++KD+ VNC
Sbjct: 59  DSRLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNC 118

Query: 111 HLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFL 169
           H G PP YLLRH FN+ +F PGS KPLW L VID++L++FHG DVLFDIF+AANFHKLFL
Sbjct: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFL 178

Query: 170 ETLNSMDDEHITDLEYIYRYDATKSNRS-ISFPRTIYENPKLRIPGKTIDLVNLQTQSFF 228
           + LN++  E  +D   ++  D +  N S ++FP++IY++ KL +P  T  + + QTQSFF
Sbjct: 179 KELNNISLEAHSDDRVLF--DISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236

Query: 229 KSFYVNAIKKPLDIITFNSEPMKYIKPNEI----DFMNEASALCGTTVFGHITTDRFEYL 284
           KS + N +K+P   +T  +         ++    D +N  S+LCGTTVFG +   RF YL
Sbjct: 237 KSIFYNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYL 296

Query: 285 NSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTIL 344
            SI   E++C+RSFICGIA++CLK ++KDFTG+I FSIP++LR++++     GLF+K + 
Sbjct: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELR 356

Query: 345 VECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERM 404
           +ECPLSLIDD++  +  + N  D       E D  F EK +EYQF +++  VS  +  ++
Sbjct: 357 IECPLSLIDDELSADEFLANRNDK------EDDDEFNEKLMEYQFNKVTKHVSDFIMAKL 410

Query: 405 RAWRRNGFNDDDIKKMKFTSDD---KASNTKIIQINDVSEFXXXXXXXXXX-XXXELNFT 460
           ++W +NGFNDDDI++MK+ +DD   + S TK+IQINDVS+                  FT
Sbjct: 411 KSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFT 470

Query: 461 HSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
            SI+    MSLSYTYC+E G NICIHYPD+Y++E FVE F+SF+
Sbjct: 471 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFI 514

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  446 bits (1147), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 241/525 (45%), Positives = 337/525 (64%), Gaps = 30/525 (5%)

Query: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYIS-----NAQDGLTDDATLLTNSEPLLL 55
           MT+FR L ++EKK++ Q+L  Q NG IFS+ Y       N  D  +D+ TL TNS     
Sbjct: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKD-- 58

Query: 56  DSRL-----VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNC 110
           DSRL        L++++   P L  TVNE+ EFE +K++KTSDI+  ++F+++KD+ VNC
Sbjct: 59  DSRLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNC 118

Query: 111 HLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFL 169
           H G PP YLLRH FN+ +F PGS KPLW L VID++L++FHG DVLFDIF+AANFHKLFL
Sbjct: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFL 178

Query: 170 ETLNSMDDEHITDLEYIYRYDATKSNRS-ISFPRTIYENPKLRIPGKTIDLVNLQTQSFF 228
           + LN +    +T  E    +D    N S + FP++IY++ KL +P  T  + + QTQSFF
Sbjct: 179 KELNEIST--VTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236

Query: 229 KSFYVNAIKKPLDIITFNSEPMKYIKPNEI----DFMNEASALCGTTVFGHITTDRFEYL 284
           KS Y N +K+P   +T  +     +   ++    D +N  ++LCGTTVFG +   RF YL
Sbjct: 237 KSIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYL 296

Query: 285 NSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTIL 344
            SI   E++C+RSFICGIA++CLK ++KDF+G+I F+IP+NLR  +      GLF+K + 
Sbjct: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELR 356

Query: 345 VECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERM 404
           VECPLSLIDD++  N  + N  DN +           E+ +EYQF +++  VS  +  ++
Sbjct: 357 VECPLSLIDDELSANEFLTNSNDNEDNDDEFN-----ERLMEYQFNKVTKHVSGFIMAKL 411

Query: 405 RAWRRNGFNDDDIKKMKFTSDD----KASNTKIIQINDVSEFXXXXXXXXXX-XXXELNF 459
           R+W +NGFNDDDI++MK+ +DD    + S TK+IQINDVS+                  F
Sbjct: 412 RSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGF 471

Query: 460 THSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
           T SI+    MSLSYTYC+E G NICIHYPD+Y++E FVE F+SF+
Sbjct: 472 TSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFI 516

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  442 bits (1138), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 236/525 (44%), Positives = 341/525 (64%), Gaps = 31/525 (5%)

Query: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYIS-----NAQDGLTDDATLLTNSEPLLL 55
           MT+FR L ++EKKL+ Q+L  Q NG IFS+ Y       N  D  +D+ TL TNS     
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKD-- 58

Query: 56  DSRL-----VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNC 110
           DSRL        L++++   P L  T+NE+ EFE ++++KTSDI+  ++F++LKD+ VNC
Sbjct: 59  DSRLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNC 118

Query: 111 HLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFL 169
           H G PP YLLRH FN+ +F PGS +PLW L VID++L++FHG DVLFDIF+AANFHKLFL
Sbjct: 119 HWGVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFL 178

Query: 170 ETLNSMDDEHITDLEYIYRYDATKSNRS-ISFPRTIYENPKLRIPGKTIDLVNLQTQSFF 228
           + LN++    +T  E    +D    + S ++FP++IY++ KL +P  T  + + QTQSFF
Sbjct: 179 KELNNISS--VTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236

Query: 229 KSFYVNAIKKPLDIITFNSEPMKYIKPNEI----DFMNEASALCGTTVFGHITTDRFEYL 284
           KS + N +K+P   +T  +         ++    D +N  S+LCGTTVFG ++  RF YL
Sbjct: 237 KSIFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYL 296

Query: 285 NSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTIL 344
            SI   E++C+RSFICGIA++CLK ++KDF+G+I FSIP++LR+ +      GLF+K + 
Sbjct: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELR 356

