Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.786.9ON39239221050.0
ZYRO0F00462g6.9ON39339314070.0
TPHA0M001906.9ON39139313950.0
TDEL0G046206.9ON39239113380.0
NCAS0F001906.9ON41140113330.0
NDAI0K029006.9ON43840713160.0
Ecym_30126.9ON39737512571e-172
CAGL0B03575g6.9ON41939412511e-171
Skud_5.336.9ON40140112361e-169
KNAG0E009806.9ON41439112341e-169
YEL056W (HAT2)6.9ON40140112151e-166
Suva_5.126.9ON40140112091e-165
Smik_5.316.9ON42740512061e-164
SAKL0E00814g6.9ON39839712031e-164
ACR017W6.9ON42337811791e-160
KLLA0D00814g6.9ON40840111481e-156
Kwal_56.223456.9ON39638011411e-155
KLTH0C11550g6.9ON39838011411e-155
KAFR0L003206.9ON39138211021e-149
TBLA0A071206.9ON40738610541e-141
TBLA0H036508.548ON4194343501e-36
KLTH0E12694g8.548ON4184043422e-35
AEL250C8.548ON4174063413e-35
Kpol_1024.398.548ON4174153395e-35
Ecym_70428.548ON4144053245e-33
NDAI0C055108.548ON4194193247e-33
YBR195C (MSI1)8.548ON4224183212e-32
ZYRO0A13068g8.548ON3974023096e-31
KAFR0I008408.548ON4134113097e-31
Suva_4.4498.548ON4244193081e-30
KLLA0E23541g8.548ON4174023034e-30
TPHA0L017208.548ON4194083036e-30
Smik_2.3358.548ON4224183028e-30
Kwal_27.120708.548ON4184063018e-30
NCAS0B021708.548ON4144163019e-30
Skud_2.3218.548ON4224153011e-29
SAKL0H09900g8.548ON4254082992e-29
CAGL0M05291g8.548ON4194402931e-28
TDEL0B029808.548ON4124062842e-27
KNAG0A036708.548ON4264232763e-26
NCAS0G011206.276ON4941761792e-13
Skud_13.2912.401ON5094021773e-13
Suva_13.3112.401ON5104031731e-12
KLLA0E07085g3.25ON4522241702e-12
CAGL0K03861g2.401ON5134031693e-12
YMR131C (RRB1)2.401ON5114031675e-12
TPHA0G026502.401ON5164051675e-12
NDAI0A020907.322ON12002341661e-11
Smik_13.3292.401ON5094011651e-11
KAFR0A003802.401ON5164001632e-11
KNAG0B027207.322ON12042321632e-11
KLTH0F19294g3.25ON4512261613e-11
TDEL0G033402.401ON5144021596e-11
Kpol_1041.202.401ON5154051587e-11
KAFR0L013907.322ON12062331598e-11
TPHA0D045007.322ON12082501598e-11
Kpol_1060.246.276ON4863241578e-11
SAKL0F10648g7.322ON12032331581e-10
Kpol_2001.657.322ON12062501581e-10
TBLA0F022307.322ON12162341581e-10
Sklu_YGOB_Anc_2.4012.401ON5204081542e-10
TDEL0C022407.322ON12012331553e-10
KNAG0E021802.401ON5174121533e-10
Skud_4.1097.322ON12012331543e-10
Smik_4.907.322ON12012331534e-10
Suva_4.997.322ON12012331534e-10
NDAI0F012406.276ON5241691506e-10
Kwal_56.245267.322ON12102361517e-10
KLTH0H01892g7.322ON12092361518e-10
KLLA0F04884g7.322ON12122331518e-10
YDL145C (COP1)7.322ON12012331518e-10
NCAS0F019702.401ON5114061481e-09
KAFR0I028403.25ON4562131472e-09
TPHA0D035906.276ON5983221472e-09
Kpol_1048.598.544ON8501761472e-09
Kpol_1019.307.310ON12522061463e-09
KAFR0A069906.239ON8852101436e-09
NCAS0A139407.322ON12052311436e-09
KLTH0E09394g2.401ON5224021427e-09
KAFR0F010606.276ON5531651427e-09
Kwal_33.151365.201ON4731671427e-09
TDEL0A068906.276ON4472211401e-08
ADL184W3.25ON4492081401e-08
NDAI0H027502.401ON5124101391e-08
CAGL0I03718g7.322ON12012481401e-08
Ecym_80727.322ON12011811402e-08
TPHA0P014903.25ON4592261382e-08
CAGL0H00781g6.276ON5131781382e-08
KLLA0F17237g2.401ON5231881382e-08
SAKL0A03872g6.239ON8782111382e-08
TDEL0E054806.239ON8812101383e-08
SAKL0C13266g3.25ON4592271373e-08
KLTH0B03410g5.201ON4771821363e-08
ZYRO0A08690g2.401ON5162621373e-08
ADL186C3.22ON13611991373e-08
SAKL0E07766g2.283ON3981111363e-08
Smik_15.163.22ON13262011373e-08
TDEL0C023607.310ON12642171374e-08
SAKL0C13332g3.22ON13532291374e-08
Ecym_25236.363ON6463311364e-08
Kpol_2002.995.201ON4871821354e-08
NDAI0I003506.340ON5151681354e-08
KLLA0F15598g5.201ON4781701355e-08
CAGL0M04081g3.25ON4552431355e-08
ADR077C7.322ON12042141365e-08
Skud_4.637.310ON12732131365e-08
CAGL0E01485g3.22ON13362011365e-08
AAL157C5.201ON4791581346e-08
YGL137W (SEC27)6.239ON8892101356e-08
Suva_7.1276.239ON8912101356e-08
CAGL0J03476g6.340ON5171681346e-08
Smik_7.1356.239ON8872101357e-08
AFL118W6.239ON8322051348e-08
TBLA0B092502.401ON5263021338e-08
NDAI0G038303.25ON5101641339e-08
Kwal_47.178272.401ON5234031339e-08
CAGL0D05588g5.201ON4771701329e-08
KNAG0F018406.239ON9112101331e-07
NCAS0G038702.283ON3891151311e-07
SAKL0A00660g6.363ON6603211321e-07
AEL269C7.534ON4551671311e-07
NCAS0D046106.340ON5152041311e-07
TPHA0I018808.544ON10341241321e-07
Skud_15.163.22ON13322031321e-07
ZYRO0E07392g6.239ON8972101321e-07
TBLA0A060606.239ON8882101322e-07
TBLA0H002303.22ON13332031322e-07
Smik_4.457.310ON12702201322e-07
Ecym_60672.401ON5222621302e-07
KAFR0E012303.259ON3691601292e-07
TPHA0L016908.544ON8322331312e-07
ZYRO0E08184g6.276ON5063341302e-07
Skud_7.1356.239ON8972101312e-07
Kwal_23.64296.363ON7503561312e-07
AGL234W6.363ON6293191302e-07
TPHA0E030805.201ON4881741302e-07
ZYRO0F05808g7.310ON12822181312e-07
KLLA0F05159g7.310ON12312161312e-07
KLLA0E08449g2.283ON4221821292e-07
KNAG0A012303.22ON13211961302e-07
TPHA0J025406.239ON8662101303e-07
NDAI0I008806.239ON8882101293e-07
NCAS0B022008.544ON8222551293e-07
Suva_4.537.310ON12711911294e-07
Suva_15.223.22ON13361991294e-07
SAKL0H06666g8.672ON4412121274e-07
TDEL0A061808.672ON4342101274e-07
ZYRO0D08206g6.340ON5151691274e-07
CAGL0G01628g2.283ON3761221274e-07
YNL035C2.283ON3891731274e-07
SAKL0H15708g8.316ON3682601264e-07
ADR242C2.401ON5214011274e-07
Kwal_27.115502.283ON4071351274e-07
Smik_6.3488.672ON4511901275e-07
TBLA0C050107.356ON5721721275e-07
YPL247C6.276ON5231711275e-07
Suva_14.3112.283ON3891881265e-07
TPHA0A031007.310ON12652581285e-07
TDEL0A004103.22ON12622431276e-07
TPHA0C033702.283ON4131701266e-07
ZYRO0F11110g7.322ON12012141276e-07
ZYRO0B10450g5.201ON4821371266e-07
SAKL0H09988g8.544ON7492111266e-07
AFR199C2.431ON3341851256e-07
KLTH0H03608g6.239ON8752071276e-07
Ecym_80617.310ON12282671277e-07
CAGL0C03608g6.363ON6432521267e-07
TDEL0E042805.201ON4811911257e-07
KAFR0J009805.201ON4801351258e-07
NCAS0D027305.201ON4751361258e-07
YPL151C (PRP46)8.672ON4511901258e-07
SAKL0A02970g6.276ON4152481248e-07
KLTH0A06754g6.340ON5142111259e-07
CAGL0M02277g8.672ON4271941249e-07
TBLA0H020005.201ON4731421249e-07
TBLA0B087303.25ON4612241241e-06
KLLA0C08547g6.340ON5152071241e-06
ZYRO0F07282g8.672ON4272171241e-06
Smik_14.2962.283ON3891121231e-06
CAGL0H08932g6.239ON9022101241e-06
Kpol_1013.377.534ON4681681231e-06
KNAG0D007406.276ON5041671231e-06
Ecym_21396.276ON4352661231e-06
Skud_14.2982.283ON3891701231e-06
KLLA0F10263g6.363ON6822921241e-06
NCAS0F033405.429ON4481731231e-06
SAKL0D04796g1.247ON7691961231e-06
Skud_16.1318.672ON4512021232e-06
Ecym_70388.544ON8002421232e-06
Suva_10.645.201ON4901411232e-06
KAFR0I028603.22ON13652011232e-06
Suva_16.1598.672ON4511901222e-06
KNAG0J016808.672ON3982091212e-06
KLTH0A07282g6.363ON7252891222e-06
YOL138C (RTC1)3.22ON13411991232e-06
Smik_6.4516.276ON5231711222e-06
SAKL0G12892g5.201ON4761771222e-06
KLTH0G10296g2.283ON4261211212e-06
Kwal_55.220763.22ON12862031232e-06
Smik_12.525.201ON4891401212e-06
CAGL0M08646g5.631ON3372451203e-06
YCR072C (RSA4)6.340ON5151681213e-06
AER263C6.340ON5131691203e-06
KNAG0I028406.340ON5191701203e-06
YLL011W (SOF1)5.201ON4891401194e-06
Skud_12.565.201ON4891881194e-06
TBLA0C018408.672ON4232121194e-06
KLTH0F19338g3.22ON12902011204e-06
KLLA0F19734g8.288ON11331581205e-06
KNAG0I025406.325ON9181761195e-06
Suva_16.606.276ON5261731195e-06
TBLA0I022806.325ON9271881195e-06
CAGL0M05335g8.544ON8063021196e-06
ZYRO0F06776g8.651ON4321891177e-06
Smik_3.1726.340ON5151681177e-06
KAFR0L015207.356ON5841731187e-06
KLLA0C08976g6.325ON9111721188e-06
KAFR0H024508.672ON4172091178e-06
NDAI0I021805.201ON4792311178e-06
TDEL0H003707.534ON4651671178e-06
NCAS0B036908.288ON11451221188e-06
SAKL0A01738g6.325ON9091801188e-06
KLTH0D11132g8.672ON4371531168e-06
KAFR0J025506.325ON9061791179e-06
KNAG0A012503.25ON4522241169e-06
KLLA0D12760g6.276ON493741169e-06
TDEL0A075506.340ON5152041161e-05
TBLA0D041307.231ON5741681161e-05
Kwal_56.236858.288ON11021641171e-05
TBLA0C009902.663ON3931111151e-05
NDAI0J018504.122ON5751981161e-05
KAFR0A033801.247ON6662091161e-05
Kpol_1028.236.363ON7442891161e-05
SAKL0F15972g7.534ON4702291161e-05
ZYRO0D05852g8.316ON3712521151e-05
Kpol_1038.203.22ON13132131161e-05
KLTH0D10648g8.651ON4491181151e-05
KNAG0A030808.651ON4461971151e-05
Smik_10.1261.247ON7122291161e-05
TBLA0A037505.429ON4471731151e-05
Kpol_1003.342.283ON388631142e-05
Kwal_26.87008.651ON3811101142e-05
NCAS0D047806.363ON6212111152e-05
Ecym_71055.201ON4841441142e-05
Kpol_1036.658.316ON3712781142e-05
TDEL0A077806.363ON6572901152e-05
Skud_10.1021.247ON7081701152e-05
SAKL0A01276g6.340ON5151651142e-05
Suva_3.1096.340ON5151681142e-05
Skud_16.326.276ON5221711142e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.78
         (392 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   815   0.0  
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   546   0.0  
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   541   0.0  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   520   0.0  
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   518   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     511   0.0  
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   488   e-172
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   486   e-171
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   480   e-169
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   479   e-169
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   472   e-166
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   470   e-165
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   469   e-164
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   468   e-164
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   458   e-160
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   446   e-156
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   444   e-155
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   444   e-155
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   429   e-149
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   410   e-141
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   139   1e-36
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   136   2e-35
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   135   3e-35
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   135   5e-35
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   129   5e-33
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   129   7e-33
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   128   2e-32
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   123   6e-31
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   123   7e-31
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   123   1e-30
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   121   4e-30
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   121   6e-30
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   120   8e-30
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   120   8e-30
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   120   9e-30
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   120   1e-29
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   119   2e-29
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   117   1e-28
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   114   2e-27
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   110   3e-26
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    74   2e-13
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    73   3e-13
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    71   1e-12
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    70   2e-12
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    70   3e-12
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    69   5e-12
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    69   5e-12
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    69   1e-11
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    68   1e-11
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    67   2e-11
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    67   2e-11
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    67   3e-11
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    66   6e-11
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    65   7e-11
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    66   8e-11
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    66   8e-11
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    65   8e-11
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    65   1e-10
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    65   1e-10
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    65   1e-10
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    64   2e-10
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    64   3e-10
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    64   3e-10
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    64   3e-10
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    64   4e-10
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    64   4e-10
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    62   6e-10
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    63   7e-10
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    63   8e-10
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    63   8e-10
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    63   8e-10
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    62   1e-09
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    61   2e-09
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    61   2e-09
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    61   2e-09
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    61   3e-09
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    60   6e-09
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    60   6e-09
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    59   7e-09
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    59   7e-09
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    59   7e-09
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    59   1e-08
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    59   1e-08
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    58   1e-08
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    59   1e-08
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    59   2e-08
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    58   2e-08
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    58   2e-08
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    58   2e-08
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    58   2e-08
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    58   3e-08
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    57   3e-08
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    57   3e-08
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    57   3e-08
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    57   3e-08
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    57   3e-08
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    57   3e-08
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    57   4e-08
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    57   4e-08
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    57   4e-08
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    57   4e-08
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       57   4e-08
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    57   5e-08
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    57   5e-08
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    57   5e-08
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    57   5e-08
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    57   5e-08
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    56   6e-08
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    57   6e-08
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    57   6e-08
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    56   6e-08
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    57   7e-08
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    56   8e-08
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    56   8e-08
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      56   9e-08
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    56   9e-08
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    55   9e-08
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    56   1e-07
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     55   1e-07
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    55   1e-07
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    55   1e-07
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     55   1e-07
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    55   1e-07
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    55   1e-07
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    55   1e-07
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    55   2e-07
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    55   2e-07
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    55   2e-07
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    55   2e-07
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    54   2e-07
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    55   2e-07
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    55   2e-07
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    55   2e-07
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    55   2e-07
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    55   2e-07
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    55   2e-07
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    55   2e-07
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    55   2e-07
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    54   2e-07
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    55   2e-07
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    55   3e-07
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    54   3e-07
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    54   3e-07
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    54   4e-07
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    54   4e-07
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    54   4e-07
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    54   4e-07
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    54   4e-07
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    54   4e-07
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    54   4e-07
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    53   4e-07
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    54   4e-07
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    54   4e-07
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    54   5e-07
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    54   5e-07
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    54   5e-07
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    53   5e-07
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    54   5e-07
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    54   6e-07
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    53   6e-07
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    54   6e-07
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    53   6e-07
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    53   6e-07
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    53   6e-07
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    54   6e-07
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    54   7e-07
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    53   7e-07
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    53   7e-07
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    53   8e-07
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     53   8e-07
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    53   8e-07
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    52   8e-07
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    53   9e-07
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    52   9e-07
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    52   9e-07
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    52   1e-06
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    52   1e-06
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    52   1e-06
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    52   1e-06
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    52   1e-06
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    52   1e-06
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    52   1e-06
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    52   1e-06
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    52   1e-06
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    52   1e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    52   1e-06
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    52   1e-06
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    52   2e-06
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    52   2e-06
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    52   2e-06
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    52   2e-06
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    52   2e-06
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    51   2e-06
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    52   2e-06
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    52   2e-06
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    52   2e-06
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    52   2e-06
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    51   2e-06
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    52   2e-06
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    51   2e-06
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    51   3e-06
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    51   3e-06
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    51   3e-06
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    51   3e-06
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    50   4e-06
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    50   4e-06
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    50   4e-06
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    51   4e-06
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    51   5e-06
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    50   5e-06
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    50   5e-06
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    50   5e-06
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    50   6e-06
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    50   7e-06
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    50   7e-06
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    50   7e-06
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    50   8e-06
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    50   8e-06
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    50   8e-06
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    50   8e-06
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    50   8e-06
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    50   8e-06
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    49   8e-06
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    50   9e-06
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    49   9e-06
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    49   9e-06
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    49   1e-05
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    49   1e-05
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    50   1e-05
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    49   1e-05
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    49   1e-05
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    49   1e-05
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    49   1e-05
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    49   1e-05
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    49   1e-05
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    49   1e-05
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    49   1e-05
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    49   1e-05
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    49   1e-05
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    49   1e-05
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    49   2e-05
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    49   2e-05
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     49   2e-05
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    49   2e-05
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    49   2e-05
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    49   2e-05
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    49   2e-05
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    49   2e-05
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    49   2e-05
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    49   2e-05
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    49   2e-05
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    49   2e-05
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    49   2e-05
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    49   2e-05
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    49   2e-05
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    49   2e-05
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    48   2e-05
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    49   2e-05
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    49   2e-05
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    48   2e-05
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    49   3e-05
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    48   3e-05
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    48   3e-05
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    48   3e-05
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    48   3e-05
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    48   3e-05
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    48   3e-05
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    48   3e-05
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    48   3e-05
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    48   3e-05
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       48   3e-05
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    48   3e-05
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    48   3e-05
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              48   3e-05
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    47   3e-05
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    48   4e-05
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    48   4e-05
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    47   4e-05
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               47   4e-05
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      47   4e-05
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    47   4e-05
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             47   4e-05
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    47   4e-05
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    47   5e-05
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    47   5e-05
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    47   5e-05
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    47   5e-05
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    47   5e-05
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    47   5e-05
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    47   5e-05
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    47   5e-05
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    47   5e-05
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    47   5e-05
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    47   5e-05
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    47   6e-05
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    47   6e-05
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    47   6e-05
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    47   6e-05
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    47   6e-05
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    47   6e-05
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    47   7e-05
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    47   7e-05
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    47   7e-05
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    47   7e-05
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    47   7e-05
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    47   7e-05
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    46   8e-05
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    47   8e-05
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    46   8e-05
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    46   8e-05
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    47   8e-05
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    47   8e-05
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    47   9e-05
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    46   9e-05
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    46   1e-04
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    46   1e-04
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    46   1e-04
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    46   1e-04
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    46   1e-04
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    46   1e-04
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    46   1e-04
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    46   1e-04
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    46   1e-04
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    46   1e-04
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    46   1e-04
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    46   1e-04
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    46   1e-04
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    45   1e-04
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    46   1e-04
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    46   1e-04
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    45   1e-04
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    46   1e-04
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    45   1e-04
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    46   1e-04
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    46   2e-04
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    45   2e-04
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    45   2e-04
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    45   2e-04
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    45   2e-04
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    45   3e-04
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    45   3e-04
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    45   3e-04
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    45   3e-04
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    45   3e-04
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    45   3e-04
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    45   3e-04
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    45   3e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    45   3e-04
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    45   3e-04
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    45   3e-04
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    45   3e-04
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    44   3e-04
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    45   3e-04
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    45   3e-04
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    45   4e-04
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    45   4e-04
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    44   4e-04
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    44   4e-04
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    45   4e-04
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    44   4e-04
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    44   4e-04
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    44   5e-04
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    44   5e-04
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    44   5e-04
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    44   5e-04
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    44   5e-04
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    44   5e-04
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    44   5e-04
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    44   5e-04
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    44   6e-04
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    44   6e-04
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    44   6e-04
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    44   6e-04
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    44   6e-04
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    43   6e-04
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    44   6e-04
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    44   6e-04
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    44   6e-04
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    44   6e-04
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    44   7e-04
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    43   7e-04
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    43   7e-04
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    44   7e-04
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    44   7e-04
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    44   7e-04
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    44   7e-04
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    44   7e-04
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     43   8e-04
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    44   8e-04
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    43   8e-04
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    43   9e-04
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    43   0.001
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    43   0.001
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    43   0.001
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    43   0.001
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    43   0.001
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    43   0.001
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    43   0.001
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    43   0.001
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    43   0.001
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       43   0.001
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    43   0.001
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    43   0.001
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    43   0.001
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    43   0.001
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    43   0.001
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    43   0.001
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    43   0.001
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    43   0.001
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    43   0.001
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    43   0.001
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    42   0.001
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    42   0.001
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    43   0.001
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    43   0.001
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    42   0.001
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    43   0.002
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    42   0.002
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    43   0.002
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    42   0.002
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    42   0.002
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    42   0.002
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    42   0.002
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    42   0.002
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    42   0.002
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     42   0.002
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    42   0.002
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    42   0.002
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    42   0.002
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    42   0.002
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    42   0.002
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    42   0.002
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    42   0.002
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    42   0.002
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    42   0.002
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    42   0.002
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    42   0.002
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    42   0.002
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    42   0.002
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    42   0.002
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    42   0.002
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    42   0.003
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    42   0.003
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               42   0.003
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    42   0.003
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     42   0.003
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    42   0.003
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    42   0.003
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    42   0.003
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    42   0.003
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    41   0.003
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    42   0.003
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    42   0.003
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    41   0.003
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    41   0.003
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    42   0.003
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    42   0.004
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    41   0.004
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    41   0.004
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    41   0.004
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    41   0.004
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    41   0.004
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    41   0.004
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    41   0.004
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    41   0.004
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    41   0.004
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    41   0.004
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    41   0.004
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    41   0.004
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    41   0.004
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    41   0.004
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    41   0.005
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    41   0.005
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    41   0.005
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    41   0.005
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    41   0.005
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    41   0.005
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    41   0.005
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    41   0.005
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    40   0.005
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    41   0.005
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    40   0.005
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    41   0.005
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    40   0.006
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    40   0.006
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    41   0.006
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    40   0.006
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    41   0.006
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    41   0.006
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    40   0.006
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    40   0.006
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    40   0.006
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    40   0.006
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    40   0.006
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    40   0.007
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    40   0.007
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    40   0.007
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    40   0.007
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    40   0.007
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    40   0.007
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    40   0.007
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    40   0.007
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    40   0.008
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    40   0.008
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    40   0.008
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    40   0.008
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    40   0.008
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    40   0.008
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               40   0.008
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    40   0.008
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    40   0.009
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    40   0.009
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    40   0.009
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    40   0.009
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    40   0.009
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    40   0.009
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    40   0.009
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    40   0.009
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    40   0.010
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    39   0.010
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    40   0.010
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    40   0.010
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    40   0.010
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    40   0.010
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    40   0.011
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    40   0.011
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    40   0.011
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    40   0.011
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    39   0.012
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    40   0.012
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    40   0.012
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    40   0.012
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    40   0.012
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    40   0.012
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    40   0.013
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    39   0.013
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    40   0.013
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    39   0.013
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    39   0.014
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    39   0.014
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    39   0.014
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    39   0.015
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    39   0.015
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    40   0.015
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    39   0.015
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    39   0.015
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    39   0.015
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    39   0.015
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    39   0.015
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    39   0.015
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    39   0.015
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    39   0.016
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    39   0.016
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    39   0.016
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.017
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    39   0.017
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    39   0.018
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    39   0.018
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    39   0.018
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     39   0.018
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    39   0.019
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    39   0.019
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    39   0.019
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    39   0.020
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    39   0.020
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    39   0.020
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    39   0.021
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    39   0.022
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    39   0.022
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    39   0.022
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    39   0.022
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    39   0.022
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    39   0.022
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    39   0.023
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    39   0.023
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    39   0.024
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               39   0.024
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    39   0.025
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    39   0.026
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    39   0.026
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    39   0.026
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    39   0.027
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    38   0.027
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    38   0.027
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    38   0.027
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    39   0.027
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    39   0.027
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    39   0.027
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    38   0.027
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    39   0.028
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    39   0.029
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    38   0.029
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    39   0.029
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    38   0.029
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               38   0.030
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    38   0.031
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    39   0.031
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    39   0.031
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.031
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    39   0.031
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    38   0.031
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    38   0.032
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    38   0.034
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    38   0.034
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    39   0.035
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    38   0.035
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    38   0.035
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    38   0.036
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    38   0.036
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    38   0.037
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    38   0.037
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    38   0.038
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    38   0.038
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    38   0.038
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     38   0.038
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    38   0.039
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    38   0.040
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    38   0.040
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    38   0.040
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    38   0.040
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    38   0.040
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    38   0.040
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    38   0.041
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    38   0.041
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    38   0.043
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    38   0.044
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    38   0.045
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    38   0.046
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    38   0.046
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    37   0.046
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    38   0.047
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    38   0.047
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    38   0.047
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    38   0.047
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    38   0.048
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    38   0.049
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      38   0.049
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    38   0.050
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    37   0.050
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    38   0.051
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    37   0.051
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    38   0.051
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    38   0.053
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    38   0.054
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    38   0.054
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    37   0.057
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    38   0.057
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    37   0.058
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    37   0.058
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    37   0.059
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    37   0.060
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    37   0.061
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    37   0.061
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    37   0.062
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    37   0.063
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    37   0.064
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    37   0.064
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    37   0.064
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    37   0.065
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    37   0.065
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    37   0.066
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    37   0.066
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    37   0.069
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    37   0.070
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    37   0.074
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    37   0.075
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               37   0.076
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    37   0.077
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    37   0.077
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    37   0.077
Suva_16.171 Chr16 complement(299070..300455) [1386 bp, 461 aa] {...    37   0.077
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    37   0.078
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    37   0.079
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    37   0.081
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    37   0.081
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    37   0.081
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    37   0.082
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    37   0.082
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    37   0.083
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    37   0.083
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    37   0.084
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    37   0.085
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    37   0.089
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    37   0.090
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    37   0.091
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    36   0.093
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    37   0.093
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    37   0.093
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    37   0.095
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    37   0.096
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    37   0.097
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    37   0.099
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    37   0.099
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    37   0.10 
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    36   0.10 
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    37   0.10 
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    37   0.11 
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    36   0.11 
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    36   0.11 
TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.6...    37   0.11 
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    37   0.11 
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    37   0.11 
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    37   0.11 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    36   0.11 
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    37   0.11 
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    37   0.12 
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    37   0.12 
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    37   0.12 
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    36   0.12 
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    37   0.12 
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    37   0.12 
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    36   0.12 
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    37   0.12 
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    36   0.12 
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    37   0.12 
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    37   0.12 
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    36   0.13 
KNAG0J02460 Chr10 complement(465585..466361) [777 bp, 258 aa] {O...    36   0.13 
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    36   0.13 
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    36   0.13 
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    36   0.14 
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    36   0.14 
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    36   0.15 
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    36   0.15 
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    36   0.15 
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    36   0.15 
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    36   0.15 
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    36   0.15 
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    36   0.15 
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    36   0.15 
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               36   0.15 
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    36   0.15 
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    36   0.16 
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    36   0.17 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    36   0.17 
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    36   0.17 
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    36   0.17 
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    36   0.17 
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    36   0.17 
NCAS0I01270 Chr9 (229975..230754) [780 bp, 259 aa] {ON} Anc_3.33...    35   0.17 
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    36   0.17 
KAFR0G01610 Chr7 complement(355067..355843) [777 bp, 258 aa] {ON...    35   0.18 
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    36   0.18 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    36   0.19 
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    36   0.19 
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    36   0.19 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    36   0.19 
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    36   0.20 
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    36   0.20 
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    35   0.20 
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    36   0.21 
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    36   0.21 
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    36   0.21 
Suva_4.335 Chr4 complement(593913..594689) [777 bp, 258 aa] {ON}...    35   0.21 
Smik_2.229 Chr2 complement(408029..408805) [777 bp, 258 aa] {ON}...    35   0.21 
YBR088C Chr2 complement(424990..425766) [777 bp, 258 aa] {ON}  P...    35   0.21 
Skud_2.216 Chr2 complement(393230..394006) [777 bp, 258 aa] {ON}...    35   0.21 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    35   0.21 
SAKL0G15378g Chr7 (1323190..1324305,1324796..1325290) [1611 bp, ...    35   0.22 
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    35   0.23 
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    35   0.23 
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    35   0.24 
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    35   0.25 
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    35   0.25 
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    35   0.25 
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    35   0.26 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    35   0.26 
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    35   0.27 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    35   0.27 
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    35   0.27 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    35   0.27 
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    35   0.27 
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    35   0.27 
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    35   0.27 
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    35   0.27 
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    35   0.28 
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    35   0.28 
TDEL0C04740 Chr3 complement(859442..860218) [777 bp, 258 aa] {ON...    35   0.29 
CAGL0D01716g Chr4 (179249..180025) [777 bp, 258 aa] {ON} highly ...    35   0.29 
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    35   0.29 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    35   0.30 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    35   0.30 
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    35   0.30 
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    35   0.30 
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    35   0.30 
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    35   0.31 
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    35   0.31 
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    35   0.31 
KLTH0C09636g Chr3 (800421..802229) [1809 bp, 602 aa] {ON} weakly...    35   0.32 
ZYRO0C15730g Chr3 complement(1232565..1233341) [777 bp, 258 aa] ...    35   0.32 
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    35   0.32 
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    35   0.32 
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    35   0.34 
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    35   0.34 
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    35   0.35 
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    35   0.36 
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    35   0.37 
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    35   0.37 
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    35   0.37 
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     35   0.38 
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    35   0.39 
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    34   0.39 
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    35   0.41 
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    34   0.41 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    35   0.42 
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    35   0.42 
Kpol_264.9 s264 complement(18422..19198) [777 bp, 258 aa] {ON} c...    34   0.43 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    35   0.47 
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      34   0.47 
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    34   0.48 
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    34   0.48 
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    34   0.50 
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    35   0.51 
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    34   0.51 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    34   0.53 
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    34   0.55 
TBLA0B02560 Chr2 (586575..587351) [777 bp, 258 aa] {ON} Anc_3.33...    34   0.58 
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    33   0.59 
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    34   0.59 
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    34   0.61 
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    34   0.65 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    34   0.66 
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    34   0.68 
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    34   0.70 
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    33   0.71 
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    34   0.72 
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    34   0.72 
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    34   0.73 
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    34   0.73 
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    34   0.76 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    34   0.76 
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    34   0.78 
NDAI0A07740 Chr1 complement(1781144..1781920) [777 bp, 258 aa] {...    33   0.79 
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    34   0.82 
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    33   0.85 
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    34   0.85 
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    33   0.86 
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    34   0.86 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    33   0.86 
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    33   0.89 
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    33   0.89 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    33   0.92 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    33   0.94 
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    33   0.94 
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    33   0.95 
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    33   1.0  
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    33   1.0  
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    33   1.0  
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    33   1.1  
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    33   1.1  
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    33   1.1  
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    33   1.1  
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    33   1.1  
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    33   1.2  
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    33   1.2  
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    33   1.2  
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    33   1.2  
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    33   1.3  
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    33   1.4  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    33   1.4  
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    33   1.4  
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    33   1.4  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    33   1.5  
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    33   1.6  
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    33   1.6  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    33   1.6  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    33   1.7  
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    33   1.7  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    33   1.7  
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    33   1.8  
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    32   1.9  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    32   1.9  
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    33   1.9  
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    32   1.9  
KAFR0A05280 Chr1 complement(1045446..1048265) [2820 bp, 939 aa] ...    33   2.0  
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    33   2.0  
NDAI0A07070 Chr1 complement(1610054..1612360) [2307 bp, 768 aa] ...    33   2.1  
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    32   2.1  
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    32   2.1  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    32   2.2  
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    32   2.2  
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    32   2.3  
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    32   2.3  
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    32   2.3  
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    32   2.3  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    32   2.3  
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    32   2.4  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    32   2.4  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    32   2.4  
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    32   2.5  
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    32   2.5  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    32   2.6  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    32   2.7  
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    32   2.7  
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    32   2.8  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    32   2.8  
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    32   2.8  
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    32   2.8  
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    32   2.9  
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    32   3.0  
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    32   3.0  
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    32   3.2  
KAFR0G01280 Chr7 (286915..288597) [1683 bp, 560 aa] {ON} Anc_3.9...    32   3.2  
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    32   3.2  
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    32   3.2  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    32   3.3  
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    32   3.4  
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    32   3.5  
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    32   3.5  
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    32   3.9  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   4.2  
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    31   4.3  
NCAS0E03000 Chr5 (595862..598918) [3057 bp, 1018 aa] {ON} Anc_7....    32   4.3  
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    32   4.3  
TBLA0B08220 Chr2 complement(1962086..1963405) [1320 bp, 439 aa] ...    31   4.3  
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    31   4.4  
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    31   4.6  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    31   4.6  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    31   4.7  
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    31   5.1  
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    31   5.4  
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    31   5.4  
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    31   5.4  
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    31   5.5  
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    31   5.5  
KNAG0G01320 Chr7 (295446..296891) [1446 bp, 481 aa] {ON} Anc_8.1...    31   5.6  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    31   5.8  
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    31   6.2  
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    31   6.3  
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    31   6.3  
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    31   6.5  
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    31   6.6  
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    31   6.6  
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    31   6.7  
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    31   6.7  
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    31   7.1  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    30   7.2  
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    31   7.3  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    31   7.6  
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    31   7.6  
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    30   7.7  
ADR331C Chr4 complement(1285562..1290250) [4689 bp, 1562 aa] {ON...    31   8.0  
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    30   8.4  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    30   8.6  
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    30   8.8  
KLLA0F20658g Chr6 (1919851..1923099) [3249 bp, 1082 aa] {ON} sim...    30   8.9  
Skud_2.408 Chr2 complement(726580..729003) [2424 bp, 807 aa] {ON...    30   8.9  
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    30   9.2  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    30   9.2  
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    30   9.7  
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    30   10.0 

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/392 (100%), Positives = 392/392 (100%)

Query: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILG 60
           MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILG
Sbjct: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILG 60

Query: 61  THTSGEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDS 120
           THTSGEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDS
Sbjct: 61  THTSGEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDS 120

Query: 121 NIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIAL 180
           NIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIAL
Sbjct: 121 NIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIAL 180

Query: 181 WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ 240
           WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ
Sbjct: 181 WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ 240

Query: 241 AKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDG 300
           AKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDG
Sbjct: 241 AKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDG 300

Query: 301 ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSA 360
           ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSA
Sbjct: 301 ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSA 360

Query: 361 SVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392
           SVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ
Sbjct: 361 SVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/393 (62%), Positives = 312/393 (79%), Gaps = 1/393 (0%)

Query: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILG 60
           M      E+PL++D+EY+LWK+NVPLMYDFVSET LTWPSLT +WLPGS    RQ MILG
Sbjct: 1   MSISNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILG 60

Query: 61  THTSGEEVDYLKVAALDLPDEVVT-GEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKD 119
           THTS EE +YLK+AA+ LPDEVV   E  ++    KSN+KI+KKFEH+ E+ RARYMP+D
Sbjct: 61  THTSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQD 120

Query: 120 SNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIA 179
            N+IATI+G G + +Y+R+     GL +T ++H ENGYGLSFNPN   +L+SGSDD  I 
Sbjct: 121 DNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV 180

Query: 180 LWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTI 239
           LWD+   S+ P   + + HSDIVNDC WH+FD+N+FGSVSEDSTL+LHD+R     +  +
Sbjct: 181 LWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240

Query: 240 QAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKED 299
           QAK  +NTLAFS HS NLFAAAG D+ +YLYDRR+ +KPLH+M GHEDA+T L+FHP+ED
Sbjct: 241 QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED 300

Query: 300 GILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLS 359
           G+L+S G+DRR ILWDLAEIGAEQ PD+ADDGSPE++MIHAGHRS+INDF+++P IPWL+
Sbjct: 301 GVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360

Query: 360 ASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392
           A+ EE+N+VQVWK S  L R+GGTP +DT++L+
Sbjct: 361 ATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/393 (65%), Positives = 307/393 (78%), Gaps = 3/393 (0%)

Query: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILG 60
           ME   +QEEPLTVDQEY+LWK+NVPL+YDFVSETRLTWPSLT QWLPG +  TRQ++ILG
Sbjct: 1   MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILG 60

Query: 61  THTSGEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDS 120
           T TSG E DYLK+AALDLPDE++ G+ +D  +  KSN+K+VKKF HDGEINRARYMP+++
Sbjct: 61  TLTSGAETDYLKIAALDLPDEIIIGKKSD--KVVKSNLKVVKKFAHDGEINRARYMPQNT 118

Query: 121 NIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIAL 180
           NIIAT+NGEG + IYD S+ +   L +TLKYHK+N YGL+FNPN   ELISGSDD TIAL
Sbjct: 119 NIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL 178

Query: 181 WDIDSGS-KSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTI 239
           WD  +   K P   W   HSDIVNDC WH F+ N+FGSVSEDSTL+L DKR+  K    I
Sbjct: 179 WDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKI 238

Query: 240 QAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKED 299
            +K  +N++AFS  S NLFAAAG   NIYLYD R T K LH M GHE+ +T L+F   +D
Sbjct: 239 SSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKD 298

Query: 300 GILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLS 359
           GIL+SG +DRRVI+WDL EIGAEQQPDEADDG PE++MIHAG RSAIND + HP+IPWL+
Sbjct: 299 GILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLN 358

Query: 360 ASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392
           ASVEE+N+VQVWKCS  L R+ GTPE+    L+
Sbjct: 359 ASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/391 (61%), Positives = 306/391 (78%), Gaps = 1/391 (0%)

Query: 3   AQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTH 62
           A+ + ++PL++D+EYELW++NVPLMYDFVSET LTWP+LT +WLPG+    RQ +ILGTH
Sbjct: 2   AEEQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNRQELILGTH 61

Query: 63  TSGEEVDYLKVAALDLPDEVVTG-EANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSN 121
           TS EE +YLK+AA+DLPDE+V G E  + +  TKSNIKI+KKF+H+ E+ RARYMP+DSN
Sbjct: 62  TSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSN 121

Query: 122 IIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALW 181
           +IATING G V +YDRSK   +GL ++L +H++NGYGLSFNP    +L+SGSDD  IALW
Sbjct: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALW 181

Query: 182 DIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQA 241
           DI + S  P S W++ H D VNDC WH  + N FGSVSED TL+LHD+R    V + I+ 
Sbjct: 182 DITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT 241

Query: 242 KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGI 301
             AFNT+AFSKHS NLFAAAG D+ IYLYD R+T   LH M+GHE  +T L+F+  +DGI
Sbjct: 242 VTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGI 301

Query: 302 LVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSAS 361
           ++S G DRRVI+WDL EIGAEQ PD+ADDGSPE++MIHAGHRS +NDF+++P IPWL AS
Sbjct: 302 VMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMAS 361

Query: 362 VEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392
            EE+N+VQVWKCS  L RVGG P++D  +L+
Sbjct: 362 AEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 317/401 (79%), Gaps = 11/401 (2%)

Query: 3   AQREQEEP---LTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQY 56
            Q E+E+P   L++D+EYELW++NVPLMYDFVSETRLTWPSL+ +WLP    ++   RQ 
Sbjct: 11  VQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQE 70

Query: 57  MILGTHTSGEEVDYLKVAALDLPDEVV-TGEANDDNRR----TKSNIKIVKKFEHDGEIN 111
           +I+GTHTSGEE +YLK+AA+DLP++++ + E  +D ++    TKSNIKI+KKF+H+ EI 
Sbjct: 71  LIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFKHEEEIT 130

Query: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELIS 171
           RARYMP++SN++ATING G V +YDRSK +  GL +T +YHKENGYGLSFN N + +L+S
Sbjct: 131 RARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLS 190

Query: 172 GSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS 231
           GSDD TIALW++++ + SP  VW ++HSDIVNDC W +FD N+FGSVSEDSTL+LHD+R 
Sbjct: 191 GSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE 250

Query: 232 TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITC 291
                +  +  A FNTLAFSKHS  LFAAAG D+++YL+DRR  ++PLH MAGH+ A+T 
Sbjct: 251 KDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTN 310

Query: 292 LQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTL 351
           ++F P +DGIL++ G DRR I+WD+ +IG EQ PD+A+DG+PE+LMIHAGHRSAINDF++
Sbjct: 311 MEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSM 370

Query: 352 HPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392
           +P IPWL AS EE+N++QVWKCS  L RVGGTP +    L+
Sbjct: 371 NPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/407 (58%), Positives = 309/407 (75%), Gaps = 20/407 (4%)

Query: 6   EQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDT----RQYMILGT 61
           ++ + LT+D+EY+LWK+NVPLMYDFVSET+LTWP+LT +WLP S   T    RQ +ILGT
Sbjct: 32  DENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGT 91

Query: 62  HTSGEEVDYLKVAALDLPDEVVTGEAND-------------DNRRTKSNIKIVKKFEHDG 108
           HTSGEE +YLK+AA+DLPDEVV    N                ++ +SNIKIVKKF+H+ 
Sbjct: 92  HTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEE 151

Query: 109 EINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNE 168
           EI RAR+MP++++IIATING G V IY++S  +   L +TL++HKENGYGLSFNPN   +
Sbjct: 152 EITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGK 211

Query: 169 LISGSDDFTIALWDIDSGS---KSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLK 225
           L+SGSDD TIALWDI   S   K P  +WD++H+DIVNDC W+ F+ N+F SVSEDSTL+
Sbjct: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271

Query: 226 LHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
           LHD+R  + +IN+I+    FNTLAFSKHS  L AAAG D+ +YLYD R  + PL+ M GH
Sbjct: 272 LHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGH 331

Query: 286 EDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSA 345
           ED+IT L+F P  DG+L+S G DRRVI+WD+ +IGAEQ PD+A+DG+PE++MIHAGHRSA
Sbjct: 332 EDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSA 391

Query: 346 INDFTLHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392
           +NDF+++P IPWL AS EE+N++QVWKCS  L  VGGTPE+   +L+
Sbjct: 392 VNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  488 bits (1257), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 235/375 (62%), Positives = 291/375 (77%), Gaps = 8/375 (2%)

Query: 8   EEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDT---RQYMILGTHTS 64
           E PLTVDQEYELWK+NV LMYDFVSET+LTWPSL+ QWLP  + +    +Q MILGTHTS
Sbjct: 11  ESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS 70

Query: 65  GEEVDYLKVAALDLPDEVVTGEANDDNRR--TKSNIKIVKKFEHDGEINRARYMPKDSNI 122
           G+E +YLK+AA+DLP EVV G  ++DN     KS IK+ KKFEH+ E+ RARYMPK+  I
Sbjct: 71  GDENNYLKIAAIDLPYEVV-GLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKI 129

Query: 123 IATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWD 182
           IATING+G + IYDRSKS+S+GL  TL YHK+NGYGL+FNP +  EL+S SDD T+ALWD
Sbjct: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189

Query: 183 IDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK 242
           I+S  + P S+  N H+DIVND  WH FDEN+FG+VSED TL++HDKRS S     +  +
Sbjct: 190 INSTDR-PVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE 247

Query: 243 AAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGIL 302
              N LAFSKHS NL AAAG DT +YLYD R+ ++PLH MAGH+DA+T ++F   +DGIL
Sbjct: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307

Query: 303 VSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASV 362
            S G+DRR+ +WDL +IGAEQ  ++ADDG PE++M+HAGHRSAINDF+ +P +PWL AS 
Sbjct: 308 CSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASA 367

Query: 363 EEDNVVQVWKCSKNL 377
           EEDNVVQVWK SK L
Sbjct: 368 EEDNVVQVWKISKKL 382

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  486 bits (1251), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 292/394 (74%), Gaps = 12/394 (3%)

Query: 9   EPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSE---EDTRQYMILGTHTSG 65
           EP+TVD+EYELWK+NVP++YDFVSETRLTWP+LT +WLP        TRQ +ILGTHTSG
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSG 85

Query: 66  EEVDYLKVAALDLPDEVVTGEANDDNRRTK------SNIKIVKKFEHDGEINRARYMPKD 119
           EE +YLK+ A+DLP EV      D     +      SN+KIVKKF HDGEI RARYMP+D
Sbjct: 86  EEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQD 145

Query: 120 SNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIA 179
            NIIATINGEG + IYDRSK+  + L +TL+YH ENGYGL+FN N    L+SGSDD  IA
Sbjct: 146 DNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIA 205

Query: 180 LWDIDSGSKS--PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVIN 237
           LWDI +  K+  P   +++ H+DI+ND  WH  + ++FGSVSEDST+KL DKRS S++I+
Sbjct: 206 LWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS-SQIIH 264

Query: 238 TIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPK 297
            I  K  +NTLAFS  S+NLFAAAG D  +YLYD R  + PL+ M GHEDA+T ++F P 
Sbjct: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324

Query: 298 EDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPW 357
            DGIL S G+DRR I+WDL EIGAEQ  DE +DG PE+LMIHAGH+++IND  ++P I W
Sbjct: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384

Query: 358 LSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391
           L AS EEDN+VQ+WKCS N+ R+GG PE+D  +L
Sbjct: 385 LVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  480 bits (1236), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/401 (56%), Positives = 303/401 (75%), Gaps = 20/401 (4%)

Query: 7   QEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED-----TRQYMILGT 61
           QE+PL+VD+EY+LWK+NVPLMYDFVSETRLTWPSLT QWLP   +       +Q +I+GT
Sbjct: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGT 63

Query: 62  HTSGEEVDYLKVAALDLPDEVVTGEANDDNRRT---------KSNIKIVKKFEHDGEINR 112
           HTSGEE +YLK A ++LP EV+  E   +             +SNI+I  K+EH+ EI R
Sbjct: 64  HTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITR 123

Query: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           ARYMP+D N++ATING+G V +Y    SRSDGL++TLK+HK+NGY LSF+P +   L+SG
Sbjct: 124 ARYMPQDPNMVATINGQGTVFLY----SRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSG 179

Query: 173 SDDFTIALWDIDSGSKS--PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           SDD ++ALWD+  GS S  P   WD++HSDIVND  WH+F+++LFG+VSEDS LK++D R
Sbjct: 180 SDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239

Query: 231 STSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAIT 290
           + +  I+T +    FNTLAFS HS+N+ AAAG+D+++YLYD R   +PLH M+GHEDA+T
Sbjct: 240 AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVT 299

Query: 291 CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFT 350
            L+F P  DG++VS G+D R+I+WDL +IGAEQ PD+A+DG PE++M+HAGHRSA+NDF 
Sbjct: 300 NLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFD 359

Query: 351 LHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391
           L+  +PWL AS EE+N++QVWKCS +L  VGG P+I+  ++
Sbjct: 360 LNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  479 bits (1234), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 221/391 (56%), Positives = 290/391 (74%), Gaps = 6/391 (1%)

Query: 6   EQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED--TRQYMILGTHT 63
           ++  PL   +EY+LWK+NVP+MYDFVSETRL WPSLT QWLP S  +  TRQ +ILGTHT
Sbjct: 26  DENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHT 85

Query: 64  SGEEVDYLKVAALDLPDEVV--TGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSN 121
           S EE +YLK+A +DLP EV   +     D  + +SNI++ +KF+HD E+ RARYMP+D N
Sbjct: 86  SDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPN 145

Query: 122 IIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALW 181
           I+ATI+G G V IYDRS  R D    TL+YH +NGYGL+FNP +   L+SGSDD  +ALW
Sbjct: 146 ILATISGTGTVYIYDRSNER-DTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALW 204