Query: 345 VECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERM 404
           + CPLSLIDD++  N  +      +N    E D  F+EK +EYQF  ++  VS+ +  ++
Sbjct: 357 IACPLSLIDDELSVNEFL------ANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKL 410

Query: 405 RAWRRNGFNDDDIKKMKFTSDD----KASNTKIIQINDVSEFXXXXXXXXXX-XXXELNF 459
           ++W +NGFNDDDI++MK+ +DD    + S TK++QINDVS+                  F
Sbjct: 411 KSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGF 470

Query: 460 THSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
           T SI+    +SLSYTYC+E G NICIHYPD+Y++E FVE F+SF+
Sbjct: 471 TSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFI 515

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  441 bits (1133), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 246/526 (46%), Positives = 345/526 (65%), Gaps = 31/526 (5%)

Query: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNA-----QDGLTDDATLLTNSEPLLL 55
           MT+FR L ++EKKL+ Q+L  Q NG IFS+ Y  ++      D  +D+ TL TNS     
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKD-- 58

Query: 56  DSRL-----VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNC 110
           DSRL        L+K++   P L  TVNE  E+  +K++KTSDI+  ++F++ KD+ VNC
Sbjct: 59  DSRLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNC 118

Query: 111 HLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFL 169
           H G PP YLLRH FN+ +F PGS KPLW L VID++L++FHG DVLFDIF+AANFHKLFL
Sbjct: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFL 178

Query: 170 ETLNSMDDEHITDLEYIYRYDATKSN-RSISFPRTIYENPKLRIPGKTIDLVNLQTQSFF 228
           + LNS+     +D   ++  D    N   +SFP++IY++ KLR+P  T  +++ QTQSFF
Sbjct: 179 KELNSITSVSRSDDRVLF--DINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFF 236

Query: 229 KSFYVNAIKKPLDIIT----FNS-EPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEY 283
           KS + N +K+P   +T    F+S  P   +K    D +N  S+LCGTTVFG +   RF Y
Sbjct: 237 KSIFYNTLKRPFGYLTNQTSFSSPAPTSQLKRYN-DILNTNSSLCGTTVFGIVNNQRFSY 295

Query: 284 LNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTI 343
           L SI   E++C+RSFICGIA++CLK ++KDF+G+I FSIP++LR+ +      GLF+K +
Sbjct: 296 LKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKEL 355

Query: 344 LVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKER 403
            +ECPLSLIDD++  +IN +    NSN      +  F EK +EYQF +++  VS  +  +
Sbjct: 356 RIECPLSLIDDEL--SINEF--LVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTK 411

Query: 404 MRAWRRNGFNDDDIKKMKFTSDD----KASNTKIIQINDVSEFXXXXXXXXXX-XXXELN 458
           +++W RNGFNDDDI++MK+ +DD    + S TK+IQINDVS+                  
Sbjct: 412 LKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSG 471

Query: 459 FTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
           FT+SI+    MSLSYTYC++ G NICIHYPD+Y++E FVE F+SF+
Sbjct: 472 FTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFI 517

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  440 bits (1132), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 234/550 (42%), Positives = 336/550 (61%), Gaps = 64/550 (11%)

Query: 5   RQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRL----- 59
           R L +YE+KL+ + L    NG +F A YI +  D +T D  +  +    L  +R+     
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFD--DSVTADEHIWDDDNDTLAATRVESRST 60

Query: 60  ------------VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEF 107
                         AL+ ++ K+PE+ TTVN+ LEF  +KEI+T D+I+ V FD+ KDE 
Sbjct: 61  KKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEK 120

Query: 108 VNCHLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHK 166
           VNCH G PP YL+RHI   + F PGS KPLW L +ID+S ++FH QD+LFDIF+AANFHK
Sbjct: 121 VNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHK 180

Query: 167 LFLETLNSM---DDEHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQ 223
           LFL+ L ++      +   LEY+++   +  N + S P++IY+N KL +P    +L+NLQ
Sbjct: 181 LFLKELIAVCRPQQSYEKPLEYLFKLQKSFEN-NYSVPKSIYDNLKLHLPATRPELLNLQ 239

Query: 224 TQSFFKSFYVNAIKKPLD---------------------IITFNSEPMKYIKPNEIDFMN 262
           TQSFFKS + NA+KKPLD                     +I+     +K  +    + + 
Sbjct: 240 TQSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILT 299

Query: 263 EASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSI 322
            A++ CG T+FG ++ +RF YLNS+ ++E +C+RSFI  I +LCLK M+K F G++ FS+
Sbjct: 300 SATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSM 359

Query: 323 PVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNNINVYNGYDNSNVKVP---ETDPT 379
           P+NLR+S+    DFGL YK I VECPLS+IDD+                 VP   E+DP 
Sbjct: 360 PMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDK--------------QCSVPGLNESDPE 405

Query: 380 FEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKKMKFTSDDK--ASNTKIIQIN 437
           + EK LE QF+QI+  V+ ++++RM  W++ G+ND+D+K+MKFT  D+  A NT++I+IN
Sbjct: 406 YNEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKIN 465

Query: 438 DVSEFXXXXXXXXXXXXXELNFTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFV 497
           DVSE                 FT S+S +  MSLSYT+C+E G NICIHYPD Y+ME FV
Sbjct: 466 DVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFV 525

Query: 498 ERFQSFVADQ 507
           + F+SF+ +Q
Sbjct: 526 DCFESFMEEQ 535

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  427 bits (1097), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 229/517 (44%), Positives = 329/517 (63%), Gaps = 30/517 (5%)

Query: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQ-DGLTDD-ATLLTNSE--PLLLDSRL 59
           FR LG YEKK++ Q + G+ NG++FS++   N + D   DD ATL T      + L S L
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVL 62

Query: 60  VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLL 119
             ALQ ++  H EL TT+N++L F  V +I+T+D+I ++ +D  KD+ +         LL
Sbjct: 63  CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLL 121

Query: 120 RHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSM--DD 177
           RHIFN+  F P +GKPLW+  + +DS ++FHG DVLFDIF+ ANF K  L+ +N +   +
Sbjct: 122 RHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSN 181

Query: 178 EHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIK 237
           + +  ++ ++++DA +S    ++PR+IYENPKL +P  T DL+NLQTQSFFK+ Y N +K
Sbjct: 182 QKLKTVKTLFKFDAERS--LTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLK 239

Query: 238 KPLDIITF----NSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENV 293
           KP+D+IT     N+  +   +    D ++ A++LCG TV G I+ +R+++L  +   EN+
Sbjct: 240 KPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENI 299

Query: 294 CIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLID 353
            +RSFI  I ++CLK ++K+F GSI FSIPVNLR  I   SDFGLFYK I VECPL LI+
Sbjct: 300 SLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLELIN 359

Query: 354 DQ-VYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGF 412
           D+  Y N  V +   N+++             LE QF++IS  VS  + +RM+AW + GF
Sbjct: 360 DEKYYTNPEVLHSMQNNSL-------------LEIQFERISRHVSDVISQRMKAWEKFGF 406

Query: 413 NDDDIKKMKFTSDDKASNTKIIQINDVSEFX---XXXXXXXXXXXXELNFTHSISNSDFM 469
           NDDDIK+MKF++D+K     IIQINDV+E                  LNFT S+S ++FM
Sbjct: 407 NDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFM 466

Query: 470 SLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506
           SL Y++  + G NICIHYPD Y+ME FVE FQSF+ +
Sbjct: 467 SLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  409 bits (1051), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/519 (42%), Positives = 329/519 (63%), Gaps = 30/519 (5%)

Query: 3   SFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLT--NSEPLLLDSRLV 60
           + R L +YE+K++ + +  + NG+IF+A Y +++++   DD TLLT  +S P +  + L 
Sbjct: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSASSEEW-GDDTTLLTLKDSRPTI--AILT 58

Query: 61  NALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLR 120
            A+Q+++ +H EL TT+NE  EFE +K IK  DI+  ++FDS KDE +NCH G PPYLLR
Sbjct: 59  KAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLR 118

Query: 121 HIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHI 180
           HIF+ N+F PGS KPLW L +ID+SLV+FHGQD+LFDIF+AANFHKL L+  N + +E +
Sbjct: 119 HIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPL 178

Query: 181 --TDLEYIYRYD-ATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIK 237
             ++ + I+  + + K   ++   ++IY+NP++ +P  + DL NLQTQSFFKS + + +K
Sbjct: 179 DSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVK 238

Query: 238 KPLDIITFNSEPMKYIKPNEI----------DFMNEASALCGTTVFGHITTDRFEYLNSI 287
           KP+  +  N    +    N +          D  +  + L  TTVFG IT  R+EYLNS+
Sbjct: 239 KPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSL 298

Query: 288 ARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESI-EGPSDFGLFYKTILVE 346
             ++ +C +SF+ GI +LCLK  I++F GS+ FSI +NLR  + E   +FGLFYK +L++
Sbjct: 299 ITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLID 358

Query: 347 CPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRA 406
            PLSLIDD    N  + +GY +      + DP   EK LE+QFK+++ LV   ++ R+  
Sbjct: 359 VPLSLIDD----NAVMLSGYRD----FSDNDPDLTEKILEFQFKRVTSLVKDLIERRISK 410

Query: 407 WRRNGFNDDDIKKMKFTSDDKASNTKIIQINDVSEFXXXXXXXXXXXXXE-LNFTHSISN 465
           +   GFNDDDI++MK+     A +TKII++ D SE                 NFT S+  
Sbjct: 411 FSTMGFNDDDIRQMKYGK--PAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKSLRK 468

Query: 466 SDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
           +DF S+SYT C  +G N+C+ +PD  DME FVE FQSF+
Sbjct: 469 NDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFI 507

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  333 bits (855), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/519 (38%), Positives = 297/519 (57%), Gaps = 28/519 (5%)

Query: 5   RQLGTYEKKLVGQALAGQSNGIIFSAKYISN---AQDGLTDDATLLTNSEPLLLDSRLVN 61
           RQL  YE KL+ Q L G+ NG+ F+AKY  N   +    +D++TL++  +  L  S +  
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSVITR 63

Query: 62  ALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRH 121
            LQ ++ KH EL T ++E   +  V EI+  D+I  + FDS KDE +NCHLG PPYLLRH
Sbjct: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123

Query: 122 IFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNS-----MD 176
           IFN++ F  G  KPLW+L +ID++ ++FHG D+LFD F+AA FHK FL  +NS     + 
Sbjct: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183

Query: 177 DEHITDLEYIYRYDATKSNRSI--SFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVN 234
            +    L+Y+++  ++     I    PR+IY+         T  + N QT+SFFKS Y+N
Sbjct: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSLYLN 243

Query: 235 AIKKPLDIITFNSEPMK---YIKPNE----IDFMNEASALCGTTVFGHITTDRFEYLNSI 287
           A+KKP++ IT  S  +K    IK  E    ++ M    +LCG T+FG I++ RF  L   
Sbjct: 244 AVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELTEK 303

Query: 288 ARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVEC 347
           A  E + ++S ICG+ ++ LK  + DF+ ++ FSI VNLR+ +     FGL+Y+ I++EC
Sbjct: 304 ATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIIIEC 363

Query: 348 PLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAW 407
           PLSLIDD+       ++GY + +V +   +    EK  E QFK ++  +   M E++  W
Sbjct: 364 PLSLIDDRAIQ----FSGYRD-HVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYW 418