Query: 182 DIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQA 241
           D+ S    P   W+NIHSDIVNDC WH+F ++LFG+VSEDS+L++HD R  SK + TI  
Sbjct: 205 DVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE-SKPVATING 263

Query: 242 KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGI 301
              FNTL+FS HS NL A  G+++ +YLYDRR   +PLH+M+GH DA+T L F  ++DGI
Sbjct: 264 TKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGI 323

Query: 302 LVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSAS 361
           ++S GAD+RVI+WD+ +IGAEQ  ++A+D + E++MIHAGHRS INDF ++P+IPWL AS
Sbjct: 324 ILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVAS 383

Query: 362 VEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392
            EE+N+VQ+WKCS  L R+ GTP +   MLQ
Sbjct: 384 AEEENIVQLWKCSHKLPRISGTPPVRVDMLQ 414

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  472 bits (1215), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 307/401 (76%), Gaps = 20/401 (4%)

Query: 7   QEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED-----TRQYMILGT 61
           QE+PL+VD+EY+LWK+NVPLMYDFVSETRLTWPSLT QWLP   ++      +Q +I+GT
Sbjct: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGT 63

Query: 62  HTSGEEVDYLKVAALDLPDEVVTGE-----ANDDNRRT----KSNIKIVKKFEHDGEINR 112
           HTSGEE +YLK A ++LP E+++ E     A ++ + +    +SNI+I  K+EH+ EI R
Sbjct: 64  HTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITR 123

Query: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           ARYMP+D NI+ATING+G V +Y    SRS+GL++TLK+HK+NGY LSF+  V   L+SG
Sbjct: 124 ARYMPQDPNIVATINGQGTVFLY----SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSG 179

Query: 173 SDDFTIALWDIDSGSKSPKSV--WDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           SDD T+ALW++ SG    K V  W+++HSDI+ND  WH+F+++LFG+VSEDS LK++D R
Sbjct: 180 SDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR 239

Query: 231 STSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAIT 290
           + +  I+T++    FNTLAFS HS+NL AAAG+D+ +YLYD R   +PLH M+GHEDA+ 
Sbjct: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299

Query: 291 CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFT 350
            L+F    DG++VS G+D R+++WDL +IGAEQ PD+A+DG PE++M+HAGHRS++NDF 
Sbjct: 300 NLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFD 359

Query: 351 LHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391
           L+P IPWL AS EE+N++QVWKCS +L  VGG P+++  ++
Sbjct: 360 LNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  470 bits (1209), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/401 (55%), Positives = 300/401 (74%), Gaps = 20/401 (4%)

Query: 7   QEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED-----TRQYMILGT 61
           QE+PL+VD+EY+LWK+NVPLMYDFVSETRLTWPSLT QWLP   ++      +Q +I+GT
Sbjct: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGT 63

Query: 62  HTSGEEVDYLKVAALDLPDEVVTGE-----ANDDNRRT----KSNIKIVKKFEHDGEINR 112
           HTSGEE +YLK A ++LP E++  E     A +D+  +    +SNIKI  K++H+ EI R
Sbjct: 64  HTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITR 123

Query: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           ARYMP++   +ATING+G V IY    SRS+GL++TLK+H+ENGY LSF+P V   L+SG
Sbjct: 124 ARYMPQNPGTVATINGQGTVFIY----SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSG 179

Query: 173 SDDFTIALWDIDSGSKS--PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           SDD T+ALWD++  S S  P   W ++HSDIVND  WH+F+++LFG+VSEDS LK++D R
Sbjct: 180 SDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR 239

Query: 231 STSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAIT 290
             +    T +    FNTLAFS HS+NL AAAG D+++YLYD R   +PLH M+GHEDA+T
Sbjct: 240 VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVT 299

Query: 291 CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFT 350
            L+F P  DG++VS G+D R+I+WDL +IGAEQ PD+A+DG PE++M+HAGH+SA+NDF 
Sbjct: 300 NLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFD 359

Query: 351 LHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391
           L+  IPWL AS EE+N++QVWKCS +L  VGG P++   M+
Sbjct: 360 LNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  469 bits (1206), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/405 (54%), Positives = 304/405 (75%), Gaps = 20/405 (4%)

Query: 3   AQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDT-----RQYM 57
           A   QE+ L+VD+EY+LWK+NVPLMYDFVSETRLTWPSL+ QWLP   ++      RQ +
Sbjct: 26  AMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQEL 85

Query: 58  ILGTHTSGEEVDYLKVAALDLPDEVVTG-----EANDDNRRT----KSNIKIVKKFEHDG 108
           I+GTHTSGEE +YLK A +++P E++       EA +D++ T    KSNI+I  K+ H+ 
Sbjct: 86  IIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEE 145

Query: 109 EINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNE 168
           EI RARYMP++ + +AT+NG+G V +Y    SRS GL++TLK+HK+NGY LSFN  V  +
Sbjct: 146 EITRARYMPQNPDFVATLNGQGTVFLY----SRSGGLQSTLKFHKDNGYALSFNALVEGQ 201

Query: 169 LISGSDDFTIALWDIDSGSKS--PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           L+SGSDD T+ALW++ S S S  P   W+++HSDIVND  WH+F+E LFG+VSEDS LK+
Sbjct: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261

Query: 227 HDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHE 286
           +D R+ +  I+ ++    FNTLAFS HS+NL AAAG+D+++YLYD R   +PLH M+GHE
Sbjct: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321

Query: 287 DAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAI 346
           DA+T ++F    DG++VS G+D R+I+WDL +IGAEQ PD+A+DG PE++M+HAGHRS++
Sbjct: 322 DAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 381

Query: 347 NDFTLHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391
           NDF L+  IPWL AS EE+N++QVWKCS NL  VGG P+++  ++
Sbjct: 382 NDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  468 bits (1203), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 224/397 (56%), Positives = 295/397 (74%), Gaps = 13/397 (3%)

Query: 6   EQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSG 65
           E+ + L++++EYELWKTNVPLMYDFVSET+LTWPSLT QWLPG+   T+Q MILGTHTSG
Sbjct: 5   EENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSG 64

Query: 66  EEVDYLKVAALDLPDEVVTGE---------ANDDNRRTKSNIKIVKKFEHDGEINRARYM 116
           E+ +YLK+A+++LP++++  E           +  R  +S IKI KK +H+ EI RAR+M
Sbjct: 65  EDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITRARFM 124

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDF 176
           P+D N IATING G V ++DRSK +++ L +   +HK+NGYGLSFNP    EL+S SDD 
Sbjct: 125 PQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDG 184

Query: 177 TIALWDIDSGSKSP-KSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKV 235
           TIALW++   + SP K+V    H DIVNDC+WH F+ENLFGSVSED TL++HDKR+ S V
Sbjct: 185 TIALWNVMGTNTSPSKAV--TTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTV 242

Query: 236 INTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFH 295
            + +   + FNTL FSKHS NLFAAAG D+ +YLYD R T   LH M+GHED++T L+F 
Sbjct: 243 -HRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFS 301

Query: 296 PKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTI 355
           P +DGIL S G+DRRV+LWDL +IG+EQ  ++A DG PE++M+HAGH+SA+NDF+ +  I
Sbjct: 302 PHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNI 361

Query: 356 PWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392
           PWL ASVEEDN+V VWK SK L+  G   + D + L+
Sbjct: 362 PWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  458 bits (1179), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 213/378 (56%), Positives = 281/378 (74%), Gaps = 6/378 (1%)

Query: 9   EPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEEV 68
           + LTV++EYELW +NVP+MY+FVSET+LTWPSLT QWLP   +   Q +I GTHT+GEEV
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEV 99

Query: 69  DYLKVAALDLPDEVVTGEAND--DNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATI 126
           +YLKVA ++LP  +   +  D  D     S+  I  KF H  E+ RARYMP +SNIIATI
Sbjct: 100 NYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATI 159

Query: 127 NGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSG 186
           NG+G +SI+DR+   S    +TL +HKENGYGL+FNP++S EL+SGSDD T+ALWDI++ 
Sbjct: 160 NGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEA- 218

Query: 187 SKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFN 246
           +K PKS+  + H DIVND  WH F+ N+FG+VSED TL++HDKR   + +  +   + FN
Sbjct: 219 AKKPKSILTS-HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFN 277

Query: 247 TLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGG 306
           TL+FSKHS NL AAAG+D+ IYLYD R  + PLHVM+GH+D++T ++F P  DGI+ S G
Sbjct: 278 TLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSG 337

Query: 307 ADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDN 366
           +DRR I+WDL +IGAEQ  D+ADDG+PE++M+HAGHRS +N+F+ +P IPWL AS EEDN
Sbjct: 338 SDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDN 397

Query: 367 VVQVWKCSKNLSRVGGTP 384
           V+Q WK S  L  V  +P
Sbjct: 398 VIQAWKVSMKL--VNASP 413

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  446 bits (1148), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 286/401 (71%), Gaps = 19/401 (4%)

Query: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPG--------SEED 52
           M    E E+P T+++EY+LW +NVP+MYDFVSETRLTWPSLT QWLP          ++ 
Sbjct: 1   MTEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQL 60

Query: 53  TRQYMILGTHTSGEEVDYLKVAALDLPDEVVTGE--ANDDNRRT-----KSNIKIVKKFE 105
            RQ +++GT T+  E +YLK+AA+DLP+ V + +   +DD +       +S IKIV+KF+
Sbjct: 61  LRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFK 120

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYDRS-KSRSDGLRTTLKYHKENGYGLSFNPN 164
           H+ E+ RARYMP+  NIIAT+NG G V I+DR+ K +  G   +  YHKENGYGL+FNP 
Sbjct: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180

Query: 165 VSNELISGSDDFTIALWDIDS-GSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           VS +L+S SDD T+ALWD+ S  +KSP   +D +H+DIVNDC WH F  +LFG+VSED+T
Sbjct: 181 VSGQLLSASDDGTVALWDVTSTANKSPSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDNT 239

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           L +HD  S  + I  +   +AFNTLAFSK S NL AAAG D+N+YLYD R+  KPLH MA
Sbjct: 240 LIIHDTNS-DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GHED++T L+F P +DG+L S G+DRR+I+WDL  IGAEQQPD+A DG PE+ M+H GHR
Sbjct: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHR 358

Query: 344 SAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTP 384
           S +N+F+ +  +PWL  SVEE+NV+Q+WK +  + R    P
Sbjct: 359 SPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  444 bits (1141), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/380 (57%), Positives = 287/380 (75%), Gaps = 9/380 (2%)

Query: 6   EQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSG 65
           E E  L++D EY+LWK+NVPLMYDFVSETRL WPSLT QWLP +E+ T Q +++GTHTS 
Sbjct: 5   EPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSD 64

Query: 66  EEVDYLKVAALDLPDEVVTGEA----NDDN---RRTKSNIKIVKKFEHDGEINRARYMPK 118
            E +YLK+A ++LP E+++ E     ND+N    +  S IKI+KKF+H+ E+ RARY P 
Sbjct: 65  SEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPF 124

Query: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           DSN+IATI+G G V +YDR+K   + LR    YHKENGYGL+F+     ELIS SDD +I
Sbjct: 125 DSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSI 184

Query: 179 ALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINT 238
           A+WDI SG   P SV +++HSDIVN+C WH  D N++GSVSEDS L +HDKRS  K +  
Sbjct: 185 AIWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRS-EKPLQK 242

Query: 239 IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKE 298
           +  K  FNT+AFSKHS+NLFAAAG D  +YL+D R+ T+ LH M+GH++A+T L+F   +
Sbjct: 243 LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHK 302

Query: 299 DGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWL 358
           DGIL SGG+DRRV+LWDL +IG EQQ ++ADDG PE+LM+HAGH+SAINDF+  P +PWL
Sbjct: 303 DGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWL 362

Query: 359 SASVEEDNVVQVWKCSKNLS 378
            ASVEE+N+VQ+WK S+ L+
Sbjct: 363 MASVEEENIVQIWKPSRKLT 382

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  444 bits (1141), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 280/380 (73%), Gaps = 11/380 (2%)

Query: 8   EEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEE 67
           E  ++VD+EY+LWK+NVPLMYDFVSET+L WPSLT QWLP ++    Q +ILGTHTSG E
Sbjct: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTE 66

Query: 68  VDYLKVAALDLPDEVVT-----GEANDDNRRT----KSNIKIVKKFEHDGEINRARYMPK 118
            +YLK+A++ LPDEVV+       + DD++ +    +S IKIV+KFEH  E+ RARY P 
Sbjct: 67  QNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPF 126

Query: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           + N+IATI+G G V +YDRSK     L     +HKENGYGL+F+     EL+S SDD +I
Sbjct: 127 NPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSI 186

Query: 179 ALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINT 238
           A+WD+ SG  +P  V D  H++IVN+C WH     LFGSVS+DSTL +HDKR    V+  
Sbjct: 187 AIWDVCSGKNTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKI 245

Query: 239 IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKE 298
           +Q++  +NTLAFSKHS+NLFAAAG D+ + LYD R+   P+H M+GH D++T L+F P +
Sbjct: 246 LQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304

Query: 299 DGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWL 358
           DGIL SG +DRRV++WDL +IGAEQQ ++ADDG PE+LM+HAGH+S +NDF+  P IPWL
Sbjct: 305 DGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWL 364

Query: 359 SASVEEDNVVQVWKCSKNLS 378
            ASVEE+NVVQ+WK SK L+
Sbjct: 365 MASVEEENVVQIWKASKKLT 384

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  429 bits (1102), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 206/382 (53%), Positives = 283/382 (74%), Gaps = 7/382 (1%)

Query: 5   REQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED--TRQYMILGTH 62
           +E+E  L++D+EY+LWK+NVPLMYDFVSET+LTWPSLT +WLP   +   T+Q MI+GTH
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTH 63

Query: 63  TSGEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNI 122
           TS +E +Y+K+A+++LP+EV+    N  +   KSN++I KKF+ + EI R+RYM +D NI
Sbjct: 64  TSDQEPNYVKIASIELPNEVIDPH-NVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNI 122

Query: 123 IATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWD 182
           I+TI+G G VSI+DR+ S  D    T  YHK+NGYGLSFNP    +L+S +DD  IA++D
Sbjct: 123 ISTIDGNGTVSIFDRNSS--DSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180

Query: 183 IDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSED-STLKLHDKRSTSKVINTIQA 241
           I++ S+ P   W +  + I+ND  WHHFD  LFG+VSE+ +TL ++D R+  KV  +I+ 
Sbjct: 181 INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKV-TSIEM 239

Query: 242 KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGI 301
           +  FN+LAFSKHS NLF+AAG D N+YLYD R T K LH M+GHE  +T L+FH   DGI
Sbjct: 240 EQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGI 299

Query: 302 LVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSAS 361
           LVS   DRR+I+WDL EIG+EQ  ++A D +PE++MIHAGHRS++NDF+L+ +IPWL AS
Sbjct: 300 LVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359

Query: 362 VEEDNVVQVWKCSKNLSRVGGT 383
            EE+N++QVWK S  L R+  +
Sbjct: 360 TEEENIIQVWKSSSRLPRISNS 381

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  410 bits (1054), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 277/386 (71%), Gaps = 17/386 (4%)

Query: 5   REQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEE----DTRQYMILG 60
           +E+EEPLT DQEYELWK+NVPL+YDFVSET+L WPSLT +WLP +E        Q ++LG
Sbjct: 14  KEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLG 73

Query: 61  THTSGEEVDYLKVAALDLPDEVVTGEANDD-NRRTKSNIKIVKKFEHDGEINRARYMPKD 119
           THTSGEE +YLK+A + LPD+++  +  D+ ++  KSNI+I+KKF+H+ E+ RA YMP+D
Sbjct: 74  THTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQD 133

Query: 120 SNIIATINGEGNVSIYDRS--KSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFT 177
           S IIATING+G V IYD S  +++S+ + + L +HKENGYGL+FNP    +L+S SDD +
Sbjct: 134 STIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193

Query: 178 IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTS---K 234
           +A W+I    +    +     + I+ND  W+ F++NLFG V+E S L L D R+ +   K
Sbjct: 194 VAYWNI----QKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLK 249

Query: 235 VINT--IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCL 292
           +++   I+  +AFN +AFS HS  L AA+G D+ IYLYD R   +PLH M GHED++T L
Sbjct: 250 IVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL 309

Query: 293 QFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGS-PEILMIHAGHRSAINDFTL 351
            FH   DGI++SGG+D+RV +WDL +IG EQ  DE +DG  PE+LMIHAGHRS INDF++
Sbjct: 310 DFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSM 369

Query: 352 HPTIPWLSASVEEDNVVQVWKCSKNL 377
              + WL AS+EEDN+VQVWK + +L
Sbjct: 370 SNNLNWLCASIEEDNIVQVWKMNNSL 395

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  139 bits (350), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 115/434 (26%), Positives = 198/434 (45%), Gaps = 77/434 (17%)

Query: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MIL 59
           ME +        + Q Y  WK N  L+YD+++     WPSLT Q+ P  ++    + ++L
Sbjct: 1   MEIENSTSISNDLQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHRLLL 60

Query: 60  GTHTSGE----------------EVDYLKVAALDLPDEVVTGEANDDNR---RTKSNIKI 100
            T TS +                 +D+  +   D+ DE+   E   DNR    +K+ I  
Sbjct: 61  STFTSSQIPDDESIYISHISTLNHLDWSSLNNFDM-DEM---EFKPDNRIKFPSKNLITD 116

Query: 101 VKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTL----------- 149
           +     +G+ N+ARYMP++ +II   +  G + I+DR+K R   L TT            
Sbjct: 117 ISITFPEGDCNKARYMPQNPDIIGCASSNGCIYIFDRTK-RGSKLSTTTSARFSSGSKAY 175

Query: 150 --------KYHKENG--------YGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPK-- 191
                   K+  E+G          +++NP    +L+S   +  I LWD      S    
Sbjct: 176 EAKLAKQRKFVIEDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNRE 235

Query: 192 ---SVWDNIHSDI-VNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQA---KAA 244
              ++WD    D+  N+ +W +   ++F +  E++ + + D R    ++N+I+       
Sbjct: 236 INNTIWDTNFDDLGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEG-IVNSIEQGNHNGG 294

Query: 245 FNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVS 304
            N+  F+  +A L A+   +  I L+D R+  KP+  +  H  +I+ +++ P  + ++ S
Sbjct: 295 INSCKFNYENAMLLASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIAS 353

Query: 305 GGA-DRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVE 363
           GG  D  V LWD++    E++P          + IH GH   IND +     PWL  SV 
Sbjct: 354 GGQEDGLVKLWDISN---EEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVG 400

Query: 364 EDNVVQVWKCSKNL 377
            DN +Q+WK +K+L
Sbjct: 401 SDNSIQIWKPAKHL 414

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  136 bits (342), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/404 (26%), Positives = 186/404 (46%), Gaps = 53/404 (13%)

Query: 15  QEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEEV---DYL 71
           + Y  WK N  L YD+++     WPSLT Q  P  +  T ++ IL +  +  +V   + L
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDEHRILLSSFTSSQVPEDESL 82

Query: 72  KVAALDLPDEVVTGEAND----------DNRR---TKSNIKIVKKFEHDGEINRARYMPK 118
            VA L     +     N+          DN     +KS ++ ++     G+ N+ARY P 
Sbjct: 83  YVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKARYCPS 142

Query: 119 DSNIIATINGEGNVSIYDRSK---------SRSDG-------LRTTLKYHKENGYGLSFN 162
           + ++I + +  G++ ++DR+K         S  D        L T+L+ HK     L++N
Sbjct: 143 NPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLAWN 202

Query: 163 PNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIV-----NDCSWHHFDENLFGS 217
                 L +      + +WD++   K+  ++ + +    V     N+ SW    ++L   
Sbjct: 203 WQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLLAY 262

Query: 218 VSEDSTLKLHDKRSTSKVINT---IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQ 274
            SED+ + + D R+  K  ++          NT  F+ H   L  +A     I L+D R 
Sbjct: 263 CSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWDIRN 322

Query: 275 TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI-LWDLAEIGAEQQPDEADDGSP 333
            T+PL  +  H D+I+ LQ++P+E  +L +GG D  ++ +WDL+      QP+       
Sbjct: 323 FTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLS------QPE-----GQ 370

Query: 334 EILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
           E++  H GH   +ND +  P   W+  SV  DN +QVW+ S +L
Sbjct: 371 ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 101 VKKFEHDGEINRARYMPKDSNIIATINGEGN-VSIYDRSKSRSDGLRTTLKYHKENGYGL 159
           +K   H+  I+  ++ P++  ++AT   +G  V I+D S+     L  T   H      +
Sbjct: 327 LKTLLHNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQELIFTHGGHMLGVNDI 386

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPK 191
           S++P+ +  + S ++D +I +W   +    PK
Sbjct: 387 SWDPHDTWMMCSVANDNSIQVWRPSNSLVEPK 418

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  135 bits (341), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/406 (27%), Positives = 183/406 (45%), Gaps = 54/406 (13%)

Query: 13  VDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDT-RQYMILGTHTSGE--EVD 69
           + Q Y  WK N  L+YD+++     WPSLT Q++P  E  T +  ++L + TS +  E +
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPTDKHRLLLSSFTSSQLPEDE 80

Query: 70  YLKVAALDLPDEVVTGEAND----------DNRRTKSNIKIVKKFE---HDGEINRARYM 116
            + ++ L     V     N+          DN+    N  +V+        G+ NRA YM
Sbjct: 81  AVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACYM 140

Query: 117 PKDSNIIATINGEGNVSIYDRSK---SRSDGLRTTLKYHKE-------------NGYGLS 160
           P++ +II  I   G V+I+DR+K   +R   L +   Y  +                 L+
Sbjct: 141 PQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSLA 200

Query: 161 FNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIV------NDCSWHHFDENL 214
           +N   +  + S   +  I +WDI    KS  ++  N    I+      ND SW     ++
Sbjct: 201 WNWQKAGIIASSYSNGLIKVWDITRYQKSQPTI-SNPELRILQDKAGTNDVSWMVHHSSI 259

Query: 215 FGSVSEDSTLKLHDKRSTSKVINTIQAK--AAFNTLAFSKHSANLFAAAGLDTNIYLYDR 272
             +  E +T+ L D R+      T  +      N L F+  +  L  AA  +  I L+D 
Sbjct: 260 LAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWDC 319

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGG-ADRRVILWDLAEIGAEQQPDEADDG 331
           R  +KPL V   H D+++ LQ++P    I+ + G  D  + +WD +     ++P+++   
Sbjct: 320 RAFSKPLSVF-NHGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTS-----REPEDS--- 370

Query: 332 SPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
              +L +H GH   +ND   +   PWL  SV  DN V VWK + NL
Sbjct: 371 ---LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  135 bits (339), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 111/415 (26%), Positives = 191/415 (46%), Gaps = 66/415 (15%)

Query: 10  PLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLP--GSEEDTRQYMILGTHTSG-- 65
           P      Y  WK N  L+Y++++     WPSLT Q+ P   ++ D+ + ++L + TS   
Sbjct: 18  PKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHR-ILLSSFTSSLV 76

Query: 66  --------------EEVDYLKVAALDLPDEVVTGEANDDNRRTKSNI--KIVKKFEHDGE 109
                         + + +  +   DL DE+     N + +    N+  ++V +F  +G+
Sbjct: 77  PEDESLYITRISTLKHLSWASLNNFDL-DEMEFKPDNSNIKLPPKNLTTELVIRFP-NGD 134

Query: 110 INRARYMPKDSNIIATINGEGNVSIYDRSK------SRSDGLRTTLK-----------YH 152
            NRARY+P++ ++IA  + +G+V I+DR+K      SR  G   + +            +
Sbjct: 135 CNRARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQSLN 194

Query: 153 KEN-GYGLSFNPNVSNELISGSDDFTIALWDI------DSGSKSPKSVWDNIHSDIVNDC 205
            EN    + +N      L+    D  +  WDI      D   K+P+  +  +     ND 
Sbjct: 195 GENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNY-KLDESGCNDA 253

Query: 206 SWHHFDENLFGSVSEDSTLKLHDKRSTSKVIN--TIQAKAAFNTLAFSKHSANLFAAAGL 263
            W     +LF + SED+ L L D R  S +I+  T   K   N   F+  ++ L A+   
Sbjct: 254 VWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDS 313