Query: 408 RRNGFNDDDIKKMKFTSDDKASNTKIIQINDVSEFXXXXXXXXX--XXXXELNFTHSISN 465
           +     D+DIK MK   D   S  +IIQIND++E                  +   S+S 
Sbjct: 419 K----TDNDIKMMKMMDDMHQSKDEIIQINDLTEIDINENLSQNDPYCVKSSSMVTSLSK 474

Query: 466 SDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
            +  S+SYT+C+ +G  I IH P    ME FVE FQ+F+
Sbjct: 475 KEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFL 513

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  327 bits (838), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/527 (36%), Positives = 303/527 (57%), Gaps = 53/527 (10%)

Query: 4   FRQLGTYEKKLVGQALAGQS-NGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLVNA 62
            R L + EK+ +G +L  ++ +G + S K++SN+ D ++DDATLL++ +  L  S +  A
Sbjct: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLD-ISDDATLLSSKDKPLTISLVSRA 70

Query: 63  LQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRHI 122
           L+ ++  H E+ TT+N+  EF+ + +I TSD++ S+ F++ KDE VNCH GAPPYL+ +I
Sbjct: 71  LKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINYI 130

Query: 123 FNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSM--DDEHI 180
           F+   F P S KPLW+L +++ SLV+F+G D LFDIFA ANF KL  E +NS+  +++ I
Sbjct: 131 FSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENKEI 190

Query: 181 TDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL 240
            D + I++    ++   I+FP++IY+NP L +P    +L NLQTQSFFKS Y+N  KK  
Sbjct: 191 QD-DIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKKSF 249

Query: 241 DIITFNSE-PMKYIKPNEI-----DFMNEASALCGTTVFGHITTDRFEYLNSIARHENVC 294
           D + F  + P+   + + I     + ++  S +    V G+++ +R+  L  +   E + 
Sbjct: 250 DYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLIDAEKID 309

Query: 295 IRSFICGIALLCLKSMIKDFTGSITFSIPVNLRE-----------SIEGPSD----FGLF 339
           ++SF C I ++CLK MI  F GSI F IP NLR            S  GP D     G+ 
Sbjct: 310 LKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANELGII 369

Query: 340 YKTILVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTT 399
           YK I VE PL LI+                  K+   D       +E QFK + + ++ +
Sbjct: 370 YKDIYVEVPLKLIE------------------KIGNEDV------VEEQFKIVCNYINES 405

Query: 400 MKERMRAWRRNGFNDDDIKKMKFTSDDKASNTKIIQINDVSEFXXXXXXXXXXXXXELNF 459
           +++R++AW +NGFNDDDIK+MKF  +   +   II++ND++               +L+ 
Sbjct: 406 IQKRIKAWEKNGFNDDDIKRMKFGYEQVGN---IIEVNDLTSLDLSCSKDSLFHIEDLSL 462

Query: 460 THSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506
           T ++  +  +SLS+      G N+CI+Y   Y M+ F++ FQSF+ +
Sbjct: 463 TRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  300 bits (768), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 182/515 (35%), Positives = 274/515 (53%), Gaps = 26/515 (5%)

Query: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISN-AQDGLTDDATLLTNSEPLLLDSRLVNA 62
           +R L   EK ++ +   G  NG++FSA Y  N     L+D+ TL ++    L DS +  A
Sbjct: 8   YRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMIWKA 67

Query: 63  LQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRHI 122
           L K++ +H ELR  V+  LEFE V +I   D++  ++FD   DE VNC+ G PPYLLRHI
Sbjct: 68  LLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHI 127

Query: 123 FNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHITD 182
           F++  FT G  +PLW+L VID ++V+FHG DVLFD FAAANFHKLFL+ LNS+  E  T 
Sbjct: 128 FDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL-SESCTS 186

Query: 183 LEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPLDI 242
              +++          + PR +++  + +      D    Q+Q+  +S Y  AIKKPL  
Sbjct: 187 PRPVFKGGKILP----TLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPLRF 242

Query: 243 ITF----NSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSF 298
           I      +S       P  +++ N    LCGT VFG I+T RF+ L  I     + +++F
Sbjct: 243 IESGRIEHSTEQHSGTPEPLNYPNH---LCGTVVFGTISTPRFKILKGILNDHKISMKTF 299

Query: 299 ICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYN 358
           I    L CL+ ++      ITFS+P+NLR+ I   S  G++++ +L+ECPL         
Sbjct: 300 IISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAG----R 355

Query: 359 NINVYNGYDNSNVKVPE-------TDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNG 411
           N N   G   SN ++ E            ++   E  F++    VS  +K+ ++      
Sbjct: 356 NSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGK 415

Query: 412 FNDDDIKKMKFTSD--DKASNTKIIQINDVSEFXXXXXXXXXXXXXELNFTHSISNSDFM 469
           F D D+ KM+  +     AS +KII+IND+SE              ++  T S  N+ FM
Sbjct: 416 FKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFM 475

Query: 470 SLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
           S+SY++    G N+ IHY +  +M  FVE F++F+
Sbjct: 476 SISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFL 510

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  285 bits (729), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 173/516 (33%), Positives = 273/516 (52%), Gaps = 27/516 (5%)

Query: 2   TSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNA--QDGLTDDATLLTNSEPLLLDSRL 59
           +S R L + EK    +    + NGI+F+  Y SN    +  +DD TL    +  L D ++
Sbjct: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQI 65

Query: 60  VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLL 119
            NAL+ M+ ++ EL  T+ +  +F   + I+  D++  ++F + KDE + C  G PPY+L
Sbjct: 66  SNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYIL 125

Query: 120 RHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSM-DDE 178
           R+I   NKF    G+PLWEL ++D ++V+ H  +V+FD+FAAANFH  F + L+    D 
Sbjct: 126 RNILENNKFE--FGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDT 183