Query: 264 DTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI-LWDLAEIGAE 322
             NI L+D R+   P++++  H  +I+ ++++P    +L S G D  ++ LWD       
Sbjct: 314 IGNICLWDIRKKETPINIL-DHGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA------ 366

Query: 323 QQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                   GS + + IH GH   +ND + +   PWL  SV +DN +Q+WK + NL
Sbjct: 367 --------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  129 bits (324), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 104/405 (25%), Positives = 185/405 (45%), Gaps = 51/405 (12%)

Query: 10  PLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSE-EDTRQYMILGTHTSGE-- 66
           P  + Q Y  WK N  L+Y++++     WPSLT Q++P  +    +  ++L + TS +  
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASDKHRILLSSFTSAQLP 77

Query: 67  --------EVDYLKVAAL----DLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRAR 114
                   E+  +K  A     +   E +  + ++  + +K+  + +K    +G+ NRAR
Sbjct: 78  EDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPEGDCNRAR 137

Query: 115 YMPKDSNIIATINGEGNVSIYDRSK---SRSDGLRTTLKYHKE----------NGYGLSF 161
           YMP++ ++IA+ +  G+V I+DR+K   +R   L  T KY  E              L++
Sbjct: 138 YMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLAW 197

Query: 162 NPNVSNELISGSDDFTIALWDIDSGSKS------PKSVWDNIHSDIVNDCSWHHFDENLF 215
           N   S  L +   D  + +WDI   +K+      P   W  +  +  N+ SW     ++ 
Sbjct: 198 NYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQ-VDKEGANEVSWMVHHSSIL 256

Query: 216 GSVSEDSTLKLHDKRSTSKVINTIQA--KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRR 273
               E + L + D R+ +       +      N + F+  +  L  +A  +  + + D R
Sbjct: 257 AVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDIR 316

Query: 274 QTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGA-DRRVILWDLAEIGAEQQPDEADDGS 332
           Q   P+   + H DA++ +Q++PK   ++ S G  D  V +WDLA+   E  P       
Sbjct: 317 QLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ---EDDP------- 365

Query: 333 PEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
             ++ IH GH   +ND   +   PW+  SV  DN V +WK + N+
Sbjct: 366 --LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANI 408

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  129 bits (324), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 112/419 (26%), Positives = 181/419 (43%), Gaps = 57/419 (13%)

Query: 3   AQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLP--GSEEDTRQYMILG 60
           AQ +   P  + Q Y  WK N  L+YD+++     WPSLT Q+ P   +  DT + +I  
Sbjct: 7   AQEQSTIPNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILISS 66

Query: 61  THTS----GEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEH---------- 106
             +S     E +   K++ L   +       + D    K +  +    +H          
Sbjct: 67  FTSSQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIKFP 126

Query: 107 DGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLR-----------------TTL 149
           +G+ NRARY+P++ ++IA  +  G+V I+DR+K  S  +R                 T  
Sbjct: 127 NGDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVE 186

Query: 150 KYHKENGYGLSFNPNVSNE--LISGSDDFTIALWDIDSGSKSPKSVWD----NIHSDI-- 201
           + H+     +S   N   E  L S      + +WDI     S   V D    NI  D   
Sbjct: 187 ELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHS-NPVLDKPVLNIQFDALG 245

Query: 202 VNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK--AAFNTLAFSKHSANLFA 259
           VND SW    ++LF +  E  TL L D+R   +V    Q +     N+  F+  +  L A
Sbjct: 246 VNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLA 305

Query: 260 AAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGA-DRRVILWDLAE 318
           +A  +  + ++D R   +       H  +I+ ++++P  D I+ + G  D  V LWD++ 
Sbjct: 306 SADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDVS- 364

Query: 319 IGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                      +   E+L +H GH   +ND +      WL  SV  DN +Q+WK + NL
Sbjct: 365 -----------NTDNELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  128 bits (321), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 106/418 (25%), Positives = 185/418 (44%), Gaps = 65/418 (15%)

Query: 10  PLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSGE-- 66
           P+ + + Y  WK N  L+YD+++     WPSLT Q+ P  +  + ++ ++L + TS +  
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFTSSQKP 75

Query: 67  --EVDYL-KVAAL-----------DLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINR 112
             E  Y+ K++ L           D+ DE+     N     +K  +  +  F  +GE NR
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDM-DEMEFKPENSTRFPSKHLVNDISIFFPNGECNR 134

Query: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHK------------------- 153
           ARY+P++ +IIA  + +G + I+DR+K  S  +R +   H                    
Sbjct: 135 ARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMD 194

Query: 154 ------ENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSV---WDNIHSD--IV 202
                      L++N      L+S   +  + +WDI   S     +     +I+SD   V
Sbjct: 195 TSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAV 254

Query: 203 NDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK--AAFNTLAFSKHSANLFAA 260
           ND +W    ++LF + +E + + L D R+  + + + + K     N+  F+  ++ + A+
Sbjct: 255 NDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILAS 314

Query: 261 AGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGA-DRRVILWDLAEI 319
           A  +  + L+D R   K       H  +++ L++ P  D +L + G  D  V LWD +  
Sbjct: 315 ADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDTS-- 372

Query: 320 GAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                         E +  H GH   +ND +     PWL  SV  DN V +WK + NL
Sbjct: 373 ------------CEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNL 418

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  123 bits (309), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 103/402 (25%), Positives = 173/402 (43%), Gaps = 55/402 (13%)

Query: 15  QEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEEV---DYL 71
           Q Y LWK N  L+YD+++     WPSL+ Q+ P  +  +  + +L T  +  ++   + +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSSQLPQDENV 69

Query: 72  KVAALDLPDEVVTGEAND---DNRRTKSN-----------IKIVKKFEHDGEINRARYMP 117
            +A++     V     N+   D    K +           I++   F H G+ NRA Y+P
Sbjct: 70  TIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDCNRATYLP 128

Query: 118 KDSNIIATINGEGNVSIYDRS---KSRSDGLRTTLKYH---KENG------YGLSFNPNV 165
           ++ ++I+T + +G+V I+DR+   KS    LR   +       NG        L +N  +
Sbjct: 129 QNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDWNRQI 188

Query: 166 SNELISGSDDFTIALWDIDSGSK------SPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
              L S   +  + +WDI    K       P + + +  S   ND SW    + L     
Sbjct: 189 EGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLLSIAR 248

Query: 220 EDSTLKLHDKRSTSKVINT---IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT 276
           ED+ + L D R+   +  T       +  N   F+     L A A  D  + L+D R+  
Sbjct: 249 EDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDIRKLH 308

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGA-DRRVILWDLAEIGAEQQPDEADDGSPEI 335
            P+  +   E  ++ L+++P+   +L +GG  D  V LW+            A +G  ++
Sbjct: 309 NPIKTI-NCESPLSALEWNPQLPTVLATGGQEDGLVKLWN------------ASNG--QL 353

Query: 336 LMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
           L  H GH   +ND    P   WL  SV  DN   +WK +  L
Sbjct: 354 LFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  123 bits (309), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 102/411 (24%), Positives = 187/411 (45%), Gaps = 58/411 (14%)

Query: 10  PLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSGE-- 66
           P  + + Y  WK N  L+Y +++     WPSLT Q+ P  +  T  + ++L T TS +  
Sbjct: 13  PDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTFTSSQLP 72

Query: 67  EVDYLKVAALDLPDEVVTGEAN-----------DDNRRTKS---NIKIVKKFEHDGEINR 112
           E + L +A L   + +     N           D++ +  S   N+ I   F  +G+ NR
Sbjct: 73  EDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFP-NGDCNR 131

Query: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYG-------------- 158
           ARY+P++ +++A  +  G++ I++R+K  S  L +  +  +   Y               
Sbjct: 132 ARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNEA 191

Query: 159 --LSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDN-----IHSDIVNDCSWHHFD 211
             +++N   +  L S     +I +WDI   S S  ++ +N        +  N+ +W    
Sbjct: 192 VSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNH 251

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVI----NTIQAKAAFNTLAFSKHSANLFAAAGLDTNI 267
           +++F + SE + L L D R+  +++    N        N+  F+ ++  L A+A     I
Sbjct: 252 DSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGKI 311

Query: 268 YLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI-LWDLAEIGAEQQPD 326
            ++D R+  K       H  +I+ L+++P  + ILV+ G D  ++ +WD A         
Sbjct: 312 NMWDIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWDTA--------- 362

Query: 327 EADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                + + + +H GH   +ND +     PWL +SV  DN + VWK + NL
Sbjct: 363 -----NGQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNL 408

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  123 bits (308), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 186/419 (44%), Gaps = 67/419 (15%)

Query: 10  PLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSGE-- 66
           P+ + + Y  WK N  L+YD+++     WPSLT Q+ P  +    ++ ++L + TS +  
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKP 75

Query: 67  --EVDYL-KVAAL-----------DLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINR 112
             E  Y+ K++ L           D+ DE+     N         +  +  F  +G+ NR
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDM-DEMEFKPENTTRLPPSHLVNDISIFFPNGDCNR 134

Query: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHK------------------- 153
           ARY+P++ +IIA  + +G + I+DR+K  S  +R +   H                    
Sbjct: 135 ARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAMD 194

Query: 154 ------ENGYGLSFNPNVSNELISGSDDFTIALWDIDSGS-KSP--KSVWDNIHSDI--V 202
                      L++N      L+S   +  + +WDI   S ++P   S   +I SD   V
Sbjct: 195 TSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASGV 254

Query: 203 NDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVI--NTIQAKAAFNTLAFSKHSANLFAA 260
           ND +W    ++LF + +E + + L D R+  + +  N        N+  F+  ++ + A+
Sbjct: 255 NDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLAS 314

Query: 261 AGLDTNIYLYD-RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGG-ADRRVILWDLAE 318
           A  +  + L+D R+    P+  M  H  +I+ L+++P    +L + G  D  V LWD A 
Sbjct: 315 ADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVKLWDTAR 373

Query: 319 IGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                          E +  H GH   +ND +     PWL  SV  DN V +WK ++NL
Sbjct: 374 --------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAENL 418

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  121 bits (303), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 102/402 (25%), Positives = 187/402 (46%), Gaps = 45/402 (11%)

Query: 13  VDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPG-SEEDTRQYMILGTHTSGE----- 66
           V Q Y  WK N  L+YD+++     WPSL+ Q+ P  +  + +Q ++L + TS +     
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTNDKQRILLSSFTSQQLPQDE 79

Query: 67  --------EVDYLKVAALDL--PDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYM 116
                    ++++K ++++    DE+     N      K+  + V+    DG+ NR RYM
Sbjct: 80  SIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNRCRYM 139

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKE---NG-------YGLSFNPNVS 166
           P++ +II T +  G+V I+DR+K   + + T  K+  E   NG         L++N  + 
Sbjct: 140 PQNPDIIGTASSNGSVYIFDRTK-HGNKISTGRKFEIECRNNGDDEQDESLSLAWNYQLE 198

Query: 167 NELISGSDDFTIALWDIDSGSKSPK--------SVWDNIHSDIVNDCSWHHFDENLFGSV 218
             L +   +  + +WD+    KS +        SV D   ++ VND SW     ++  S 
Sbjct: 199 GTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMD---ANGVNDVSWMVNHTSILASC 255

Query: 219 SEDSTLKLHDKRSTSKV--INTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT 276
            E + + L D R  +K+  ++        N + F+  +  +         + ++D R   
Sbjct: 256 GESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDFK 315

Query: 277 KPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEI 335
           +P+     G +D I+ +Q++P+   IL +  AD++  L  + +   EQ+   A++    +
Sbjct: 316 EPIKEWEHGDQDPISAIQWNPQIPQILAT--ADQQSGLVKIWDASGEQEDSNAENNM--L 371

Query: 336 LMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
           L +H GH   +ND +     PW   SV  DN + +WK + NL
Sbjct: 372 LFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  121 bits (303), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 102/408 (25%), Positives = 189/408 (46%), Gaps = 59/408 (14%)

Query: 13  VDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPG-SEEDTRQYMILGTHTSG-----E 66
           + + Y  WK N  L+YD+++     WPSL+ Q+    + ++    ++L + TSG     E
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHRILLSSFTSGLMPEQE 82

Query: 67  EVDYLKVAALDLPDEVVTGEANDDNRRTK--SNIKIVKKFEH--------DGEINRARYM 116
            ++ + ++ L           + D    K  +N+K+  K  H        +G+ NRARY+
Sbjct: 83  SINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRARYL 142

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHK--------ENGY---------GL 159
           P++ +IIA  + +G V I++R+K  S  LR T  +          EN            L
Sbjct: 143 PQNQDIIAGASSDGTVYIFNRTKYGS-TLRQTSSFQSYQARFAEPENTVQSVDSNPNEAL 201

Query: 160 SFNPNVSNE--LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIV-----NDCSWHHFDE 212
           S + NV  E  L +   D  I  WD+   S +  ++     S ++     ND +W    +
Sbjct: 202 SIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLHD 261

Query: 213 NLFGSVSEDSTLKLHDKRSTSK--VINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY 270
           +L  +  E + L ++D R + +   I++   +   N   F+  +  + A+A    N++++
Sbjct: 262 SLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNVHIW 321

Query: 271 DRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI-LWDLAEIGAEQQPDEAD 329
           D R++ + +  +  H  +I+ ++++P  D IL + G D  ++ LWD+ +           
Sbjct: 322 DIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD----------- 369

Query: 330 DGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
               E++  H GH   +ND + +   PWL  SV  DN VQ+W+ + NL
Sbjct: 370 ---SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  120 bits (302), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 104/418 (24%), Positives = 183/418 (43%), Gaps = 65/418 (15%)

Query: 10  PLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSGEE- 67
           P  + + Y  WK N  L+Y++++     WPSLT Q+ P  +    ++ ++L + TS ++ 
Sbjct: 16  PPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKP 75

Query: 68  ------------VDYLKVAALDL--PDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRA 113
                       + ++K ++L+    DE+     N      K  +  +  F  +GE NRA
Sbjct: 76  EDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGECNRA 135

Query: 114 RYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHK-------------------- 153
           RY+P++ +IIA  + +G + I+DR+K  S  +R +   H                     
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVETMDA 195

Query: 154 -----ENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSV---WDNIHSD--IVN 203
                     +++N      L+S   +  + +WDI   S     +     +I+SD   VN
Sbjct: 196 SSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGSGVN 255

Query: 204 DCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVI--NTIQAKAAFNTLAFSKHSANLFAAA 261
           D +W    ++LF + +E +T+ L D R+  + +  N        N+  F+  ++ + A+A
Sbjct: 256 DVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSLILASA 315

Query: 262 GLDTNIYLYD-RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGA-DRRVILWDLAEI 319
             +  + L+D R     PL  M  H  +++ L++ P  D +L + G  D  V LWD +  
Sbjct: 316 DSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGLVKLWDTSR- 373

Query: 320 GAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                         E +  H GH   +ND +     PWL  SV  DN V +WK + NL
Sbjct: 374 -------------EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAVNL 418

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  120 bits (301), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 104/406 (25%), Positives = 178/406 (43%), Gaps = 57/406 (14%)

Query: 15  QEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSGE--EVDYL 71
           Q Y  WK N  L+Y++++     WPSLT Q  P  +    ++ ++L + TS +  E + +
Sbjct: 23  QRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLAGDEHRILLSSFTSSQLPEDEAI 82

Query: 72  KVAALDLPDEVVTGEAND----------DNRRTKSNIKIVK----KFEHDGEINRARYMP 117
            VA L     +     N+          DN        IV+    KF   G+ N+ARY P
Sbjct: 83  YVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPA-GDCNKARYCP 141

Query: 118 KDSNIIATINGEGNVSIYDRSKSRSD----------------GLRTTLKYHKENGYGLSF 161
            + ++I++ +  G+V ++DR+K  S                  L T+L+  +     L++
Sbjct: 142 SNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALNLAW 201

Query: 162 NPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIV------NDCSWHHFDENLF 215
           N      L +      + +WD+    K+  ++ D  HS ++      ND SW    ++L 
Sbjct: 202 NWQQQGLLATCYSGGEVCVWDLAKYDKASPTLIDP-HSSLLADPQGSNDISWMVNHDSLL 260

Query: 216 GSVSEDSTLKLHDKRSTSKVINTI---QAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDR 272
               E + L + D R T +   +          N   F+ +   L  +A     I L+D 
Sbjct: 261 AYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGRINLWDI 320

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI-LWDLAEIGAEQQPDEADDG 331
           R  + P+  +  H  +++ LQ++P    IL + G D  ++ +WDL+      QP +    
Sbjct: 321 RDFSSPIRSL-DHHGSVSALQWNPHHPTILATAGQDDGLVKIWDLS------QPVDQ--- 370

Query: 332 SPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
             E+   H GH   +ND +  P  PW+  SV  DN +Q+WK S+NL
Sbjct: 371 --ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNL 414

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 101 VKKFEHDGEINRARYMPKDSNIIATI-NGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGL 159
           ++  +H G ++  ++ P    I+AT    +G V I+D S+     L+ T   H      +
Sbjct: 327 IRSLDHHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQPVDQELKFTHGGHMLGVNDI 386

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPK 191
           S++PN    + S S+D +I LW       +PK
Sbjct: 387 SWDPNDPWMMCSVSNDNSIQLWKPSQNLMTPK 418

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  120 bits (301), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 111/416 (26%), Positives = 188/416 (45%), Gaps = 68/416 (16%)

Query: 10  PLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPG--SEEDTRQYMILGTHTSGE- 66
           P  + Q Y  WK N  L+YD+++     WPSLT Q+     +  DT + ++L   TS + 
Sbjct: 15  PEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDTHR-ILLSAFTSSQL 73

Query: 67  -EVDYLKVAALDLPDEVVTGEANDDNR-----RTKSNIKIVKK---------FEHDGEIN 111
            E + + +A L     +     N+ +      + ++NIK+  K         F  DG+ N
Sbjct: 74  PEDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDISIRFP-DGDCN 132

Query: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTT--LKYHKENGY------------ 157
            ARY+P++ ++IA  +  G++ I+DR+K  S  +R +  LK ++   Y            
Sbjct: 133 IARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGIENVENT 192

Query: 158 ----GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSV---WDNIHSDI--VNDCSWH 208
                +S+N      L S      I LWD+   S S   +     N+  D   VND +WH
Sbjct: 193 NEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDVNWH 252

Query: 209 HFDENLFGSVSEDSTLKLHDKRSTSKVI--NTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
              +++  +  E + + L D R  ++++  N        N+  F+ H  +L  +   +  
Sbjct: 253 PSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDSEGR 312

Query: 267 IYLYDRR----QTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI-LWDLAEIGA 321
           I L+D R    +  K LH    H  +I+ L+++P  + I+ S G D  ++ LWD++    
Sbjct: 313 INLWDLRKLDGEPIKTLH----HGSSISTLEWNPNLETIVASAGQDDGLVKLWDVS---- 364

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                     + E++  H GH   +ND + +    WL  SV  DN VQVWK + NL
Sbjct: 365 ----------TDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNL 410

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 104/415 (25%), Positives = 182/415 (43%), Gaps = 65/415 (15%)

Query: 13  VDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSGEE---- 67
           + + Y  WK N  L+YD+++     WPSLT Q+ P  +    ++ ++L + TS ++    
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILLSSFTSSQKPEDE 78

Query: 68  ---------VDYLKVAALDL--PDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYM 116
                    + ++K A+L+    DE+     N     +K  +  ++ F  +GE NRARY+
Sbjct: 79  TIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRARYL 138

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHK----------------------- 153
           P++ +IIA  + +G + I+DR+K  S  +R +   H                        
Sbjct: 139 PQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTSLV 198

Query: 154 --ENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSV---WDNIHSD--IVNDCS 206
                  L++N      L+S   +  I +WDI   S     +     +I SD   VND +
Sbjct: 199 DINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVNDVT 258

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVI--NTIQAKAAFNTLAFSKHSANLFAAAGLD 264
           W    ++LF + +E + + L D R+  + +  N        N+  F+  ++ + A+A  +
Sbjct: 259 WMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVNSCKFNYKNSLILASADSN 318

Query: 265 TNIYLYD-RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGA-DRRVILWDLAEIGAE 322
             + L+D R     P+  M  H  +++ L++ P  D +L + G  D  V LWD       
Sbjct: 319 GRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTTR---- 373

Query: 323 QQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                      E +  H GH   +ND +     PWL  SV  DN V +WK ++N+
Sbjct: 374 ----------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWKPAENI 418

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  119 bits (299), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 107/408 (26%), Positives = 182/408 (44%), Gaps = 53/408 (12%)

Query: 10  PLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSG--- 65
           P  V   Y  WK N  L+YD+++     WPSLT Q+ P  +    Q+ ++L + TS    
Sbjct: 27  PEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTNDQHRLLLSSFTSSQLP 86

Query: 66  --EEVDYLKVAALD-LP---------DEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRA 113
             E +   +V+ L  LP         DE+     N     +K+ IK +      G+ N A
Sbjct: 87  EDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGDCNGA 146

Query: 114 RYMPKDSNIIATINGEGNVSIYDRSK------SRSDG--------LRTTLKYHKENGYGL 159
           RY+P++ ++IA  +  G++ ++DR+K         DG          ++L+ H+E    L
Sbjct: 147 RYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEEHQE-VVSL 205

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSV-----WDNIHSDIVNDCSWHHFDENL 214
           ++N      L +      + +WD+   S++   +       N      ND SW     ++
Sbjct: 206 AWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNHASI 265

Query: 215 FGSVSEDSTLKLHDKRSTSKVI----NTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY 270
                E +++ + D R+   V+    +T       N+  F+ H+  L  +      + L+
Sbjct: 266 LACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRVNLW 325

Query: 271 DRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGG-ADRRVILWDLAEIGAEQQPDEAD 329
           D R    PL  +  H  +I+  Q++P    IL +   +D  V LWD+A     Q+P E  
Sbjct: 326 DIRDLETPLKSL-DHGSSISKTQWNPNLSTILATADQSDGLVKLWDIA-----QEPGE-- 377

Query: 330 DGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
               E+L +H GH   +ND + +   PWL  SV  DN VQ+W+ ++NL
Sbjct: 378 ----ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  117 bits (293), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 112/440 (25%), Positives = 192/440 (43%), Gaps = 97/440 (22%)

Query: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MIL 59
           +E Q     P  V   Y  WK N  L+YD+++     WPSLT Q+ P  +  + Q+ ++L
Sbjct: 9   IEEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHRLLL 68

Query: 60  GTHTSG-----EEVDYLKVAAL-----------DL------PDEVVTGEANDDNRRTKSN 97
            + TS      E V   K++ L           D+      PD  V  +    N  T+ +
Sbjct: 69  SSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSV--KLPPKNLTTEVS 126

Query: 98  IKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRT---------- 147
           I+       +G+ NR+RY+P++ ++IA  + +G+V I++++K  +  LR+          
Sbjct: 127 IRFP-----NGDCNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARL 181

Query: 148 -------------------TLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK 188
                              +   HKE   G+S++    N            +WD+   S+
Sbjct: 182 FSGSHDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCN------------IWDVKKFSR 229

Query: 189 S-----PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR-STSKVINTI--- 239
           S        +     S+  ND  W    +++F +  E + L L D R +  K +N+I   
Sbjct: 230 SNILISQPELTVTFDSNGCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNY 289

Query: 240 QAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVMAGHEDAITCLQFHPKE 298
           + +   NT  F+  ++ L A+A     I L+D R+   +P+  M  H  +I+ ++++P  
Sbjct: 290 KHEDGINTCKFNPGNSLLVASADTCGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNPNI 348

Query: 299 DGILVSGGA-DRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPW 357
             +  S G  D  V LWD A +G E             + +H GH   +ND +     PW
Sbjct: 349 GVVFASAGQEDGLVKLWD-ASVGKE-------------IFVHGGHMLGVNDISWDMHDPW 394

Query: 358 LSASVEEDNVVQVWKCSKNL 377
           L ASV  DN +Q+W+ +KN+
Sbjct: 395 LMASVSNDNTIQIWRPAKNI 414

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  114 bits (284), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 99/406 (24%), Positives = 178/406 (43%), Gaps = 59/406 (14%)