Query: 179 HITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKK 238
           H  D+ ++Y          +   +T ++    +I    +  + LQ  S  K  Y   +KK
Sbjct: 184 HALDILFVYE------GNELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTVKK 236

Query: 239 PLDIITFNSEPMKYI------KPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHEN 292
            L++I  N      I      K +    M   + LCGTTV G +  +R   L  +   EN
Sbjct: 237 SLNVIRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSEN 296

Query: 293 VCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLI 352
           VC+ S +C I LL LK +I+ F GSITF +P+++RE +E   D G+ Y  ++VECPLS I
Sbjct: 297 VCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLE-IFDLGVSYTNLMVECPLSFI 355

Query: 353 DDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGF 412
           +D+ + +  V +G   S  K+    P + E  LEYQFKQ++  V  ++KE+ +AW++  F
Sbjct: 356 NDKDFQH-TVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRF 414

Query: 413 NDDDIKKMKFTSDDKASNTKIIQIN--DVSEFXXXXXXXXXXXXXELNFTHSISNSDFMS 470
           +   +K  K    +K    K I+IN  D+ E               +NFT S+ +   +S
Sbjct: 415 DMSSLKGKKLRRSNKIIRGKFIEINLVDMGE-----AQDGQFHTKNVNFTSSLGSKCLIS 469

Query: 471 LSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506
           +S    +  G NI +HYP++ DM+ FVE FQ  + D
Sbjct: 470 VSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  271 bits (693), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 174/518 (33%), Positives = 273/518 (52%), Gaps = 31/518 (5%)

Query: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQ--DGLTDDATLLTNSEPLLLDSRLVN 61
           +R L   EK ++ +  AG  NG++FS+ Y       D  +   + +   + L  D+ +  
Sbjct: 8   YRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLP-DAIMWQ 66

Query: 62  ALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRH 121
           AL +++ ++ ELR+++N+ ++FE +  I   D++  ++FD+L DE V+C+ G PPYLLRH
Sbjct: 67  ALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRH 126

Query: 122 IFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDD--EH 179
           IF++  F+ G  KPLW++ VID S+V+FHG DVLFD FAAA FHKLFLE LNS  +    
Sbjct: 127 IFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKGQ 186

Query: 180 ITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKP 239
            +DL +  R D       I   +++     + +     D V   +Q+  K+ Y  AIKKP
Sbjct: 187 KSDLIFKTREDL------IPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240

Query: 240 LDII-TFNSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSF 298
           L  I +   E       N  D  + A  LCGT VFG++  +R   L ++     +  RSF
Sbjct: 241 LRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF 300

Query: 299 ICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLI--DDQV 356
           I  + + CL  +++     I FS+P+NLRESI   SD G+F   +L ECPL LI  D + 
Sbjct: 301 IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP 360

Query: 357 YNNINVYNG--------YDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMK-ERMRAW 407
            + I+ +N          D   V   + DP       +  F++I   V+T ++   MR  
Sbjct: 361 CSGISTFNQEFLEGSTLTDVGGVNEDQNDP-------QTVFRRILTHVTTELELAAMRLE 413

Query: 408 RRNGFNDDDIKKMKFTSDDKASN-TKIIQINDVSEFXXXXXXXXXXXXXELNFTHSISNS 466
           + +   +D IK  +      AS+ +KI++IND+ E              ++  T S  + 
Sbjct: 414 KSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSD 473

Query: 467 DFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
            FMS+SY   + +G N+ IHY + ++ME FVE F+ F+
Sbjct: 474 TFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFL 511

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  241 bits (614), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 155/477 (32%), Positives = 249/477 (52%), Gaps = 36/477 (7%)

Query: 37  QDGLTDDATLLTNSEPLLLDSRLVNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIIT 96
           Q+  +D +TL+++    L + ++ +AL+ M+ ++ E+  TV +  +F  V  I+  D++ 
Sbjct: 25  QETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVR 84

Query: 97  SVKFDSLKDEFVNCHLGAPPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLF 156
            ++F + KDE + CH G PPY+ RHI N++KF   +GKPLWE+ + D S+V+FH  +VLF
Sbjct: 85  VIEFQTYKDEAIACHDGIPPYVARHILNKSKFE--AGKPLWEVYIADGSMVIFHCHNVLF 142

Query: 157 DIFAAANFHKLFLETLNSMDDEHITDLEYIYRYDATKSNRSISFPRTIYENP-KLRIPGK 215
           D+FAA NFH  F + L   +     + E ++ Y+          P  +  +P    +PG 
Sbjct: 143 DLFAAGNFHVRFQQALQRCEKNEPHN-ETLFVYEGG--------PLQLPIDPDACSLPG- 192

Query: 216 TIDLVNLQTQSFFKSFYVNAIK---KPLDIITFNSEPMKYIKPNEID-----FMNEASAL 267
            +D V     S F SF  N  +   KP   +     P   +  + +         +  +L
Sbjct: 193 -VD-VPYPASSPFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESL 250

Query: 268 CGTTVFGHITTDRFEYLNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLR 327
            GTTV G++ + + + L  +   E VC+RSF+C I LL LK +I++F GSI FSIP++LR
Sbjct: 251 YGTTVSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLR 310

Query: 328 ESIEGPSDFGLFYKTILVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEY 387
                 + FG   K ILV+CPL+LIDD+V+ ++           K+ +  P F E  LEY
Sbjct: 311 TESHKTTPFGFQSKRILVDCPLALIDDRVFESL-FNRPSKQRKTKLDKNSPKFSEGLLEY 369

Query: 388 QFKQISDLVSTTMKERMRAWRRNGFNDDDIKKMKFTSDDKASNTKIIQINDVSEFXXXXX 447
           QFK+++  V  ++  +         + D   K K+ S  +    KII+IN V        
Sbjct: 370 QFKRVTTHVMKSLTAQT--------SGDWTGKRKY-SKCQLRKKKIIEINVVD---MGTS 417