Query: 15  QEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSG-----EEV 68
           Q Y  WK N  L+YD+++     WPSLT ++ P  +  T  + ++L + TS      E +
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDSHRLLLSSFTSSQLPEDESI 76

Query: 69  DYLKVAAL-----------DLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMP 117
              +++ L           D+ DE+     N      ++    +      G+ NRARY+P
Sbjct: 77  YISRISTLKHLHWSSLNNFDM-DEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRARYLP 135

Query: 118 KDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKE----------------NGYGLSF 161
           ++ ++I+  + +G++ I+DR+K  S   R+T     E                    L +
Sbjct: 136 QNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSLDW 195

Query: 162 NPNVSNELISGSDDFTIALWDI------DSGSKSPKSVWDNIHSDIVNDCSWHHFDENLF 215
           N      L S      + +WDI      +   ++P    D+      ND +W    ++L 
Sbjct: 196 NKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHDSLL 255

Query: 216 GSVSEDSTLKLHDKRSTSKVINTIQA---KAAFNTLAFSKHSANLFAAAGLDTNIYLYDR 272
            +  E +T+ ++D RS S+V + IQ        N+  F+ H+  L A+A     ++++D 
Sbjct: 256 AACGESNTVAIYDTRSKSQV-SKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHMWDI 314

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGIL-VSGGADRRVILWDLAEIGAEQQPDEADDG 331
           R+  +       H  +I+ ++++P    I+ V+G  D  V LWD            A +G
Sbjct: 315 RKLDQDPIQSVSHGSSISTVKWNPNVATIIAVAGQEDGLVKLWD------------ASNG 362

Query: 332 SPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
             +++  H GH   +ND   +   PWL  SV  DN + +W+ S +L
Sbjct: 363 --QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  110 bits (276), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 102/423 (24%), Positives = 186/423 (43%), Gaps = 70/423 (16%)

Query: 17  YELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQY-MILGTHTSGE--EVDYLKV 73
           Y  WK N  L+YD+++     WPSLT Q+ P  + +T  + ++L ++TS +  E + + V
Sbjct: 19  YAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHRILLSSYTSCQLPEDENVYV 78

Query: 74  AALDLPDEVVTGEAND---------DNRRTK-------SNIKIVKKFEHDGEINRARYMP 117
           A++     +     N+          +R TK       +N+ I       G+ NRARYMP
Sbjct: 79  ASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFP---RGDCNRARYMP 135

Query: 118 KDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYG------------------- 158
           ++ ++IA  +  G V +++R+K  +  ++       E  YG                   
Sbjct: 136 QNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARRTPV 195

Query: 159 ------LSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSV----WD--NIHSDIVNDCS 206
                 L++N +    L        + +WD+   +    ++    W+  N  S  VND S
Sbjct: 196 DNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVNDVS 255

Query: 207 WHHFDENLFGSVSEDS-TLKLHDKR---STSKVINTIQAKAAFNTLAFSKHSANLFAAAG 262
           W    +++  +  E S +L L D R   + +K+ N  +++   N   F+  +  L A+  
Sbjct: 256 WMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSE-GINACKFNWENNLLLASTD 314

Query: 263 LDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGG-ADRRVILWDLAEIGA 321
                 L+D R+ +    V   H  +++ L+++P +  +L + G +D  + +WD +    
Sbjct: 315 STGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSL--- 371

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNLSRVG 381
                E +D   + + +H+GH   +ND       PWL  SV  DN V VWK + NL +  
Sbjct: 372 -----EIED---KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANLVQRC 423

Query: 382 GTP 384
            +P
Sbjct: 424 TSP 426

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 82/176 (46%), Gaps = 13/176 (7%)

Query: 161 FNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSE 220
           +NP  +N LIS S D T  +WD+ S +     +    H   V D  +      LF S   
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLI--AHDSEVYDVRFLTQSTQLFASCGG 297

Query: 221 DSTLKLHDKRSTSKV----------INTIQAKAAFNTLAFSKHSANLFAAAGLDTN-IYL 269
           D ++++ D RS +            +N   ++ A   L  S H  N+ A    D+N I +
Sbjct: 298 DGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILI 357

Query: 270 YDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQP 325
            D R    PL ++ GH  ++  +++HP +  +L+SGG D +V+ WDL +  A   P
Sbjct: 358 LDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTASSDP 413

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 83/200 (41%), Gaps = 31/200 (15%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK-AAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D +S++ V   + A  +    + F   S  LFA+ G D 
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDG 299

Query: 266 NIYLYDRRQTTKPLHVMAGHEDAITCL-----QF-------HPKEDGILVSGGADRRVIL 313
           ++ ++D R      H    +E  ++ L     QF        P +  ++ +  AD   IL
Sbjct: 300 SVRVFDLRSLA---HSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKIL 356

Query: 314 WDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVW-- 371
             + ++   + P          LMI  GH +++N    HP    +  S  +D  V  W  
Sbjct: 357 --ILDMRNPESP----------LMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDL 404

Query: 372 -KCSKNLSRVGGTPEIDTKM 390
            KC+ +   V  T + D  M
Sbjct: 405 NKCTASSDPVATTKDDDIAM 424

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 3/94 (3%)

Query: 112 RARYMPKDSNIIATINGEGN-VSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELI 170
           R    P D N++AT   + N + I D     S  +   L+ H  +   + ++P   N L+
Sbjct: 334 RLEPSPHDPNVMATFAADSNKILILDMRNPESPLM--ILEGHSASVNQIKWHPIKRNVLL 391

Query: 171 SGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           SG DD  +  WD++  + S   V      DI  D
Sbjct: 392 SGGDDCQVLYWDLNKCTASSDPVATTKDDDIAMD 425

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 58/141 (41%), Gaps = 24/141 (17%)

Query: 96  SNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGLRTTLKYHKE 154
           SN    +   HD E+   R++ + + + A+  G+G+V ++D RS + S     T+ Y   
Sbjct: 265 SNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHS-----TIIYEPP 319

Query: 155 NGYGLSFNPNVSNELI-----SGSDDFTIALWDIDSGS---------KSPKSVWDNIHSD 200
                  NP+ S   +     S  D   +A +  DS           +SP  + +  HS 
Sbjct: 320 VS---DLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEG-HSA 375

Query: 201 IVNDCSWHHFDENLFGSVSED 221
            VN   WH    N+  S  +D
Sbjct: 376 SVNQIKWHPIKRNVLLSGGDD 396

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 98/402 (24%), Positives = 165/402 (41%), Gaps = 64/402 (15%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQYMIL---GTHTSGEEVDYLKVAALDL 78
           P +Y+ +    + WP LT   +P   GSE       IL    T +S +  + L V AL  
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 79  PDEVVTGEANDDNRRTKSNIKIVKKFEHDG-----EINRARYMPKDSN----IIATINGE 129
             + +  + N+++   +    +    E++        NR +  P  ++    + AT++  
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTATMSEN 233

Query: 130 GNVSIYDR--------------SKSRSDGLRTTLKYHKENGYGLSFNPNV-SNELISGSD 174
           G+V IYD               SKS    + T   +    GYGL ++P + +  L+SG  
Sbjct: 234 GDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLSGDC 293

Query: 175 DFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLH 227
              I         W  D   K P +V +N     + D  W   +  +F +   D  +++ 
Sbjct: 294 SGQIYFTQRHTSRWVTD---KQPFTVSNNKS---IEDIQWSRTESTVFATAGCDGYIRIW 347

Query: 228 DKRSTSKVINTIQAKAA---FNTLAFSKHSANLFAAAGLDTNIYLYDRRQ-------TTK 277
           D RS  K    I  KA+    N +++S     L A+   +    ++D RQ       T +
Sbjct: 348 DTRS-KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQ 406

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEADD 330
           P+     H+ AIT + F+P ++ I+  G  D  V LWDL+      EI  +  +  E  +
Sbjct: 407 PVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQE 466

Query: 331 GSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
             P++L +H   +  + D   H  IP    S   D  + VWK
Sbjct: 467 IPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 96/403 (23%), Positives = 166/403 (41%), Gaps = 65/403 (16%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQYMIL---GTHTSGEEVDYLKVAAL-D 77
           P +Y+ +    + WP LT   +P   G+E       IL    T +S ++ + L V AL +
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 78  LPDEVVTGEANDDNRRTKSNIKIVKKFEHDG-----EINRARYMP----KDSNIIATING 128
           L   ++  +  +D+   +    +    E++        NR +  P        + AT++ 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 233

Query: 129 EGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNPNV-SNELISGS 173
            G+V IYD +              KS    + T   +    GYGL ++P + +  L+SG 
Sbjct: 234 NGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 293

Query: 174 DDFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
               I L       W  D  S +        +++ + D  W   +  +F + + D  +++
Sbjct: 294 CSGQIYLTQRHTSRWVTDKQSFTVS------NNESIEDIQWSRTESTVFATAACDGYIRI 347

Query: 227 HDKRSTSKVINTIQAKAA---FNTLAFSKHSANLFAAAGLDTNIYLYDRRQ-------TT 276
            D RS  K    I  KA+    N +++S     L A+   +    ++D RQ       T 
Sbjct: 348 WDTRS-KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTV 406

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEAD 329
           +P+     H+ AIT + F+P ++ I+  G  D  V LWDL+      EI  +  +  E  
Sbjct: 407 QPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQ 466

Query: 330 DGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           D  P++L +H   +  + D   H  IP    S   D  + VWK
Sbjct: 467 DIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWK 506

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 96/224 (42%), Gaps = 16/224 (7%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H E    +SF+P    + +S SDD  + +W+  +G +  + V    H D V  C WH   
Sbjct: 164 HMECVREISFSP-TDQKFVSCSDDNVLKIWNFSNGQQ--ERVLSGHHWD-VKSCDWHP-K 218

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
             L  S S+D+ +K  D RS S V   +  K    +  F     NL +    D    +YD
Sbjct: 219 MGLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYD 278

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDG 331
            RQ  K L  +    D +T LQ+HP ++ +   G  D  +  +DL++   E QP++    
Sbjct: 279 IRQQAKELFSVRDDVDYMT-LQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPTHN 334

Query: 332 SPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
            P        H   +      P I  + AS  +D  ++ W  S+
Sbjct: 335 IP------YAHEKCVTSLAYSP-IGHIMASASKDRTIRFWTRSR 371

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 105/241 (43%), Gaps = 15/241 (6%)

Query: 80  DEVVTGEANDDNRRTKSNIKIVKKFE--HDGEINRARYMPKDSNIIATINGEGNVSIYDR 137
           D +V+G A+ + +  + N  +VK  +  H   +    + P D   ++  + +  + I++ 
Sbjct: 136 DWMVSGSADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVS-CSDDNVLKIWNF 194

Query: 138 SKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNI 197
           S  + + +   L  H  +     ++P +   ++SGS D  I  WD  SGS    ++    
Sbjct: 195 SNGQQERV---LSGHHWDVKSCDWHPKMG-LIVSGSKDNLIKFWDPRSGS-CVSTMLGFK 249

Query: 198 HSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANL 257
           H+ I     +     NL   +S+D T K++D R  +K + +++    + TL +      +
Sbjct: 250 HTII--STKFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDYMTLQWHPIDETV 307

Query: 258 FAAAGLDTNIYLYD---RRQTTKPLH-VMAGHEDAITCLQFHPKEDGILVSGGADRRVIL 313
           F     D +I  +D     Q  KP H +   HE  +T L + P    I+ S   DR +  
Sbjct: 308 FTVGCYDGSIKHFDLSQENQPNKPTHNIPYAHEKCVTSLAYSPIGH-IMASASKDRTIRF 366

Query: 314 W 314
           W
Sbjct: 367 W 367

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 98/403 (24%), Positives = 167/403 (41%), Gaps = 67/403 (16%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQY-----MILGTHTSGEEVDYLKVAAL 76
           P +Y+ +    + WP L+   +P   GSE   R Y     M   T  S ++ + L V +L
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSER--RNYPQSILMTTATQASKKKENELMVLSL 176

Query: 77  -DLPDEVVTGEANDDNRRTKSNIKIVKKFEHDG---EINRARYMPKDSN----IIATING 128
            +L   ++  E  ++      +++ + + E+       NR +  P  S     + AT++ 
Sbjct: 177 SNLTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSE 236

Query: 129 EGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNPNV-SNELISGS 173
            G V I+D                K     + T   +    GYGL ++P + S  L+SG 
Sbjct: 237 NGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGD 296

Query: 174 DDFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
               I L       W  D   K   SV +N     + D  W   +  +F +   D  +++
Sbjct: 297 CSGQIYLTQRHTSKWVTD---KQAYSVGNN---KSIEDIQWSKTESTVFATAGCDGYIRV 350

Query: 227 HDKRSTSKVINTIQAKAA---FNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT------- 276
            D RS  K    I  KA+    N +++++    L A+   + +  ++D RQ T       
Sbjct: 351 WDTRS-KKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANI 409

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEAD 329
           +P+     H+ AIT + F+P E+ I+  G  D  V LWDL+      EI  + ++  E  
Sbjct: 410 QPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELK 469

Query: 330 DGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           +  P++L +H   +  I D   H  IP    S   D  + +WK
Sbjct: 470 EIPPQLLFVH--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 96/403 (23%), Positives = 163/403 (40%), Gaps = 65/403 (16%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQYMIL---GTHTSGEEVDYLKVAAL-D 77
           P +Y+ +    + WP LT   +P   GSE       IL    T +S ++ + L V AL +
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 78  LPDEVVTGEANDDNRRTKSNIKIVKKFEHDG-----EINRARYMP----KDSNIIATING 128
           L   ++  +   ++        +    E++        NR +  P        + AT++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 129 EGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNPNV-SNELISGS 173
            G+V IY+ +              KS    + T   +    GYGL ++P + +  L+SG 
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 294

Query: 174 DDFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
               I         W  D   K P +V +N     + D  W   +  +F +   D  +++
Sbjct: 295 CSGQIYFTQRHTSRWVTD---KQPFTVSNNKS---IEDIQWSRTESTVFATAGCDGYIRI 348

Query: 227 HDKRSTSKVINTIQAKAA---FNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT------- 276
            D RS  K    I  KA+    N +++S     L A+   +    ++D RQ T       
Sbjct: 349 WDTRS-KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAV 407

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEAD 329
           +P+     H+ AIT + F+P ++ I+  G  D  V LWDL+      EI  +  +  E  
Sbjct: 408 QPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQ 467

Query: 330 DGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           +  P++L +H   +  + D   H  IP    S   D  + VWK
Sbjct: 468 EIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 507

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 97/405 (23%), Positives = 164/405 (40%), Gaps = 68/405 (16%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQY-----MILGTHTSGEEVDYLKVAAL 76
           P +Y+ +    L WP LT   +P   GSE   R Y     M   T  S ++ + L V  L
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSER--RNYPQSILMTTATQASKKKDNELMVLKL 176

Query: 77  D-LPDEVVTGEANDDNRRTKSNIKIVKKFEHDGE-------INRARYMP----KDSNIIA 124
             L   +V  + N DN     +     +   + E        NR R  P    +   + +
Sbjct: 177 SHLTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTS 236

Query: 125 TINGEGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNPNV-SNEL 169
           T++  G V IYD +              K+    L T   +    GYGL ++P + +  L
Sbjct: 237 TMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGAL 296

Query: 170 ISGSDDFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDS 222
           ++G     + L       W  D   K+P +V +N     + D  W   +  +F +   D 
Sbjct: 297 LTGDCSGMVYLTQRHTSKWVTD---KTPFTVGNNKS---IEDIQWSRTESTVFATAGCDG 350

Query: 223 TLKLHDKRSTS--KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK--- 277
            +++ D RS     VI+T+ +    N +++++    L A+        ++D RQ +    
Sbjct: 351 YIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSE 410

Query: 278 ---PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAEQ-QPDE 327
              P+     H+ AIT + F+P ++ I+     D  V LWDL+      EI  ++ +  E
Sbjct: 411 KALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKE 470

Query: 328 ADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            +   P++L +H   +  + D   H  IP    S   D  + VWK
Sbjct: 471 LEQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 60/144 (41%), Gaps = 8/144 (5%)

Query: 232 TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVMAGHEDAIT 290
           T K   T+    +   + +S+  + +FA AG D  I ++D R +  KP+         + 
Sbjct: 317 TDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVN 376

Query: 291 CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFT 350
            + ++ K   +L SG       +WDL +         ++   P  +  +  H+ AI   +
Sbjct: 377 VISWNEKMGYLLASGDDKGTWGIWDLRQFSPN-----SEKALP--VAQYDFHKGAITSIS 429

Query: 351 LHPTIPWLSASVEEDNVVQVWKCS 374
            +P    + A   EDN V +W  S
Sbjct: 430 FNPLDESIVAVASEDNTVTLWDLS 453

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 103/234 (44%), Gaps = 25/234 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRGLDFHP-TQPIFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+     T+K + T+Q    +    F  H      +A  D  I +++  Q  K
Sbjct: 71  AGDDYTIKVWS-LETNKCLYTLQGHLDYVRTVFFHHELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            +  + GH   + C QFHP ED ++VS   D  V +WD++                +I A
Sbjct: 129 EIACLTGHNHFVMCAQFHPNED-LVVSASLDESVRVWDISGLRKKHSAPGTTSMEDQIAA 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
           +    +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S+
Sbjct: 188 QNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMSQ 240

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 103/250 (41%), Gaps = 51/250 (20%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWD-NIHSDIVNDCSWHHFDENLFG 216
           GL F+P      +S  DD+TI +W +++     K ++    H D V    +HH +     
Sbjct: 58  GLDFHPT-QPIFVSAGDDYTIKVWSLETN----KCLYTLQGHLDYVRTVFFHH-ELPWII 111

Query: 217 SVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD----R 272
           S S+D T+++ + ++  K I  +     F   A    + +L  +A LD ++ ++D    R
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPNEDLVVSASLDESVRVWDISGLR 170

Query: 273 RQTTKP-------------------------LHVMAGHEDAITCLQFHPKEDGILVSGGA 307
           ++ + P                           ++ GH   +    FHP    ++VSG  
Sbjct: 171 KKHSAPGTTSMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSD 229

Query: 308 DRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNV 367
           DR+V LW +++  A     E D           GH + ++    HP    L  SV ED  
Sbjct: 230 DRQVKLWRMSQTKAW----EVDTCR--------GHTNNVDCVIFHPH-QNLIISVGEDKT 276

Query: 368 VQVWKCSKNL 377
           +++W   K +
Sbjct: 277 LRIWDLDKRV 286

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 68/144 (47%), Gaps = 11/144 (7%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++SGSDD  + LW + S +K+ +      H++ V DC   H  +NL  SV 
Sbjct: 216 SFHPTLP-LIVSGSDDRQVKLWRM-SQTKAWEVDTCRGHTNNV-DCVIFHPHQNLIISVG 272

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--DRRQTTK 277
           ED TL++ D      V    +    F  +A +  + NLF AA  DT I ++  DR +   
Sbjct: 273 EDKTLRIWDLDKRVPVKQFKREHDRFWLIA-AHPNINLFGAAH-DTGIMVFKLDRERPCS 330

Query: 278 PLH----VMAGHEDAITCLQFHPK 297
            +H    +    E  +    +H +
Sbjct: 331 FIHQNQLIFINKEKQLQIFDYHKR 354

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 96/401 (23%), Positives = 164/401 (40%), Gaps = 62/401 (15%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQYMIL---GTHTSGEEVDYLKVAALDL 78
           P +Y+ +    + WP LT   +P   GSE       IL    T +S ++ + L V AL  
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 79  PDEVVTGEANDDNRRTKSNIKIVKKFEHDG-----EINRARYMP----KDSNIIATINGE 129
             + +  + N++    + +  I    E++        NR +  P        + AT++  
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSEN 233

Query: 130 GNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNPNV-SNELISGSD 174
           G+V IYD +              KS    + T   +    GYGL ++P + +  L+SG  
Sbjct: 234 GDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLLSGDC 293

Query: 175 D----FT---IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLH 227
                FT    + W  D   K P +V +N     + D  W   +  +F +   D  +++ 
Sbjct: 294 SGQVYFTQRHTSRWVTD---KQPFTVSNNKS---IEDIQWSRSESTVFATAGCDGYIRIW 347

Query: 228 DKRSTS--KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT-------KP 278
           D RS      I+   +    N +++S     L A+   +    ++D RQ T       +P
Sbjct: 348 DTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADSVQP 407

Query: 279 LHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEADDG 331
           +     H+ AIT + F+P ++ I+  G  D  V LWDL+      EI  +  +  E  + 
Sbjct: 408 VAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEI 467

Query: 332 SPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            P++L +H   +  + D   H  IP    S   D  + VWK
Sbjct: 468 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 95/400 (23%), Positives = 166/400 (41%), Gaps = 58/400 (14%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEE-DTRQYMILGTHTSGEEVDYLKVAALDLPD 80
           P +YD +    + WP LT   +P   GS+  +  Q +++ T T        ++  L L  
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 81  EVVTGEANDDNRRTKSNIKIVKK----FEHDG-----EINRARYMP-KDSN---IIATIN 127
              T   +DD   +    +   +     E++        NR R  P   SN   + AT++
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTATMS 238

Query: 128 GEGNVSIYD---RSKS-RSDGLRT---------TLKYHKE-NGYGLSFNPNV-SNELISG 172
             G V I+D   +SK+  S G +          T+K H    GY L ++P + +  L++G
Sbjct: 239 ENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGALLTG 298

Query: 173 SDDFTIALWDIDSGS----KSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHD 228
                I L   ++      K P +V +N     V D  W   +  +F S   D  +++ D
Sbjct: 299 DCSGQIYLTQRNTSKWVTDKQPFTVGNNKS---VEDIQWSRTEATVFASCGCDGYVRIWD 355

Query: 229 KRSTS--KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT-------KPL 279
            RS      ++   +    N +++++    L A+   + +  ++D RQ T       +P+
Sbjct: 356 TRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNINNVQPV 415

Query: 280 HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEADDGS 332
                H+ AIT + F+P E+ I+     D  V LWDL+      EI  +  +  E +   
Sbjct: 416 AQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELESIP 475

Query: 333 PEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           P++L +H   +  + D   H  IP    S   D  + +WK
Sbjct: 476 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 103/232 (44%), Gaps = 24/232 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EGHEGPVRGIDFHP-TQPIFAS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +DST+KL     T+K + T      +    F         +A  D  I +++  Q  K
Sbjct: 71  SGDDSTIKLWS-LDTNKCLYTFTGHLDYIRTVFFHKELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAE-------------QQ 324
            L  + GH   + C QFHP ED ++VS   D  V +WD++ +  +             QQ
Sbjct: 129 ELACITGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISALRKKHSAPVDRLEEMMIQQ 187

Query: 325 PDEADDGSPEILM--IHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            +  D G  + ++  I  GH   +N  T HPT+P L  S  +D  V++W+ S
Sbjct: 188 QNLLDSGFGDYVVKFILEGHTRGVNWATFHPTLP-LIVSGSDDRQVKLWRMS 238

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 78/191 (40%), Gaps = 28/191 (14%)

Query: 169 LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHD 228
           ++S S D T+ +WDI +  K   +  D +   ++         +NL  S   D  +K   
Sbjct: 152 VVSASLDETVRVWDISALRKKHSAPVDRLEEMMIQQ-------QNLLDSGFGDYVVKFIL 204

Query: 229 KRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHV--MAGHE 286
           +  T  V          N   F   +  L  +   D  + L+ R   TK   V    GH 
Sbjct: 205 EGHTRGV----------NWATFHP-TLPLIVSGSDDRQVKLW-RMSATKAWEVDTCRGHS 252

Query: 287 DAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD------GSPEILMIHA 340
           + + C+ FHP ++ +++S G D+ + +WDL +    +Q    DD        P I +  A
Sbjct: 253 NNVDCVIFHPHQN-LIISAGEDKTLRVWDLDKRMPVKQFKRDDDRFWLIAAHPHINLFGA 311

Query: 341 GHRSAINDFTL 351
            H S I  F L
Sbjct: 312 AHDSGIMIFKL 322

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 97/226 (42%), Gaps = 14/226 (6%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H +   G+SF+    ++ ++ SDD  + +W+  +G +  +S     H D V  C WH   
Sbjct: 166 HTQCIRGISFS-GTDSKFVTCSDDNILKIWNFSNGQQ--ESTLTGHHWD-VRSCDWHP-T 220

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
             L  S S+D+ +KL D RS   +   +  K    +  F     N+ A    D +  ++D
Sbjct: 221 MGLIASGSKDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFD 280

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDG 331
            RQ  K L V     D ++ L +HP  + I   G  D  +  +DL      Q+P ++  G
Sbjct: 281 IRQNMKELAVYRDESDYMS-LTWHPINESIFTVGCYDGSMKHFDLM-----QEPQDSSSG 334

Query: 332 SPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
                 I   H   I     +P +  + AS  +D  ++ W  S+ L
Sbjct: 335 C--FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRSRPL 377

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 93/402 (23%), Positives = 159/402 (39%), Gaps = 63/402 (15%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP-GSEEDTRQY-----MILGTHTSGEEVDYLKVAAL-D 77
           P +Y+ +    + WP LT   +P G   + R Y     M   T  S ++ + L V  L  
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 78  LPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEI------NRARYMPKDSN---IIATING 128
           L   +V  +A+++                + EI      NR +  P  S+   + AT++ 
Sbjct: 178 LNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATMSE 237

Query: 129 EGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNPNV-SNELISGS 173
            G V I+D                KS    L T   +    GYGL ++P + +  L++G 
Sbjct: 238 NGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLTGD 297

Query: 174 DDFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
               + L       W  D   K P +  +N     + D  W   +  +F +   D  +++
Sbjct: 298 CSGQVYLTQRHTSKWVTD---KQPFTFSNN---KSIEDIQWSRTESTVFATSGCDGYIRI 351

Query: 227 HDKRSTS--KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT-------K 277
            D RS      I+T  +    N +++++    L A+   D    ++D RQ +       +
Sbjct: 352 WDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQ 411

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEADD 330
           P+     H+ AIT + F+P ++ I+     D  V LWDL+      EI  +  +  E   
Sbjct: 412 PVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQ 471

Query: 331 GSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
             P++L +H   +  + D   H  IP    S   D  + VWK
Sbjct: 472 IPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 510

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 92/405 (22%), Positives = 161/405 (39%), Gaps = 70/405 (17%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQY-----MILGTHTSGEEVDYLKVAAL 76
           P +Y+ +    L WP +T   +P   GSE   R Y     M   T  + ++ + L V  L
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSER--RNYPQSILMTTATQAAKKKDNELMVLKL 177

Query: 77  DLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEI------NRARYMPKDSN----IIATI 126
               + +  E  ++     ++         D  +      NR R  P  S+    + AT+
Sbjct: 178 SQLSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEVLTATM 237

Query: 127 NGEGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNPNVSNELI-- 170
           +  G V I+D +              K+    + T   +    GY L ++P + +  +  
Sbjct: 238 SENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGALLT 297

Query: 171 ---SGSDDFT---IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTL 224
              SG   FT    + W  D   K P +V +N     + D  W   +  +F +   D  +
Sbjct: 298 GDCSGQVYFTQRHTSKWVTD---KQPFTVSNNKS---IEDIQWSRTEATVFATAGCDGYI 351

Query: 225 KLHDKRSTS--KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQ------TT 276
           ++ D RS      I+T  +    N +++++    L A+   +    ++D RQ        
Sbjct: 352 RVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENA 411

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAEQQPDEADD 330
           +P+     H+ AIT + FHP ++ I+     D  V LWDL+      EI  +QQ  E  +
Sbjct: 412 QPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEI--KQQTAETKE 469

Query: 331 GS---PEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            +   P++L +H   +  + D   H  IP    S   D  + +WK
Sbjct: 470 LAQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 511

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 102/233 (43%), Gaps = 25/233 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPLVLVALFSS-TIQLWDYRMGTLLHRF---EGHDGPVRGIDFHP-TQPIFAS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D+T+++     T+K + T      +    F  H      +A  D  I +++  Q  K
Sbjct: 71  TGDDATIRIWS-LDTNKCLYTFTGHLDYVRTVFFHHELPWLISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            +  + GH   + C QFHP ED ++VS   D  V +WD++                ++ A
Sbjct: 129 EIACLTGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISGLRKKHSAPGAMSMEDQMIA 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           +Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 QQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 115/306 (37%), Gaps = 81/306 (26%)

Query: 100 IVKKFE-HDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRS--------DGLRTTLK 150
           ++ +FE HDG +    + P    I A+   +  + I+    ++         D +RT   
Sbjct: 45  LLHRFEGHDGPVRGIDFHPTQP-IFASTGDDATIRIWSLDTNKCLYTFTGHLDYVRTVF- 102

Query: 151 YHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNI--------HSDIV 202
           +H E  +           LIS SDD TI +W+           W N         H+  V
Sbjct: 103 FHHELPW-----------LISASDDQTIRIWN-----------WQNRKEIACLTGHNHFV 140

Query: 203 NDCSWHHFDENLFGSVSEDSTLK------LHDKRSTSKVINTIQAKAAFNTL-------- 248
             C+  H  E+L  S S D T++      L  K S    ++      A   L        
Sbjct: 141 M-CAQFHPTEDLVVSASLDETVRVWDISGLRKKHSAPGAMSMEDQMIAQQNLLDGGFGDC 199

Query: 249 ---------------AFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHV--MAGHEDAITC 291
                          A    +  L  + G D  + L+ R  +TK   +    GH + + C
Sbjct: 200 VVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQVKLW-RMSSTKAWEIDSCRGHTNNVDC 258

Query: 292 LQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD------GSPEILMIHAGHRSA 345
           + FHP+++ +++S G D+ + +WDL +    +Q    +D        P I +  A H S 
Sbjct: 259 VIFHPQQN-LIISAGEDKTLRVWDLDKRVPVKQFKRENDRFWLVAAHPTINLFGAAHDSG 317

Query: 346 INDFTL 351
           I  F L
Sbjct: 318 IMIFKL 323

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 58/127 (45%), Gaps = 15/127 (11%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWD----NIHSDIVNDCSWHHFDENLF 215
           SF+P +   ++SG DD  + LW + S        W+      H++ V DC   H  +NL 
Sbjct: 216 SFHPTLP-LIVSGGDDRQVKLWRMSS-----TKAWEIDSCRGHTNNV-DCVIFHPQQNLI 268

Query: 216 GSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--DRR 273
            S  ED TL++ D      V    +    F  +A +  + NLF AA  D+ I ++  DR 
Sbjct: 269 ISAGEDKTLRVWDLDKRVPVKQFKRENDRFWLVA-AHPTINLFGAAH-DSGIMIFKLDRE 326

Query: 274 QTTKPLH 280
           +    +H
Sbjct: 327 RPCSVIH 333

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 105/250 (42%), Gaps = 29/250 (11%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           L T  +       G++F+P+    L++     TI LWD   G+   +      H   V  
Sbjct: 3   LLTKFESKSTRAKGIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHDGPVRG 58

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLD 264
             +H   + LF S  +D T+K+     T+K + T++    +    F         +A  D
Sbjct: 59  IDFHP-TQPLFVSAGDDYTIKVWS-LETNKCLYTLEGHLDYVRTVFFHRELPWIISASDD 116

Query: 265 TNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------- 317
             I +++  Q  K +  + GH   + C QFHP ED ++VS   D  V +WD++       
Sbjct: 117 QTIRIWNW-QNRKEIACITGHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKHS 174

Query: 318 -------------EIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEE 364
                        +I A+Q   +   G   +  I  GH   +N  + HPT+P L  S  +
Sbjct: 175 APGGANIPSTFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLP-LIVSGGD 233

Query: 365 DNVVQVWKCS 374
           D  V++WK S
Sbjct: 234 DRQVKLWKMS 243

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 5/111 (4%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++SG DD  + LW + S +K+ +      H++ V+   +H   +NL  SV 
Sbjct: 220 SFHPTLP-LIVSGGDDRQVKLWKM-SATKAWELDSCRGHTNNVDSVIFHP-TQNLIISVG 276

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY 270
           ED TL++ D      V    +    F  +A +  + NLF AA  D+ I ++
Sbjct: 277 EDKTLRIWDLDKRVPVKQFKRENDRFWLIA-AHPNINLFGAAH-DSGIMIF 325

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 138/324 (42%), Gaps = 62/324 (19%)

Query: 26  LMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEEVDYLKVAALDLPDEVVTG 85
           L +D V+E  + +P    QWLP S +  R++            D L++ +L+  D  +T 
Sbjct: 142 LSWDKVAEHNIIYPVSNIQWLP-SVQQPRKF--------ATSSDSLRIWSLNEEDSSLTE 192

Query: 86  EANDD-----------NRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSI 134
           + N             ++ T S+  I+ +F     +    + P D+N++ + + +    +
Sbjct: 193 QVNLSLCKYNDQHHSLSKNTTSSSDILGQFP---PVTSFHWNPIDTNLLISSSIDTTCIV 249

Query: 135 YDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVW 194
           +D   S  + +RT L  H    + + F  + +    S   D ++ ++D+ S +       
Sbjct: 250 WDLQSS--NYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLRSLA------- 300

Query: 195 DNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHS 254
              HS I+       ++ N              D+  +  + +  ++ +A   L  S   
Sbjct: 301 ---HSTII-------YESN-------------SDQNGSDTLTDNEKSPSALLRLQPSPSD 337

Query: 255 ANLFAAAGLDT-NIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVIL 313
            N+ A   LD+ +I + D R    P+  + GH  A+  +++HPK+  +L+S G D +V+ 
Sbjct: 338 PNVMATFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLY 397

Query: 314 WDLAE------IGAEQQPDEADDG 331
           WDL E      + A +    A+DG
Sbjct: 398 WDLNEWLSPTSLSANENKVNANDG 421

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 76/188 (40%), Gaps = 28/188 (14%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKV-INTIQAKAAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D +S++ V    I   +    + F  HS  LFA+ G D 
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDG 289

Query: 266 NIYLYDRRQTTKPLHVMAGHED---------------AITCLQFHPKEDGILVSGGADRR 310
           ++ ++D R       +   + D               A+  LQ  P +  ++ +   D +
Sbjct: 290 SVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDSK 349

Query: 311 VILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQV 370
            IL            D  + GSP + +   GH +A+N    HP    +  S  +D  V  
Sbjct: 350 SIL----------ILDMRNPGSPVLTL--EGHSAAVNQIKWHPKKSNVLLSCGDDCQVLY 397

Query: 371 WKCSKNLS 378
           W  ++ LS
Sbjct: 398 WDLNEWLS 405

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 100/233 (42%), Gaps = 25/233 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + LF S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRGIDFHP-TQPLFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+     T K + T+     +    F  H      +   D  I +++  Q  K
Sbjct: 71  AGDDYTIKVWS-LETKKCLFTLNGHLDYVRTVFFHHELPWIISCSDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            +  + GH   + C QFHP ED ++VS   D  V +WD++                ++ A
Sbjct: 129 EIACLTGHNHFVMCAQFHPSED-LVVSASLDETVRVWDISGLRKKHSAPGASSFEEQMIA 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           +Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 QQNLLDGGFGECVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKIWRMS 239

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 107/250 (42%), Gaps = 29/250 (11%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           L T  +       G++F+P+    L++     TI LWD   G+   +  +++ H   V  
Sbjct: 3   LLTKFESKSTRAKGIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHR--YED-HEGPVRG 58

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLD 264
             +H   + LF S  +D T+K+     T+K + T+     +    F         +A  D
Sbjct: 59  IDFHP-TQPLFVSAGDDYTIKVWS-LETNKCLYTLDGHLDYVRTVFFHKELPWIISASDD 116

Query: 265 TNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------- 317
             I +++  Q  K +  + GH   + C QFHP ED ++VS   D  V +WD++       
Sbjct: 117 QTIRIWNW-QNRKEIACITGHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKHS 174

Query: 318 -------------EIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEE 364
                        +I A+Q   +   G   +  I  GH   +N  + HPT+P L  S  +
Sbjct: 175 APGRSAMPTSFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLP-LIVSGGD 233

Query: 365 DNVVQVWKCS 374
           D  V++WK S
Sbjct: 234 DRQVKLWKMS 243

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++SG DD  + LW + S +K+ +      H++ V+   +H   +NL  SV 
Sbjct: 220 SFHPTLP-LIVSGGDDRQVKLWKM-SATKAWELDSCRGHTNNVDSVIFHP-TQNLILSVG 276

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--DRRQTTK 277
           ED TL++ D    + V    +    F  +A +  + NLF AA  D+ I ++  DR +   
Sbjct: 277 EDKTLRVWDLDKRTPVKQFKRENDRFWLIA-AHPNINLFGAAH-DSGIMIFKLDRERPPF 334

Query: 278 PLH 280
            +H
Sbjct: 335 AIH 337

>TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7.322
           YDL145C
          Length = 1216

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 101/234 (43%), Gaps = 26/234 (11%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + LF S
Sbjct: 16  GIAFHPSRPWALVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRSVDFHP-TQPLFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+     T+K + T+     +    F  H      +A  D  I +++  Q  K
Sbjct: 71  AGDDCTIKVW-SLETNKCLYTLTGHLDYVRTVFFHHELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA-----------------EIG 320
            +  + GH   + C QFHP ED ++VS   D  V +WD++                 ++ 
Sbjct: 129 EIANLIGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISGLRKKHSAPAQSASFEEQMS 187

Query: 321 AEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            +Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 TQQNILDGGFGDCVVKFILEGHTRGVNWVSFHPTLP-LIVSGSDDRQVKLWRMS 240

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 98/408 (24%), Positives = 164/408 (40%), Gaps = 73/408 (17%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQY-----MILGTHTSGEEVDYLKVAAL 76
           P +Y+ +    + WP +T   +P   GSE   R Y     M   T  S ++ + L V  L
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSER--RNYPQSILMTTATQASKKKDNELMVLKL 179

Query: 77  DLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEI------NRARYMPKDSN------IIA 124
               + +  E N ++   + +   V     +  I      NR +  P  S+      + A
Sbjct: 180 SQLTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQEILTA 239

Query: 125 TINGEGNVSIYDRSKSRSDGLRT--------------TLKYHKE-NGYGLSFNPNV-SNE 168
           T++  G V I+D + S+    +T              T+K H    GY L ++P + +  
Sbjct: 240 TMSENGEVYIFDLA-SQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTGA 298

Query: 169 LISGSDDFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSED 221
           L++G     + L       W  D   K P +V +N     V D  W   +  +F S   D
Sbjct: 299 LLTGDCSGQVYLTQRHTSKWISD---KEPFTVANN---QSVEDIQWSRTESTVFASCGCD 352

Query: 222 STLKLHDKRSTSKVINTIQAKAA---FNTLAFSKHSANLFAAAGLDTNIYLYDRRQ---- 274
             +++ D RS  K    I  KA+    N +++S+    L A+   +    ++D RQ    
Sbjct: 353 GYIRVWDTRS-KKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPS 411

Query: 275 ---TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQ 324
               T P+     H+ AIT + F+P ++ I+     D  V LWDL+      EI  +  +
Sbjct: 412 NSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAE 471

Query: 325 PDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
             E     P++L +H   +  + D   H  IP    S   D  + +WK
Sbjct: 472 TKELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWK 516

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 68/152 (44%), Gaps = 12/152 (7%)

Query: 229 KRSTSKVIN-----TIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVM 282
           +R TSK I+     T+    +   + +S+  + +FA+ G D  I ++D R +  KP   +
Sbjct: 312 QRHTSKWISDKEPFTVANNQSVEDIQWSRTESTVFASCGCDGYIRVWDTRSKKHKPAISV 371

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGH 342
                 +  + +  K   +L SG  +    +WDL +      P  +++ SP  +  +  H
Sbjct: 372 KASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFS----PSNSNNTSP--VAQYDFH 425

Query: 343 RSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           + AI   + +P    + A   EDN V +W  S
Sbjct: 426 KGAITSISFNPLDESIVAVASEDNTVTLWDLS 457

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 102/233 (43%), Gaps = 25/233 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRGIDFHP-TQPIFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D ++K+     T+K + T+     +    F         +A  D  I +++  Q  K
Sbjct: 71  AGDDYSIKVWS-LETNKCLYTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            L  + GH   + C QFHP ED ++VS   D  + +WD+A                ++ +
Sbjct: 129 ELACLTGHNHFVMCAQFHPTED-LVVSASLDETIRVWDIAGLRKRHSAPGASSFEDQMAS 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           +Q   +A  G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 QQNLLDAGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 101/248 (40%), Gaps = 51/248 (20%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWD-NIHSDIVNDCSWHHFDENLFG 216
           G+ F+P      +S  DD++I +W +++     K ++  N H D V    +H  +     
Sbjct: 58  GIDFHPT-QPIFVSAGDDYSIKVWSLETN----KCLYTLNGHLDYVRTVFFHR-ELPWII 111

Query: 217 SVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD----R 272
           S S+D T+++ + ++  K +  +     F   A    + +L  +A LD  I ++D    R
Sbjct: 112 SASDDQTIRIWNWQN-RKELACLTGHNHFVMCAQFHPTEDLVVSASLDETIRVWDIAGLR 170

Query: 273 RQTTKP-------------------------LHVMAGHEDAITCLQFHPKEDGILVSGGA 307
           ++ + P                           ++ GH   +    FHP    ++VSGG 
Sbjct: 171 KRHSAPGASSFEDQMASQQNLLDAGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGD 229

Query: 308 DRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNV 367
           DR+V LW ++   A     E D           GH + ++    HP    L  SV ED  
Sbjct: 230 DRQVKLWRMSSTKAW----EVDTCR--------GHTNNVDSVIFHPHQN-LIISVGEDKT 276

Query: 368 VQVWKCSK 375
           ++VW   K
Sbjct: 277 LRVWDLDK 284

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 56/132 (42%), Gaps = 25/132 (18%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH---------HF 210
           SF+P +   ++SG DD  + LW + S        W+      V+ C  H         H 
Sbjct: 216 SFHPTLP-LIVSGGDDRQVKLWRMSS-----TKAWE------VDTCRGHTNNVDSVIFHP 263

Query: 211 DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY 270
            +NL  SV ED TL++ D    + V    +    F  +A   H  NLF AA  D+ I ++
Sbjct: 264 HQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAH-DSGIMVF 321

Query: 271 --DRRQTTKPLH 280
             DR +     H
Sbjct: 322 KLDRERPCSVTH 333

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 95/412 (23%), Positives = 163/412 (39%), Gaps = 82/412 (19%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQY-----MILGTHTSGEEVDYLKVAAL 76
           P +Y+ +    L WP +T   +P   GSE   R Y     M   T  S ++ + L V +L
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSER--RNYPQSILMTTATQASKKKENELMVLSL 177

Query: 77  DLPDEVVTGEANDDNRRT-------------KSNIKIVKKFEHDGEINRARYMPKDSN-- 121
              ++ +     D++                  NIK+      +   NR +  P  S   
Sbjct: 178 SQLNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKL------NDTTNRLKVSPFASTDK 231

Query: 122 --IIATINGEGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNPNV 165
             + AT++  G V I+D +              K+    + T   +    GY L ++P +
Sbjct: 232 EVLTATMSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMI 291

Query: 166 SNELI-----SGSDDFT---IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
            N  +     SG   FT    + W  D   K P +  +N     V D  W   +  +F S
Sbjct: 292 KNGALLTGDCSGQIYFTQRHTSKWITD---KQPFTAENNKS---VEDIQWSRTESTVFAS 345

Query: 218 VSEDSTLKLHDKRSTS--KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIY-LYDRRQ 274
              D  +++ D RS      ++   +    N +++S+    L A+ G D  ++ ++D RQ
Sbjct: 346 AGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLAS-GDDNGLWGVWDLRQ 404

Query: 275 TT-------KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGA 321
            +       +P+     H+ AIT + F+P +D I+     D  V LWDL+      EI  
Sbjct: 405 FSPDNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQ 464

Query: 322 E-QQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           +  +  E +   P++L +H   +  + D   H  IP    S   D  + +WK
Sbjct: 465 QIAETKELEKIPPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWK 513

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 70/153 (45%), Gaps = 14/153 (9%)

Query: 229 KRSTSKVINTIQAKAAFNT-----LAFSKHSANLFAAAGLDTNIYLYD-RRQTTKP-LHV 281
           +R TSK I   Q   A N      + +S+  + +FA+AG D  I ++D R +  KP L V
Sbjct: 309 QRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSV 368

Query: 282 MAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAG 341
            A + D +  + +  K   +L SG  +    +WDL +      PD  +D  P  +  +  
Sbjct: 369 KASNTD-VNVISWSEKIGYLLASGDDNGLWGVWDLRQFS----PDNINDVQP--VAQYDF 421

Query: 342 HRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           H+ AI     +P    + A   EDN V +W  S
Sbjct: 422 HKGAITSINFNPLDDSIIAVASEDNTVTLWDLS 454

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 101/233 (43%), Gaps = 25/233 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRGLDFHP-TQPIFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+     T+K + T+     +    F         +A  D  I +++  Q  K
Sbjct: 71  AGDDYTIKVWS-LDTNKCLYTLSGHLDYVRTVFFHRELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            +  + GH   + C QFHP +D ++VS   D  + +WD++                ++ A
Sbjct: 129 EIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHSAPGTNSFEEQMNA 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           +Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 QQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++S SDD  + LW + S +K+ +      H++ V+   +H   +NL  SV 
Sbjct: 216 SFHPTLP-LIVSASDDRQVKLWRM-SATKAWEVDTCRGHTNNVDSVIFHP-HQNLIISVG 272

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--DRRQTTK 277
           ED TL++ D    + V    +    F  +A   H  NLF AA  D+ I ++  DR +   
Sbjct: 273 EDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAH-DSGIMVFKLDRERPCS 330

Query: 278 PLH 280
            +H
Sbjct: 331 FIH 333

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 101/233 (43%), Gaps = 25/233 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRGLDFHP-TQPIFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+     T+K + T+     +    F         +A  D  I +++  Q  K
Sbjct: 71  AGDDYTIKVWS-LDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            +  + GH   + C QFHP +D ++VS   D  + +WD++                ++ A
Sbjct: 129 EIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHSAPGTNSFEEQMNA 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           +Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 QQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++S SDD  + LW + S +K+ +      H++ V+   +H   +NL  SV 
Sbjct: 216 SFHPTLP-LIVSASDDRQVKLWRM-SATKAWEVDTCRGHTNNVDSVIFHP-HQNLIISVG 272

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--DRRQTTK 277
           ED TL++ D    + V    +    F  +A   H  NLF AA  D+ I ++  DR +   
Sbjct: 273 EDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAH-DSGIMVFKLDRERPCS 330

Query: 278 PLH 280
            +H
Sbjct: 331 FIH 333

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 101/233 (43%), Gaps = 25/233 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRGLDFHP-TQPIFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+     T+K + T+     +    F         +A  D  I +++  Q  K
Sbjct: 71  AGDDYTIKVWS-LDTNKCLYTLSGHLDYVRTVFFHRELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            +  + GH   + C QFHP +D ++VS   D  + +WD++                ++ A
Sbjct: 129 EIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHSAPSNNSFEEQLNA 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           +Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 QQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++S SDD  + LW + S +K+ +      H++ V+   +H   +NL  SV 
Sbjct: 216 SFHPTLP-LIVSASDDRQVKLWRM-SATKAWEVDTCRGHTNNVDSVIFHP-HQNLIISVG 272

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--DRRQTTK 277
           ED TL++ D    + V    +    F  +A   H  NLF AA  D+ I ++  DR +   
Sbjct: 273 EDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAH-DSGIMVFKLDRERPCS 330

Query: 278 PLH 280
            +H
Sbjct: 331 VIH 333

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 75/169 (44%), Gaps = 15/169 (8%)

Query: 161 FNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSE 220
           +NP  +N LIS S D T  +WD++S +     +    H   V D  +      LF S   
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLI--AHDSEVFDVRFLTQSTQLFASCGG 313

Query: 221 DSTLKLHDKRSTSKVINTIQAKAAFNT------------LAFSKHSANLFAAAGLDTN-I 267
           D ++++ D RS +      +  A  +             L  S H  N+ A    D+N I
Sbjct: 314 DGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKI 373