Query: 448 XXXXXXXXELNFTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504
                    +NFT S+ +  FMSLS    +  G N+C+HY +   M+ FV+ FQ+F+
Sbjct: 418 PSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFL 474

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  127 bits (320), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 134/243 (55%), Gaps = 29/243 (11%)

Query: 272 VFGHITTDRFEYLNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIE 331
           +FG I  +RF  L ++ R   +C+RS ICGI +LC K  I++F G+I FSI V+++  ++
Sbjct: 25  LFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPIVD 84

Query: 332 GPSDFGLFYKTILVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQ 391
             S FG+  K I+V+CPL LIDD+ Y +       D+ ++K  +         LE QF++
Sbjct: 85  DSSQFGILKKNIIVDCPLKLIDDKHYKDT------DSESIKNGDI--------LEIQFRK 130

Query: 392 ISDLVSTTMKERMRA----WRRNG--FNDDDIKKMKFTSDDKASNTKIIQINDVSE--FX 443
           ++D V+  +  ++++    ++RN   FN   I       + + S++K+IQIND+++  F 
Sbjct: 131 VTDFVTEELSNKLQSMAKHFKRNNCPFNFSSI-------NSQISDSKVIQINDLTDIPFT 183

Query: 444 XXXXXXXXXXXXELNFTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSF 503
                       +L  T  +S ++ MSLSY     +  +I IHY +   M+ FVE F++F
Sbjct: 184 TTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFRTF 243

Query: 504 VAD 506
           + +
Sbjct: 244 IEN 246

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 76.6 bits (187), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 72/136 (52%)

Query: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLVNAL 63
            R L   EK  + Q   G  NGIIFS K     +D L+DDATL T  E   L   L+ +L
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNLQLLLLKSL 61

Query: 64  QKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRHIF 123
           + ++ K+ EL TTV+E L F  + E+KT+D++  + +   K +      G    L+  I+
Sbjct: 62  KLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSIY 121

Query: 124 NRNKFTPGSGKPLWEL 139
             + F PGSGKP  +L
Sbjct: 122 YHSNFQPGSGKPYGKL 137

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 120/305 (39%), Gaps = 47/305 (15%)

Query: 57  SRLVNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSV----KFDSLKDEFVNCHL 112
           S +  A++  V + P L + V  K E   ++ I    ++  V     +  L ++  N   
Sbjct: 36  SEICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYTDYGLLDEDICN--- 92

Query: 113 GAPPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQD-VLFDIFAAANFHKLFLET 171
                    IF   +FT GSGKPLW++ V++D   +    D V+ D  +   F K FL +
Sbjct: 93  --------KIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGS 144

Query: 172 LNSMDDEHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSF 231
           LN+     +   E ++      S         + ++P  RIP   +       ++  +  
Sbjct: 145 LNATASTSLVS-EVVFEPSVHNS--------VVPQHPYDRIP---VTFFETMARALVQVL 192

Query: 232 YVNAIKKPLDIITFNSEPM--KYIKPNEIDFMNEASALCGTTVFGH------ITTDRFEY 283
              A  K   I T    P+  +Y+K     F  +  A  G+    +      I   + + 
Sbjct: 193 VFLAFLKIDLITTLFVPPLQKQYLKFKNYQFTRDYLAADGSVRNDNRLLKIVIPPQKLQN 252

Query: 284 LNSIARHENVCIRSFICGIALLCLKSM-IKDFTGS-ITFSIPVNLRESIEGPSDFGLFYK 341
           L ++ +  NV + S I  I    LK +    F G+    SIP+N R  IE         K
Sbjct: 253 LLALCKGHNVSLSSLILAIMANSLKHVDSSQFDGTRAKISIPMNTRPFIE---------K 303

Query: 342 TILVE 346
           T+L E
Sbjct: 304 TLLAE 308

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 126/299 (42%), Gaps = 27/299 (9%)

Query: 57  SRLVNALQKMVLKHPELRTTV---NEKLEFEEVKE-IKTSDIITSVKFDSLKDEFVNCHL 112
           S  + AL+++V  H +L       N ++    + E IK  D++  + +D+  +E +N   
Sbjct: 37  SDFICALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS-- 94

Query: 113 GAPPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQD-VLFDIFAAANFHKLFLET 171
                    +F +  F  G  KPLW++ V+  +  M    D + FD  A   F    L++
Sbjct: 95  ---------VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKS 145

Query: 172 LNSMDDEHITDL-EYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKS 230
           L  +  ++  D+ E IYR   +  +     P   YE  KL IP  +  +     ++ F  
Sbjct: 146 LEELKQDNDLDVDEIIYRPGGSTDSIDQCHP---YE--KLPIPF-SWKVKRPIVKALFTI 199

Query: 231 FYVNAIKKPLDIITFNSE--PMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIA 288
                + +   II F+    P  Y+K N  D            +   +++++ + +    
Sbjct: 200 APGAVVSQDASIIQFDEYKIPEDYLKKNSNDDGCYQIKNTNRQISLKMSSNKLKVIMKDC 259

Query: 289 RHENVCIRSFICGIALLCLKSMIKD-FTGS-ITFSIPVNLRESIEGPSDFGLFYKTILV 345
           +  +V   +++  +  L L  + K+ ++GS I + +P+N R  I    ++   Y T + 
Sbjct: 260 KQHHVSFTAYLTAVLYLALGKIPKEKYSGSTIKYEVPMNTRNRISNSGEYSNSYGTFVA 318

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 65/129 (50%), Gaps = 20/129 (15%)