Query: 268 YLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            + D R    P+  + GH  ++  +++HP E  IL+S   D +V+ WDL
Sbjct: 374 IILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 28/185 (15%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK-AAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D  S++ V   + A  +    + F   S  LFA+ G D 
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 315

Query: 266 NIYLYDRRQTT------KPLHVM-----AGHEDAITCLQFHPKEDGILVSGGAD-RRVIL 313
           ++ ++D R         +P   M     A   +A+  L+  P +  I+ +  AD  ++I+
Sbjct: 316 SVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIII 375

Query: 314 WDLAEIGAEQQPDEADDGSPEI-LMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            D+               +PE  ++   GH S++N    HPT   +  S  +D  V  W 
Sbjct: 376 LDMR--------------NPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWD 421

Query: 373 CSKNL 377
            + +L
Sbjct: 422 LNSSL 426

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 99/236 (41%), Gaps = 31/236 (13%)

Query: 158 GLSFNPN---VSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENL 214
           GL+F+P+   V   L S S    I LWD   G+   K      H   V    +H   + L
Sbjct: 16  GLAFHPSRPWVLVALFSSS----IQLWDYRMGTLLHKF---EDHEGPVRGIDFHP-TQPL 67

Query: 215 FGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQ 274
           F S  +D T+K+     T K + T+     +    F         +A  D  I +++  Q
Sbjct: 68  FVSAGDDYTIKVWS-LDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNW-Q 125

Query: 275 TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------E 318
             K +  + GH   + C  FHP ED ++VS   D  V +WD++                +
Sbjct: 126 NRKEIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQ 184

Query: 319 IGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           I A+Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 185 IAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 101/248 (40%), Gaps = 51/248 (20%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWD-NIHSDIVNDCSWHHFDENLFG 216
           G+ F+P      +S  DD+TI +W +D+     K ++  N H D V    +H  +     
Sbjct: 58  GIDFHPT-QPLFVSAGDDYTIKVWSLDT----KKCLFTLNGHLDYVRTVFFHR-ELPWII 111

Query: 217 SVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD----R 272
           S S+D T+++ + ++  K I  +     F   A    + +L  +A LD  + ++D    R
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWDISGLR 170

Query: 273 RQTTKP-------------------------LHVMAGHEDAITCLQFHPKEDGILVSGGA 307
           ++ + P                           ++ GH   +    FHP    ++VSGG 
Sbjct: 171 KRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLP-LIVSGGD 229

Query: 308 DRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNV 367
           DR+V LW ++   A     E D           GH + ++    HP    L  SV ED  
Sbjct: 230 DRQVKLWRMSSTKAW----EVDTCR--------GHTNNVDSVIFHPH-QNLIISVGEDKT 276

Query: 368 VQVWKCSK 375
           V+VW   K
Sbjct: 277 VRVWDLDK 284

>KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1209

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 99/236 (41%), Gaps = 31/236 (13%)

Query: 158 GLSFNPN---VSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENL 214
           GL+F+P+   V   L S S    I LWD   G+   K      H   V    +H   + L
Sbjct: 16  GLAFHPSRPWVLVALFSSS----IQLWDYRMGTLLHKF---EDHEGPVRGIDFHP-TQPL 67

Query: 215 FGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQ 274
           F S  +D T+K+     T K + T+     +    F         +A  D  I +++  Q
Sbjct: 68  FVSAGDDYTIKVWS-LDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNW-Q 125

Query: 275 TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------E 318
             K +  + GH   + C  FHP ED ++VS   D  V +WD++                +
Sbjct: 126 NRKEIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQ 184

Query: 319 IGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           I A+Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 185 IAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 101/248 (40%), Gaps = 51/248 (20%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWD-NIHSDIVNDCSWHHFDENLFG 216
           G+ F+P      +S  DD+TI +W +D+     K ++  N H D V    +H  +     
Sbjct: 58  GIDFHPT-QPLFVSAGDDYTIKVWSLDT----KKCLFTLNGHLDYVRTVFFHR-ELPWII 111

Query: 217 SVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD----R 272
           S S+D T+++ + ++  K I  +     F   A    + +L  +A LD  + ++D    R
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWDISGLR 170

Query: 273 RQTTKP-------------------------LHVMAGHEDAITCLQFHPKEDGILVSGGA 307
           ++ + P                           ++ GH   +    FHP    ++VSGG 
Sbjct: 171 KRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLP-LIVSGGD 229

Query: 308 DRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNV 367
           DR+V LW ++   A     E D           GH + ++    HP    L  SV ED  
Sbjct: 230 DRQVKLWRMSSTKAW----EVDTCR--------GHTNNVDSVIFHPH-QNLIISVGEDKT 276

Query: 368 VQVWKCSK 375
           ++VW   K
Sbjct: 277 IRVWDLDK 284

>KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1212

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 102/233 (43%), Gaps = 25/233 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G    +      H   V    +H   + LF S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGVLLHRF---EDHEGPVRGIDFHP-TQPLFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+    S +K + T+     +    F  H      ++  D  I +++  Q  K
Sbjct: 71  AGDDYTIKVWSLES-NKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA--------------EIGAEQ 323
            +  + GH   + C QFHP ED ++VS   D  V +WD++              E    Q
Sbjct: 129 EIACLTGHNHFVMCAQFHPVED-LVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQ 187

Query: 324 QPDEADDGSPEILM--IHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           Q +  D G  + ++  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 QQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMS 239

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD------GSPEILM 337
           GH + +  + FHP+++ +++S G D+ V +WDL +    +Q    +D        P + +
Sbjct: 251 GHTNNVDSVIFHPQQN-LIISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNL 309

Query: 338 IHAGHRSAINDFTL 351
             A H S I  F L
Sbjct: 310 FGAAHDSGIMIFKL 323

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 59/119 (49%), Gaps = 5/119 (4%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++SGSDD  + LW + S +K+ +      H++ V+   +H   +NL  SV 
Sbjct: 216 SFHPTLP-LIVSGSDDRQVKLWRM-SATKAWEVDTCRGHTNNVDSVIFHP-QQNLIISVG 272

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKP 278
           ED T+++ D    + +    +    F  L  +  + NLF AA  D+ I ++   +   P
Sbjct: 273 EDKTVRVWDLDKRTPIKQFKRENDRF-WLVRAHPNLNLFGAAH-DSGIMIFKLDRERPP 329

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 101/233 (43%), Gaps = 25/233 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRGLDFHP-TQPIFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+     T+K + T+     +    F         +A  D  I +++  Q  K
Sbjct: 71  AGDDYTIKVWS-LDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            +  + GH   + C QFHP +D ++VS   D  + +WD++                ++ A
Sbjct: 129 EIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSA 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           +Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 188 QQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMS 239

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++SGSDD  + LW + S +K+ +      H++ V+   +H   +NL  SV 
Sbjct: 216 SFHPTLP-LIVSGSDDRQVKLWRM-SATKAWEVDTCRGHTNNVDSVIFHP-HQNLIISVG 272

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--DRRQTTK 277
           ED TL++ D    + V    +    F  +A   H  NLF AA  D+ I ++  DR +   
Sbjct: 273 EDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAH-DSGIMVFKLDRERPCS 330

Query: 278 PLH 280
            +H
Sbjct: 331 FIH 333

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 98/406 (24%), Positives = 165/406 (40%), Gaps = 68/406 (16%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEE-DTRQYMILGTHTSGEEVDYLKVAALDLPD 80
           P +Y+ +    + WP +T   +P   GSE  +  Q +++ T T        ++  L L +
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 81  EVVT---------GEANDDNRRTKSNIKIVKK--FEHDGEINRARYMP----KDSNIIAT 125
            V T          E  D+      +  I++          NR +  P    K+  + AT
Sbjct: 172 LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAAT 231

Query: 126 INGEGNVSIYD---RSKSRSD-GLRT---------TLKYHKE-NGYGLSFNPNVSNELI- 170
           ++  G V I+D   +SK+ S  G +          T+K H    GY L ++P      + 
Sbjct: 232 MSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGALL 291

Query: 171 ----SGSDDFT---IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
               SG   FT    + W  D   K P +V +N     + D  W   +  +F S   D  
Sbjct: 292 TGDCSGQIYFTQRHTSKWITD---KQPFTVANN---QSIEDIQWSRTESTVFASAGCDGY 345

Query: 224 LKLHDKRSTSKVINTIQAKAA---FNTLAFSKHSANLFAAAGLDTNIYLYDRRQ------ 274
           +++ D RS  K    I  KA+    N +++S+    L A+   +    ++D RQ      
Sbjct: 346 IRIWDTRS-KKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENA 404

Query: 275 -TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPD 326
            + +P+     H+ AIT + F+P ++ I+  G  D  V LWDL+      EI  +  +  
Sbjct: 405 GSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETK 464

Query: 327 EADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           E     P++L +H   +  + D   H  IP    S   D  + +WK
Sbjct: 465 ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 507

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 95/213 (44%), Gaps = 10/213 (4%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNV 165
           HD  +   +Y     + + + + +GN+ I+  + +    L      H E    +SFN N 
Sbjct: 122 HDSAVTTMKY-SNAGDWMVSGDTDGNIKIWQPNFNMVKELENA---HTECIRDISFN-NA 176

Query: 166 SNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLK 225
            ++ ++ SDD  + +W+  +G +  + V    H D V  C WH     L  S S+D+ +K
Sbjct: 177 DSKFVTCSDDNILKIWNFSNGQQ--ERVLSGHHWD-VKSCDWHP-TMGLIASASKDNLIK 232

Query: 226 LHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
           L D RS + V   ++ K       F     NL  A   D +  ++D R + K L V+   
Sbjct: 233 LWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVFDIRHSMKELMVVRDE 292

Query: 286 EDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
            D +T L +HP  + +   G  D  +  +D+ +
Sbjct: 293 VDYMTLL-WHPINESVFTVGNYDGSLKHFDILQ 324

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 133/322 (41%), Gaps = 58/322 (18%)

Query: 26  LMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEEVDYLKVAALD---LPDEV 82
           L ++ V+E  +T+P    QWLP S  + R+       TS E    L++ +LD   + +  
Sbjct: 194 LTWEKVAECNVTYPVSNIQWLP-SVPNPRKLA-----TSSE---CLRIWSLDDNSMDNSS 244

Query: 83  VTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRS 142
           V      +N R  +     K       ++  +Y  +       IN   N S+ ++S +R 
Sbjct: 245 VFNNNISNNSRHNT---YKKSLTEQVNLSLCKYNEQH----QIINNSTN-SVSNKSNARL 296

Query: 143 DG-LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDI 201
            G L     +H        +N   +N LIS S D T  +WD+ S +     +    H   
Sbjct: 297 LGQLPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDLQSSNYVKTQLI--AHDSE 346

Query: 202 VNDCSWHHFDENLFGSVSEDSTLKLHDKRST--SKVI----NTIQAKAAFNT-------- 247
           V D  +      LF S   D ++++ D R+   S +I    N +Q    FN         
Sbjct: 347 VFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNNTFNNDVTTKIDN 406

Query: 248 ------------LAFSKHSANLFAAAGLDTN-IYLYDRRQTTKPLHVMAGHEDAITCLQF 294
                       L  S    NL A  GLD   I + D R    P+ V++GH  ++  +++
Sbjct: 407 SSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLVLSGHSPSVNQIKW 466

Query: 295 HPKEDGILVSGGADRRVILWDL 316
           HP +  +L+S G D +V+ WDL
Sbjct: 467 HPSKPYVLLSCGDDCQVLYWDL 488

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 78/176 (44%), Gaps = 22/176 (12%)

Query: 198 HSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANL 257
           HS  V   S+   DE L  S SED T++L   +    +++    +     + FS    NL
Sbjct: 573 HSGTVYSTSFSAGDEYLL-SASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNL 631

Query: 258 FAAAGLDTNIYLY--DRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
           FA A  D    L+  DR     PL VMAGH + + C+ FH     I  +G +D+ V +WD
Sbjct: 632 FATASNDQTARLWSCDR---VYPLRVMAGHLNDVDCVSFHSNGRYIF-TGSSDKTVRMWD 687

Query: 316 LAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
           +               + + + +  GH S +   ++ P   W+S    +D ++ +W
Sbjct: 688 I--------------NTGDSVRLFMGHNSTVTSLSVSPDGKWISTG-SDDGIITIW 728

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 8/170 (4%)

Query: 148 TLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSW 207
           + K H++  + + F+P+ +N   + S+D T  LW  D     P  V     +D+  DC  
Sbjct: 611 SYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDR--VYPLRVMAGHLNDV--DCVS 666

Query: 208 HHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNI 267
            H +     + S D T+++ D  +   V   +   +   +L+ S      + + G D  I
Sbjct: 667 FHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGK--WISTGSDDGI 724

Query: 268 YLYDRRQTTKPLHVMAGH-EDAITCLQFHPKEDGILVSGGADRRVILWDL 316
                  + + L  M GH + +I  L ++P E  +LVSGGAD+ V +WDL
Sbjct: 725 ITIWDIGSGRKLKNMRGHGKSSIHSLSYNP-EGTLLVSGGADQSVRVWDL 773

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNV 165
           H+  +      P D   I+T + +G ++I+D    R   L+    + K + + LS+NP  
Sbjct: 700 HNSTVTSLSVSP-DGKWISTGSDDGIITIWDIGSGRK--LKNMRGHGKSSIHSLSYNPE- 755

Query: 166 SNELISGSDDFTIALWDIDSGSKSP 190
              L+SG  D ++ +WD++ G+  P
Sbjct: 756 GTLLVSGGADQSVRVWDLNKGTFEP 780

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 34/92 (36%), Gaps = 15/92 (16%)

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GH   +    F    D  L+S   D+ V LW +             D  P  L+ + GH 
Sbjct: 572 GHSGTVYSTSFSAG-DEYLLSASEDKTVRLWSV------------QDDKP--LVSYKGHE 616

Query: 344 SAINDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
             + D    P+   L A+   D   ++W C +
Sbjct: 617 KPVWDVEFSPSCNNLFATASNDQTARLWSCDR 648

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 105/206 (50%), Gaps = 20/206 (9%)

Query: 130 GNVSIYD---RSKS-RSDGLRTTLKYHKENGYGLSFNPNVSNELISGSD-DFTIALWDID 184
           GN+ +++   +S++ +S G  +    HK +   L FN   SN L+SGSD +  I +WD++
Sbjct: 84  GNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDLN 143

Query: 185 SGSKSPKSV-WDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVI-----NT 238
           +  K+P +       ++ +   +W+    ++F   S  S + + D ++  +VI     N 
Sbjct: 144 NLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYTNP 203

Query: 239 IQ-AKAAFNTLAFSKHSANLFAAAGLDTN------IYLYDRRQTTKPLHVMA--GHEDAI 289
           +   K+ F+ + +   ++   A A L+ +      I+++D R +  PL +++  GH + I
Sbjct: 204 VNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSNGI 263

Query: 290 TCLQFHPKEDGILVSGGADRRVILWD 315
             L +   ++ +L+S G D  V+LW+
Sbjct: 264 LSLDWCSTDENLLLSSGRDNSVMLWN 289

>KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672)
           [2658 bp, 885 aa] {ON} Anc_6.239 YGL137W
          Length = 885

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N +I GSDDF I +++ ++G    K V    H D +   + H     +  S S+D T+KL
Sbjct: 68  NWIIVGSDDFRIRVFNYNTGE---KVVDFEAHPDYIRSIAVHPTKPYVL-SGSDDLTIKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +      +  T +    F   +AF+    N FA+  LD  + ++   Q+T    +  G 
Sbjct: 124 WNWEKNWNLEQTFEGHEHFVMCVAFNPKDPNTFASGCLDRTVKVWSLGQSTPNFTMNTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   LV+   D  V +WD                +   +    GH S
Sbjct: 184 ERGVNYVDYYPLPDKPYLVTSSDDLTVKIWDYQ--------------TKSCVATLEGHMS 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  +++W  S
Sbjct: 230 NVSFAVFHPTLP-IIISGSEDGTLKIWNSS 258

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 68/157 (43%), Gaps = 6/157 (3%)

Query: 169 LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHD 228
           ++SGSDD TI LW+ +      ++     H   V   +++  D N F S   D T+K+  
Sbjct: 112 VLSGSDDLTIKLWNWEKNWNLEQTF--EGHEHFVMCVAFNPKDPNTFASGCLDRTVKVWS 169

Query: 229 --KRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHE 286
             + + +  +NT Q +       +          +  D  + ++D  QT   +  + GH 
Sbjct: 170 LGQSTPNFTMNTGQERGVNYVDYYPLPDKPYLVTSSDDLTVKIWD-YQTKSCVATLEGHM 228

Query: 287 DAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQ 323
             ++   FHP    I++SG  D  + +W+ +    E+
Sbjct: 229 SNVSFAVFHPTLP-IIISGSEDGTLKIWNSSTYKVEK 264

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 70/174 (40%), Gaps = 5/174 (2%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           L  T + H+     ++FNP   N   SG  D T+ +W +  G  +P    +      VN 
Sbjct: 132 LEQTFEGHEHFVMCVAFNPKDPNTFASGCLDRTVKVWSL--GQSTPNFTMNTGQERGVNY 189

Query: 205 CSWHHF-DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGL 263
             ++   D+    + S+D T+K+ D ++ S  + T++   +  + A    +  +  +   
Sbjct: 190 VDYYPLPDKPYLVTSSDDLTVKIWDYQTKS-CVATLEGHMSNVSFAVFHPTLPIIISGSE 248

Query: 264 DTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA 317
           D  + +++         +  G E +  C+  HP      ++ G D    +  L 
Sbjct: 249 DGTLKIWNSSTYKVEKTLNLGLERS-WCIATHPTGRKNYIASGFDNGFTILSLG 301

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 100/231 (43%), Gaps = 25/231 (10%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G++F+P+    L++     TI LWD   G+   +      H   V    +H   + +F S
Sbjct: 16  GIAFHPSRPWVLVALFSS-TIQLWDYRMGTLLHRF---EDHEGPVRSVDFHP-TQPIFVS 70

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
             +D T+K+     T+K + T+     +    F         +A  D  I +++  Q  K
Sbjct: 71  GGDDYTIKVWS-LETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNW-QNRK 128

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------------EIGA 321
            +  + GH   + C QFHP +D ++VS   D  + +WD++                ++ A
Sbjct: 129 EIACLTGHNHFVMCAQFHPTDD-LVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAA 187

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           +Q   +   G   +  I  GH   +N  + HPT+P +  S  +D  V++WK
Sbjct: 188 QQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMI-VSGSDDRQVKLWK 237

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 7/74 (9%)

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDL-AEIGAEQQPDEADD-----GSPEILM 337
           GH + + C+ FHP +  IL S G D+ + +WDL   I  +Q   E D        P I +
Sbjct: 251 GHTNNVDCVIFHPTQKFIL-SVGEDKTLRIWDLDKRIPVKQFKRENDRFWLIASHPNINL 309

Query: 338 IHAGHRSAINDFTL 351
             A H + I  F L
Sbjct: 310 FGAAHDAGIMVFKL 323

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 64/144 (44%), Gaps = 11/144 (7%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++SGSDD  + LW  +S +K+ +      H++ V DC   H  +    SV 
Sbjct: 216 SFHPTLPM-IVSGSDDRQVKLWKYNS-TKAWEVDTCRGHTNNV-DCVIFHPTQKFILSVG 272

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--DRRQTTK 277
           ED TL++ D      V    +    F  +A S  + NLF AA  D  I ++  DR +   
Sbjct: 273 EDKTLRIWDLDKRIPVKQFKRENDRFWLIA-SHPNINLFGAAH-DAGIMVFKLDRERPCN 330

Query: 278 PLH----VMAGHEDAITCLQFHPK 297
            ++    +    E  +    F  K
Sbjct: 331 VIYQNQLIFVNKEKHVQMFDFQKK 354

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 93/402 (23%), Positives = 164/402 (40%), Gaps = 63/402 (15%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEE-DTRQYMILGTHTSGE-----EVDYLKVAA 75
           P +Y+ +    L WP L+   +P   GSE  +  Q ++L T T        E+  LK++ 
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 76  LD---LPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDS----NIIATING 128
           L    + D+    E +DD    +  I   +        NR +  P  S     + AT++ 
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMSE 245

Query: 129 EGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNP-NVSNELISGS 173
            G V I+D                K+    + T   +    GY L ++P N S  L++G 
Sbjct: 246 NGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTGD 305

Query: 174 DDFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
               + L       W  D      K+ +   ++  + D  +   +  +F S   D  +++
Sbjct: 306 CSGRVYLTQRHTSKWITD------KTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRI 359

Query: 227 HDKRSTS-KVINTIQAKAA-FNTLAFSKHSANLFAAAGLDTNIYLYDRRQ-------TTK 277
            D RS   K   +++A A   N +++++    L A+   + +  ++D RQ       +T 
Sbjct: 360 WDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTS 419

Query: 278 PLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEADD 330
           P+     H+ AIT + F+P +D I+     D  V LWDL+      EI  +  +  E  +
Sbjct: 420 PVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQE 479

Query: 331 GSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
             P++L +H   +  + D   H  IP    S   D  + +WK
Sbjct: 480 IPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 518

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 68/152 (44%), Gaps = 12/152 (7%)

Query: 229 KRSTSKVINTIQAKAAFNT-----LAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVM 282
           +R TSK I    A +A N      + FS+  A +FA+ G D  I ++D R +  KP   +
Sbjct: 314 QRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISV 373

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGH 342
                 +  + ++ K   +L SG  +    +WDL +      P+ A   SP  +  +  H
Sbjct: 374 KASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFS----PNTAASTSP--VAQYNFH 427

Query: 343 RSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           + AI   + +P    + A   EDN V +W  S
Sbjct: 428 KGAITSISFNPLDDSIIAVASEDNTVSLWDLS 459

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 77/165 (46%), Gaps = 16/165 (9%)

Query: 166 SNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLK 225
           +N LIS S D T  +WD+ S +     +    H   V D  +      LF S   D +++
Sbjct: 293 TNLLISSSIDTTCIVWDLQSSNYVKTQLI--AHDSEVYDVRFLTKSTQLFASCGGDGSVR 350

Query: 226 LHDKRS-----------TSKVINT--IQAKAAFNTLAFSKHSANLFAAAGLDTN-IYLYD 271
           + D RS           T+ V N    Q + A   L  S   AN+ A    ++N I + D
Sbjct: 351 VFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILD 410

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            R +  P+ V+ GH+ AI  +++HP +  IL+S   D +V+ WDL
Sbjct: 411 MRNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 76/175 (43%), Gaps = 5/175 (2%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK-AAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D +S++ V   + A  +    + F   S  LFA+ G D 
Sbjct: 288 WNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDG 347

Query: 266 NIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILV--SGGADRRVILWDLAEIGAEQ 323
           ++ ++D R       +     + ++      +++ +L       D  VI   ++E     
Sbjct: 348 SVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKIL 407

Query: 324 QPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNLS 378
             D  +  SP  +++  GH+SAIN    HPT  ++  S  +D  V  W  +   S
Sbjct: 408 ILDMRNSESP--VLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNSTFS 460

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 17/150 (11%)

Query: 96  SNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGLR-------T 147
           SN    +   HD E+   R++ K + + A+  G+G+V ++D RS + S  +        +
Sbjct: 313 SNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVS 372

Query: 148 TLKYHKENGYGLSFNP-----NVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIV 202
                ++    L   P     NV    +S S+   I + D+   S+SP  V +  H   +
Sbjct: 373 NADLSQQQNALLRLEPSPTDANVIATFVSESNK--ILILDM-RNSESPVLVLEG-HKSAI 428

Query: 203 NDCSWHHFDENLFGSVSEDSTLKLHDKRST 232
           N   WH     +  S S+D  +   D  ST
Sbjct: 429 NQIKWHPTKRYILLSCSDDCQVLYWDLNST 458

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 79/167 (47%), Gaps = 9/167 (5%)

Query: 151 YHKENGY-GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHH 209
           +H E+ + G+  + + SN +  G++   I LWD           W    +D V+   ++ 
Sbjct: 171 FHGEHAFLGIDHHRSNSNFVTGGAE---INLWDSTRSRPITNLSWG---ADNVSTVKFNQ 224