Query: 57  SRLVNALQKMVLKHPELRTTV------NEKLEFEEV--KEIKTSDIITSVKFDSLKDEFV 108
           +++++AL+K V K+ +LR  V       + + F ++  ++I  +DI+    +DS+ +  +
Sbjct: 38  TQIIHALRKSVAKYQQLRCNVMKAGDSEDDIYFNDIGNEKIYFADIVEYKNWDSVSESNI 97

Query: 109 NCHLGAPPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQD-VLFDIFAAANFHKL 167
           N            IF    F   + KP+W++ V+++   +    D VLFD  +  NF   
Sbjct: 98  NS-----------IFQEYSFEYFTDKPVWKILVLENQNQLLMLLDHVLFDGMSGINFWNS 146

Query: 168 FLETLNSMD 176
           F+ +L S+D
Sbjct: 147 FISSLPSID 155

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 16/123 (13%)

Query: 57  SRLVNALQKMVLKHPELRTTV---NEKLEFEEVKE-IKTSDIITSVKFDSLKDEFVNCHL 112
           S +V A++ +V ++P+L + V   N  L  E ++  +  SD++   + +SL +E  N   
Sbjct: 36  SEIVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN--- 92

Query: 113 GAPPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQD-VLFDIFAAANFHKLFLET 171
                    IF    F  G+ KPLW++ ++ D        D ++ D  +A  F   F+ +
Sbjct: 93  --------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRS 144

Query: 172 LNS 174
           LN+
Sbjct: 145 LNA 147

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 17/123 (13%)

Query: 58  RLVNALQKMVLKHPELRTTVNEKLE-----FEEVKEIKTSDIITSVKFDSLKDEFVNCHL 112
           ++ +AL+  +  HP+L   V    E      + V  IK  D++  V +D   D  + CH 
Sbjct: 40  QIAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVEYVSWDGFDDNTI-CH- 97

Query: 113 GAPPYLLRHIFNRNKFTPGSGKPLWELCV-IDDSLVMFHGQDVLFDIFAAANFHKLFLET 171
                    IF    F     KPLW++ V   ++ ++      LFD  +A  F K F+ +
Sbjct: 98  ---------IFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHALFDGMSAVIFWKSFMSS 148

Query: 172 LNS 174
           L+S
Sbjct: 149 LSS 151

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 116/308 (37%), Gaps = 42/308 (13%)

Query: 57  SRLVNALQKMVLKHPELRTTV-----NEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCH 111
           S L   L++++ KHP L   +     ++KL      EI+  D++    FDSL +   N  
Sbjct: 36  SSLCCVLKELIPKHPHLYRNIFTKDGSKKLVRPLNVEIRLDDVLEETGFDSLDESAANS- 94

Query: 112 LGAPPYLLRHIFNRNKFTPGSGKPLWELCVID-DSLVMFHGQDVLFDIFAAANFHKLFLE 170
                     I   + F     +PLW+L  +   +  +F      FD  +A  F   F+ 
Sbjct: 95  ----------ILKNSTFQYDQQRPLWKLISLKAGTQFLFCFDHAFFDGMSAVIFWNDFIS 144

Query: 171 TLNSMDDEHITDL---EYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLV--NLQTQ 225
            LNS+  E+   +   E +Y+  A    R    P  ++  P +    + +  +      Q
Sbjct: 145 ALNSIKPENRRGMDLNEVLYKAAADPEIR--VHPFDLWPIPWVWSMKRAVTKIWTYYAGQ 202

Query: 226 SFFKSFYVNAIKKPLDIITFNSEPMKYIKPNEIDFMNEASALCGTTV--FGHITTDRFEY 283
           S  +   +  I    ++  F      YI P+   F N    L    V     I  D+ + 
Sbjct: 203 SIPQCISLKGIISKREVFRFK----HYIFPS--GFFNSEGVLRNDNVQLSSRIPPDKMDA 256

Query: 284 LNSIARHENVCIRSFICGIALLCLKSM-IKDFTGSIT-FSIPVNLRESIEG-----PSD- 335
           +    R   V   S+     +  L+ +   + TGSI    +PV+ R  I       P+D 
Sbjct: 257 ILVECRKHKVSFTSWFAAKLIQLLRELDPNESTGSIVKIMLPVDCRAEIAEKLPSYPADE 316

Query: 336 --FGLFYK 341
              GLF K
Sbjct: 317 LKMGLFVK 324

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 9/119 (7%)

Query: 57  SRLVNALQKMVLKHPELRTTVNEKLEFEEVK-EIKTSDIITSVKFDSLKDEFVNC-HLGA 114
           S+L+ AL+  V++H  L   V     ++E+K E    +I+  +KF  L +   +   LG 
Sbjct: 37  SQLIAALKYTVIQHERLTCNV----FYDELKKENFLQNILEPLKFCDLVEYRHDWDQLGE 92

Query: 115 PPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQD-VLFDIFAAANFHKLFLETL 172
               + HIF R  F+    KPLW++ ++ +   M    D VL D  +A +  + F+E L
Sbjct: 93  TE--INHIFQRYNFSYNENKPLWKILILPNQNQMLLLTDHVLMDGMSAIHVWETFMEGL 149

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 60/140 (42%), Gaps = 19/140 (13%)

Query: 56  DSRLVNALQKMVLKHPELRTTVNEKLE-------FEEVKEIKTSDIITSVKFDSLKDEFV 108
           ++ L ++L+K++ K+  LR  +N+  +        E   E    D+I    ++  +++  
Sbjct: 37  ENELCSSLRKVIAKNRILRCNINKNGDSAYINDIIENDNEFTVQDVIEYRDWNKFEEDEQ 96

Query: 109 NCHLGAPPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQD-VLFDIFAAANFHKL 167
           N            +F    F  G  KPLW+L +      +    D   FD  +A  F K 
Sbjct: 97  N-----------SVFQEINFKYGELKPLWKLIIASKINTIVLAMDHTFFDGSSATLFWKA 145

Query: 168 FLETLNSMDDEHITDLEYIY 187
            L  L+S+D + + D + ++
Sbjct: 146 LLLELSSIDRDQLEDTDVVF 165

>ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR197W
           (SIK1)
          Length = 549

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 11/112 (9%)

Query: 167 LFLETLNSMDDEHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQS 226
           LF+    S++DE + DL  I   DA  + R IS  R           G+ +  V+++  S
Sbjct: 220 LFIRDKASLNDESLHDLSAILGEDAGIAERVISNARISM--------GQDLSEVDMENVS 271

Query: 227 FFKSFYVNAIKKPLDIITFNSEPMKYIKPNEIDFMNEASALCGTTVFGHITT 278
            F    VN ++    +  +  E M  + PN  + + E   + G  +  H  +
Sbjct: 272 VFAERVVNLVEYRRQLYEYLCEKMHTVAPNLSELIGE---VIGARLISHAGS 320

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 8/99 (8%)

Query: 119 LRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQD-VLFDIFAAANFHKLFLETLNSMDD 177
           + HIF  + F     KPLW++ +I     M    D VL D  +A +  + F+E L     
Sbjct: 103 INHIFQEHNFPYSEHKPLWKILIIPSQNQMLLMTDHVLMDGMSAVHVWETFMEGLQKQGP 162

Query: 178 EHITDLEYIYR-YDATKSNRSISFPRTIYENPKLRIPGK 215
             +   E IY     + +++ IS P   YEN    IP K
Sbjct: 163 VGVD--ETIYSPLSGSSADQIISIPP--YEN--WPIPWK 195

>Ecym_1364 Chr1 (747171..748484) [1314 bp, 437 aa] {ON} similar to
           Ashbya gossypii AEL060C
          Length = 437

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 60/150 (40%), Gaps = 10/150 (6%)

Query: 83  FEEVKEIKTSDIITSV-KFDSLKDEFVNCHLGAPPYLLRHIFNRNKFTPGSGKPLWELCV 141
           FE +K    S I+ SV ++  LK      H+  P    +   N N+      +P+    V
Sbjct: 241 FEFLKGQACSGIVASVNRYRELKYSTAYSHILNP---YKEESNENQ------EPVSTSFV 291

Query: 142 IDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHITDLEYIYRYDATKSNRSISFP 201
               L  F           AA F +L    +  +   HIT LE I  Y     N+S S+P
Sbjct: 292 SKRELEWFQRSFTFVGGVTAAFFLQLIQYPMLKLQKVHITRLEAIDIYQKAVENKSNSYP 351

Query: 202 RTIYENPKLRIPGKTIDLVNLQTQSFFKSF 231
               +  KL++  +   L++L   S+  +F
Sbjct: 352 VKSLQAAKLKVRPRDTGLIHLYYNSYLDTF 381

>Suva_7.506 Chr7 (873531..874931) [1401 bp, 466 aa] {ON} YGR212W
           (REAL)
          Length = 466

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 120/291 (41%), Gaps = 45/291 (15%)

Query: 58  RLVNALQKMVLKHPELRTTV-----NEKLEFEEVKEIKTSDIITSVK--FDSLKDEFVNC 110
           +L++AL+  V+KH  L   V     + ++ F+ + E    D I      +D LK   +N 
Sbjct: 38  QLISALKYAVIKHERLSCNVFYEESDNEVYFKSITEPFLFDDIVEYHRDWDQLKQNEIN- 96

Query: 111 HLGAPPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQD-VLFDIFAAANFHKLFL 169
                     +IF    F      PLW++ +I     M    D VL D  +A +  +  +
Sbjct: 97  ----------YIFQTYDFAYNEATPLWKILIIPSQNEMLLVADHVLMDGMSAVHVWETLM 146

Query: 170 ETLNSMDDEHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFK 229
           + L    +  I D E IY    + S  +IS   + +EN    +P     +  L +  F+ 
Sbjct: 147 KGLQK--EAPIEDDEAIYSPLFSSSTDTIS--ASPFEN--WPVPWTWRIIRQLASSLFYW 200

Query: 230 SFYVNAIKKPLDIITFNSEPMKYIKPNEIDFMNEASALCGTTVFG-HITTDRFEY----- 283
           S        P  I+T N + +++   +  +   E      T+ +    T  ++E+     
Sbjct: 201 S--------PKTIVTNNKDLIQFANYSFPENFLEYEPTGDTSSYKVRNTNHQWEFRLLPA 252

Query: 284 -LNSI---ARHENVCIRSFICGIALLCLKSMIKD-FTGS-ITFSIPVNLRE 328
            L S+    +  NV + SF+  +  L  K  +K+ + G+ +   +P+N R+
Sbjct: 253 HLKSVLSECKAHNVSLTSFLGALVCLSFKRTLKEVYNGTYLKMELPMNTRK 303

>TBLA0D02320 Chr4 (588496..590994) [2499 bp, 832 aa] {ON} Anc_8.4
           YFL047W
          Length = 832

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 326 LRESIEGPSDFGLFYKTILVECPLSLIDDQVYNNINV-YNGYDNSNVKVPETDPTFEEKK 384
           LRES   P+      K  L+E P  LI + +Y+ + V YN Y       P  + + E K 
Sbjct: 602 LRESHSEPTTIASVLKIYLLELPEPLITNNIYDVLKVLYNDY------PPTRETSTEGKS 655

Query: 385 LEYQFKQISDLVSTTMKER 403
           +  + ++IS+ +S   + R
Sbjct: 656 MNKKVEKISEKISEENERR 674

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,761,517
Number of extensions: 2641540
Number of successful extensions: 8389
Number of sequences better than 10.0: 53
Number of HSP's gapped: 8561
Number of HSP's successfully gapped: 53
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)