Query: 210 FDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYL 269
            + ++F S   D+++ L+D R+ S     +Q K   N L ++   A  F  A  D N Y 
Sbjct: 225 NETDIFASAGSDNSVVLYDLRTNSPTQKFVQ-KMRTNALCWNPMEAYNFVVANEDHNAYY 283

Query: 270 YDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           YD R  ++ LHV   H  A+  + F P  D I V+G  D+ + ++ +
Sbjct: 284 YDMRNLSRALHVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIYQV 329

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 84/184 (45%), Gaps = 24/184 (13%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSW-H 208
           H++  Y ++ N +V N+L + S D  +  W++ +  +  S K+ +  IH   V       
Sbjct: 66  HRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTPQHLSQ 125

Query: 209 HFDENLFGSVSEDSTLKLHDK---------------RSTSKVINTIQAKAAFNTLAFSKH 253
           + +EN   S  +D T+KL                  +S + +I T   + AF  L    H
Sbjct: 126 NKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGEHAF--LGIDHH 183

Query: 254 SANL-FAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI 312
            +N  F   G + N++   R   ++P+  ++   D ++ ++F+  E  I  S G+D  V+
Sbjct: 184 RSNSNFVTGGAEINLWDSTR---SRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVV 240

Query: 313 LWDL 316
           L+DL
Sbjct: 241 LYDL 244

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 52/115 (45%), Gaps = 7/115 (6%)

Query: 126 INGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDS 185
           + G   ++++D ++SR     T L +  +N   + FN N ++   S   D ++ L+D+ +
Sbjct: 190 VTGGAEINLWDSTRSRPI---TNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRT 246

Query: 186 GSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ 240
            S + K V         N   W+  +   F   +ED     +D R+ S+ ++  +
Sbjct: 247 NSPTQKFV----QKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFK 297

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 85/221 (38%), Gaps = 23/221 (10%)

Query: 161 FNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSE 220
           +NP   N LIS S D T  +WD+ S +     +    H   V D  +      LF S   
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQSANYIKTQL--IAHDSEVFDVRFLTQSTQLFASCGG 275

Query: 221 DSTLKLHDKRSTSKV--------------INTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
           D ++++ D R  +                + +     A   L  S    N+ A   +D++
Sbjct: 276 DGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSS 335

Query: 267 -IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL-AEIGAEQQ 324
            + + D R    PL  +  H   I  +++HP    +L+S   D +V+ WDL   + +E  
Sbjct: 336 KVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSEST 395

Query: 325 PDEADDGSPE-----ILMIHAGHRSAINDFTLHPTIPWLSA 360
            D   D  P+       M +A     +N+    P   W  A
Sbjct: 396 KDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 20/138 (14%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGLRTTLKYHK--ENGYGLSFN 162
           HD E+   R++ + + + A+  G+G+V ++D R  + S     T+ Y     +G     +
Sbjct: 253 HDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHS-----TIIYEPTIPDGAPDLPS 307

Query: 163 PNVSNELI----SGSDDFTIALWDIDSGS------KSPKSVWDNI--HSDIVNDCSWHHF 210
           P V   L+    S  D   IA + IDS        +SP S    +  H+  +N   WH  
Sbjct: 308 PTVPPALLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPT 367

Query: 211 DENLFGSVSEDSTLKLHD 228
             N+  S S+D  +   D
Sbjct: 368 RRNVLLSASDDCQVLYWD 385

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 112 RARYMPKDSNIIATINGEGN-VSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELI 170
           R    P D N+IAT   + + V I D     S  L  TL+ H      + ++P   N L+
Sbjct: 316 RLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLL--TLEAHTAPINQIKWHPTRRNVLL 373

Query: 171 SGSDDFTIALWDIDS 185
           S SDD  +  WD+++
Sbjct: 374 SASDDCQVLYWDLNT 388

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 86/208 (41%), Gaps = 14/208 (6%)

Query: 168 ELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLH 227
           + ++ SDD  + +W+  +G +  + V    H D V  C WH     L  S S+D+ +KL 
Sbjct: 177 KFVTCSDDNVLKIWNFSNGQQ--ERVLSGHHWD-VKSCDWHP-KMGLIVSGSKDNLIKLW 232

Query: 228 DKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHED 287
           D R+   V   +  K       F     NL A    D +I +YD RQ  + L  +    D
Sbjct: 233 DPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMD 292

Query: 288 AITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAIN 347
            ++ L +HP  + I   G  +  +  +DL          +  + +P    I   H  ++ 
Sbjct: 293 YMS-LSWHPINETIFSVGCYNGAIKHFDLLH--------DNSNSTPACHTIPYAHEKSVT 343

Query: 348 DFTLHPTIPWLSASVEEDNVVQVWKCSK 375
                P +  + AS  +D  ++ W  S+
Sbjct: 344 SLAYSP-VGHILASAAKDRTIRFWARSR 370

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 103/410 (25%), Positives = 172/410 (41%), Gaps = 74/410 (18%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEEDTRQY-----MILGTHTSGEEVDYLKVAAL 76
           P +Y+ +    + WP LT   +P   GSE   R Y     M   T  S ++ + L V +L
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSER--RNYPQSLLMTTATQASKKKENELMVLSL 170

Query: 77  -DLPDEVVTGEANDDNRRTKSNIKIVKK---FEHDG-----EINRARYMPKDSN----II 123
            +L   +V  +  DD      + +   K    E++        NR +  P  ++    + 
Sbjct: 171 SNLTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLT 230

Query: 124 ATINGEGNVSIYD---RSKSRSD-GLRT---------TLKYHKE-NGYGLSFNPNVSNEL 169
           AT++  G V I+D   +SK+ S  G +          T+K H    GY L ++P++    
Sbjct: 231 ATMSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGA 290

Query: 170 I-----SGSDDFT---IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSED 221
           +     SG   FT    + W  D   K P +V +N     + D  W   +  +F S   D
Sbjct: 291 LLTGDCSGQIYFTQRHTSKWVTD---KQPFTVSNNKS---IEDIQWSRTEGTVFASAGCD 344

Query: 222 STLKLHDKRSTSKVINTIQAKAA---FNTLAFSKHSANLFAAAGLDTNIY-LYDRRQ--- 274
             +++ D RS  K    I  KA+    N +++S     L A+ G D  ++ ++D RQ   
Sbjct: 345 GYIRIWDTRS-KKHKPAISVKASNTDVNVISWSDKLGYLLAS-GDDNGVWGVWDLRQFSP 402

Query: 275 ----TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-Q 323
               + +P+     H+ AIT + F+P ++ I+     D  V LWDL+      EI  +  
Sbjct: 403 DTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAA 462

Query: 324 QPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKC 373
           +  E     P++L +H   +  + D   H  IP    S   D  + +WK 
Sbjct: 463 ETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDG-LNIWKT 509

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 12/152 (7%)

Query: 229 KRSTSKVIN-----TIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVM 282
           +R TSK +      T+    +   + +S+    +FA+AG D  I ++D R +  KP   +
Sbjct: 304 QRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISV 363

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGH 342
                 +  + +  K   +L SG  +    +WDL +      PD A+   P  +  +  H
Sbjct: 364 KASNTDVNVISWSDKLGYLLASGDDNGVWGVWDLRQFS----PDTANSVQP--VAQYDFH 417

Query: 343 RSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           + AI   + +P    + A   EDN V +W  S
Sbjct: 418 KGAITSISFNPLDESIVAVASEDNTVTLWDLS 449

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 105/248 (42%), Gaps = 25/248 (10%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           L T  +       G++F+P+    L++     TI LWD   G+   +      H   V  
Sbjct: 3   LLTKFESKSTRAKGIAFHPSRPWALVALFSS-TIQLWDYRMGTLLHRF---EGHEGPVRA 58

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLD 264
             +H   + +F S  +D+++K+     T++ + T+     +    F         +A  D
Sbjct: 59  VDFHP-TQPIFVSAGDDASIKVWS-LETNRCLYTLTGHLDYVRTVFFHSELPWVISASDD 116

Query: 265 TNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------- 317
             + +++  Q  K L  + GH   + C QFH  ED ++VS   D  V +WD++       
Sbjct: 117 QTVRIWNW-QNRKELACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDISGLRKKHS 174

Query: 318 ---------EIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVV 368
                     + ++Q   +   G  ++  I  GH   +N  + HPT+P L  +  +D  V
Sbjct: 175 APGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLP-LIVTGGDDRQV 233

Query: 369 QVWKCSKN 376
           ++W+ S N
Sbjct: 234 KLWRMSSN 241

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 13/81 (16%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWD----NIHSDIVNDCSWHHFDENLF 215
           SF+P +   +++G DD  + LW + S        W+      H++ V DC   H D+NL 
Sbjct: 216 SFHPTLP-LIVTGGDDRQVKLWRMSSNK-----AWEVDTCRGHTNNV-DCVVFHPDQNLI 268

Query: 216 GSVSEDSTLKL--HDKRSTSK 234
            SV+ED TL++   DKR+  K
Sbjct: 269 LSVAEDKTLRIWDLDKRTPVK 289

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 115/306 (37%), Gaps = 81/306 (26%)

Query: 100 IVKKFE-HDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRS--------DGLRTTLK 150
           ++ +FE H+G +    + P    I  +   + ++ ++    +R         D +RT   
Sbjct: 45  LLHRFEGHEGPVRAVDFHPTQP-IFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVF- 102

Query: 151 YHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNI--------HSDIV 202
           +H E  +           +IS SDD T+ +W+           W N         H+  V
Sbjct: 103 FHSELPW-----------VISASDDQTVRIWN-----------WQNRKELACLTGHNHFV 140

Query: 203 NDCSWHHFDENLFGSVSEDSTLK------LHDKRSTSKVINTIQAKAAFNTL---AF--- 250
             C+  H  E+L  S S D T++      L  K S   V +   + A+   L   AF   
Sbjct: 141 M-CAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDC 199

Query: 251 ----------------SKH-SANLFAAAGLDTNIYLYDRRQTTKPLHV--MAGHEDAITC 291
                           S H +  L    G D  + L+ R  + K   V    GH + + C
Sbjct: 200 KVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLW-RMSSNKAWEVDTCRGHTNNVDC 258

Query: 292 LQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD------GSPEILMIHAGHRSA 345
           + FHP ++ IL S   D+ + +WDL +    +Q    +D        P + +  A H S 
Sbjct: 259 VVFHPDQNLIL-SVAEDKTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSG 317

Query: 346 INDFTL 351
           I  F L
Sbjct: 318 IMIFKL 323

>Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar to
           Ashbya gossypii ADR077C
          Length = 1201

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 80/181 (44%), Gaps = 19/181 (10%)

Query: 209 HFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIY 268
           H  + LF S  +D T+K+    S  K + T+     +    F  +      +A  D  I 
Sbjct: 62  HPTQPLFVSGGDDYTVKVWSLDS-RKCLFTLHGHLDYVRTVFFHNELPWIISASDDQTIR 120

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA----------- 317
           +++  Q  K +  + GH   + C QFHP ED +++S   D  V +WD++           
Sbjct: 121 IWNW-QNRKEIACLTGHNHFVMCAQFHPNED-LVISASLDETVRVWDISGLRKRHSAPGS 178

Query: 318 ----EIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKC 373
               E+ ++Q   +   G   +  I  GH   +N  + HPT+P L  S  +D  V++W+ 
Sbjct: 179 QNFDEVISQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRM 237

Query: 374 S 374
           S
Sbjct: 238 S 238

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++SGSDD  + LW + S +K+ +      HS+ V+   +H + +NL  SV 
Sbjct: 215 SFHPTLP-LIVSGSDDRQVKLWRM-SATKAWEVDTCRGHSNNVDSVIFHPY-QNLIISVG 271

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKP 278
           EDST+++ D    + V    + +  F  L  +  + NLF AA  D+ I ++   +   P
Sbjct: 272 EDSTIRVWDLDRRTPVKQFKREQDRF-WLVRAHPNINLFGAAH-DSGIMIFKLDRERPP 328

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 95/226 (42%), Gaps = 26/226 (11%)

Query: 150 KYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSV----WDNIHSDIVNDC 205
           K H E    ++F+ N S + ++ SDD  + +W+  +G K  +++    WD      V  C
Sbjct: 167 KAHTECIRDIAFSKNDS-KFVTCSDDNILKIWNFSNG-KQERTLSGHHWD------VKSC 218

Query: 206 SWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDT 265
            WH  +  L  S S+D+ +KL D RS   V   +  K       F     NL AA   D 
Sbjct: 219 DWHP-EMGLIVSASKDNLIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKDK 277

Query: 266 NIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQP 325
           +  ++D R   K L V+    D +T L +HP  + +      D  +  +D+ +   E Q 
Sbjct: 278 SCRVFDIRYHMKELTVIRDEVDYMTLL-WHPTNESMFTIASYDGAIKHFDILQNLEEPQ- 335

Query: 326 DEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
                      +I   H   I   + +P +  + AS  +D  ++ W
Sbjct: 336 ----------QVIPYAHDKCITSLSYNP-VGHILASAAKDRTIRFW 370

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 77/178 (43%), Gaps = 23/178 (12%)

Query: 161 FNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSE 220
           +NP  +N LIS S D T  +WD+ S +     +    H   V D  +      LF S   
Sbjct: 243 WNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLI--AHDSEVFDVRFLTQSTQLFASCGG 300

Query: 221 DSTLKLHDKRS--------------------TSKVINTIQAKAAFNTLAFSKHSANLFAA 260
           D ++++ D R                     +S+  +T +   A   L  S H  N+ A 
Sbjct: 301 DGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLAT 360

Query: 261 AGLDTN-IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA 317
             + +N I + D R    PL V+ GH  +I  +++HP +   L+S   D +V+ WD++
Sbjct: 361 FAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDIS 418

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 3/82 (3%)

Query: 105 EHDGEINRARYMPKDSNIIATINGEGN-VSIYDRSKSRSDGLRTTLKYHKENGYGLSFNP 163
           E+   + R    P D N++AT     N + I D      D     L  H  +   + ++P
Sbjct: 340 ENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNP--DSPLVVLNGHSASINQIKWHP 397

Query: 164 NVSNELISGSDDFTIALWDIDS 185
              N LIS SDD  +  WDI S
Sbjct: 398 TKKNTLISCSDDCQVLFWDISS 419

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 60/163 (36%), Gaps = 38/163 (23%)

Query: 96  SNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYD------------------- 136
           SN    +   HD E+   R++ + + + A+  G+G+V ++D                   
Sbjct: 268 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPG 327

Query: 137 --RSKSRSDGLRTTLKYHKENGYGL------SFNPNVSNELISGSDDFTIALWDIDSGSK 188
              + SRSD          EN + L        +PNV       S++  I    +D  + 
Sbjct: 328 TGNNSSRSDST-------DENSHALLRLEPSPHDPNVLATFAIASNEILI----LDMRNP 376

Query: 189 SPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS 231
               V  N HS  +N   WH   +N   S S+D  +   D  S
Sbjct: 377 DSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDISS 419

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 80/188 (42%), Gaps = 21/188 (11%)

Query: 202 VNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAA---FNTLAFSKHSANLF 258
           + D  W   +  +F S   D  +++ D RS  K    I  KA+    N +++S+    L 
Sbjct: 336 IEDLQWSRTESTVFASCGIDGYIRIWDTRS-KKHKPAISVKASNTDVNVISWSEKIGYLL 394

Query: 259 AAAGLDTNIYLYDRRQ-------TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRV 311
           A+   D    ++D RQ       T  P+     H+ AIT + F+P ++ I+     D  V
Sbjct: 395 ASGDDDGTWGVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTV 454

Query: 312 ILWDLA------EIGAE-QQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEE 364
            LWDL+      EI  +  +  E     P++L +H   +  + D   H  IP    S   
Sbjct: 455 TLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGT 512

Query: 365 DNVVQVWK 372
           D  + VWK
Sbjct: 513 DG-LNVWK 519

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 66/152 (43%), Gaps = 12/152 (7%)

Query: 229 KRSTSKVINTIQAKAAFNT-----LAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVM 282
           +R TSK I   QA    N      L +S+  + +FA+ G+D  I ++D R +  KP   +
Sbjct: 315 QRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISV 374

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGH 342
                 +  + +  K   +L SG  D    +WDL +      P  A   SP  +  +  H
Sbjct: 375 KASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQF----TPQNASTASP--VAQYQFH 428

Query: 343 RSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           + AI   + +P    + A   EDN V +W  S
Sbjct: 429 KGAITSISFNPLDESIIAVASEDNTVTLWDLS 460

>SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 878

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 92/211 (43%), Gaps = 23/211 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N ++ GSDDF I +++ ++G K         H D +   + H     +  S S+D T+KL
Sbjct: 68  NWIVVGSDDFKIRVFNYNTGEKVTDF---EGHPDYIRSIAVHPTRPYVL-SASDDMTIKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +      +  T +    F   +AF+    N FA+A LD  + ++   Q + P   M  H
Sbjct: 124 WNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQS-PNFTMTAH 182

Query: 286 ED-AITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           E   +  + ++P +D   L++   DR V +WD                +   +    GH 
Sbjct: 183 ETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQ--------------TKSCVATLEGHM 228

Query: 344 SAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           + ++    HP++P +  S  ED  V++W  +
Sbjct: 229 ANVSYAIFHPSLP-IIISGSEDGTVKIWNAN 258

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 68/166 (40%), Gaps = 5/166 (3%)

Query: 144 GLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVN 203
            L  T + H+     ++FNP   N   S   D T+ +W +  G +SP        +  VN
Sbjct: 131 ALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL--GQQSPNFTMTAHETRGVN 188

Query: 204 DCSWHHF-DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAG 262
              ++   D+    + S+D ++K+ D ++ S  + T++   A  + A    S  +  +  
Sbjct: 189 FVDYYPLQDKPYLITSSDDRSVKIWDYQTKS-CVATLEGHMANVSYAIFHPSLPIIISGS 247

Query: 263 LDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
            D  + +++         +  G E +  C+  HP      V+ G D
Sbjct: 248 EDGTVKIWNANTYKLEKTLNLGLERS-WCVAAHPTGKRNYVASGFD 292

>TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657)
           [2646 bp, 881 aa] {ON} Anc_6.239 YGL137W
          Length = 881

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N ++ GSDDF I +++ ++G    K V    H D +   + H     L  S S+D T+KL
Sbjct: 68  NWIVVGSDDFRIRVFNYNTGE---KVVDFEAHPDYIRSIAVHPTKPYLL-SGSDDLTVKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +      +  T +    F   +AF+    + FA+  LD+ + ++   Q T    +  G 
Sbjct: 124 WNWEKNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDSTVKVWSLGQPTPNYTLTTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   L++   D  V +WD                +   +    GH S
Sbjct: 184 EKGVNYVDYYPLPDKPYLITSSDDLTVKIWDYQ--------------TKSCVATLEGHMS 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  +++W  S
Sbjct: 230 NVSFAVFHPTLP-VIISGSEDGTLKIWNSS 258

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 93/227 (40%), Gaps = 18/227 (7%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H E    +SF+    ++ ++ SDD  + +W+  +G +  + V    H D V  C WH   
Sbjct: 164 HMECVRDVSFS-GTDSKFVTCSDDNILKIWNFSNGQQ--ERVLSGHHWD-VKSCDWHP-T 218

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
             L  S S+D+ +KL D RS   +   +  K       F     NL A    D +  ++D
Sbjct: 219 MGLIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFD 278

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDG 331
            RQ  K L       D ++ L +HP  + I   G  D  +  +DL +          D G
Sbjct: 279 IRQNMKELKSFRDESDYMS-LTWHPINESIFTVGCYDGSLKHFDLLQ----------DTG 327

Query: 332 SPEILM-IHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
           S      I   H   I   + +P +  + AS  +D  ++ W  S+ +
Sbjct: 328 SSNSFHDIPYAHDKCITSLSYNP-VGHILASASKDRTIRFWTRSRPM 373

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 85/182 (46%), Gaps = 11/182 (6%)

Query: 136 DRSKSRSDGLRTTLKYHKENGY-GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVW 194
           D  +S +DGL  T  +H +  + G+  + +    + +G++   I LWD      +    W
Sbjct: 157 DEEQSSTDGLIKT--FHGDYAFLGIDHHRSKPYFVTAGAE---INLWDSSRSRPTANLSW 211

Query: 195 DNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHS 254
               +D V+   ++  + ++F S   D+++ L+D R+ S      Q +   N L ++   
Sbjct: 212 G---ADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFTQ-RMRTNALCWNPME 267

Query: 255 ANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILW 314
           A  F  A  D N Y YD R  ++ LHV   H  A+  + F P  D I V+G  D+ + ++
Sbjct: 268 AYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIY 326

Query: 315 DL 316
            +
Sbjct: 327 QV 328

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 82/186 (44%), Gaps = 29/186 (15%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSWHH 209
           H++  Y ++ N +  N+L S S D  +  W++ +  +  S K+ +  +H   V      H
Sbjct: 66  HRDGVYTIAKNYHALNKLASASADGVVKYWNMSTREEICSFKAHYGLVHGLCVTP---QH 122

Query: 210 F----DENLFGSVSEDSTLKL--------------HDKRSTSKVINTIQAKAAFNTLAFS 251
                +EN   S  +D T+KL               ++ ST  +I T     AF  L   
Sbjct: 123 LSANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAF--LGID 180

Query: 252 KH-SANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRR 310
            H S   F  AG + N++   R   ++P   ++   D ++ ++F+  E  I  S G+D  
Sbjct: 181 HHRSKPYFVTAGAEINLWDSSR---SRPTANLSWGADNVSTVKFNQNETDIFASAGSDNS 237

Query: 311 VILWDL 316
           V+L+DL
Sbjct: 238 VVLYDL 243

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 108/262 (41%), Gaps = 33/262 (12%)

Query: 135 YDRSKSRSDGLRTTLKYHKENGYGLSFNPNV-SNELISGSDDFTIAL-------WDIDSG 186
           Y   K+    + T   +    GYGL ++P + +  L++G     I L       W  D  
Sbjct: 260 YQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITD-- 317

Query: 187 SKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTS--KVINTIQAKAA 244
            K P +  +N     V D  W   +  +F +   D  +++ D RS      I+T  +   
Sbjct: 318 -KQPFTAANN---QSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTD 373

Query: 245 FNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT-------KPLHVMAGHEDAITCLQFHPK 297
            N +++++    L A+   + +  ++D RQ +       +P+     H   IT + F+P 
Sbjct: 374 VNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEGVQPVAQYDFHRGPITSISFNPL 433

Query: 298 EDGILVSGGADRRVILWDLA------EIGAE-QQPDEADDGSPEILMIHAGHRSAINDFT 350
           +D ++     D  V LWDL+      EI  + ++  E     P++L +H   +  + D  
Sbjct: 434 DDSVVAVASEDNTVTLWDLSVEADDDEIQQQTKEYKELQKIPPQLLFVH--WQKEVKDVK 491

Query: 351 LHPTIPWLSASVEEDNVVQVWK 372
            H  IP    S   D  + VWK
Sbjct: 492 WHKQIPGCLVSTGTDG-LNVWK 512

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 63/152 (41%), Gaps = 12/152 (7%)

Query: 229 KRSTSKVINTIQAKAAFNT-----LAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVM 282
           +R TSK I   Q   A N      + +S   + +FA +G D  + ++D R +  KP    
Sbjct: 308 QRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAIST 367

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGH 342
                 +  + ++ K   +L SG  +    +WDL +      P  ++   P  +  +  H
Sbjct: 368 RASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFS----PANSEGVQP--VAQYDFH 421

Query: 343 RSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           R  I   + +P    + A   EDN V +W  S
Sbjct: 422 RGPITSISFNPLDDSVVAVASEDNTVTLWDLS 453

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 84/199 (42%), Gaps = 34/199 (17%)

Query: 121 NIIATINGEGNVSIYD--RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N IA      +VSIYD  R+ ++   L TTL  H  +   + FN   ++ LISG  D  I
Sbjct: 197 NYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCI 256

Query: 179 ALWDIDSGS-KSPKSVWD-NIHSDIVNDCSWH-HFDENLFGSVSEDSTLKLHDKRSTSKV 235
            +WD+ S S K  +S  + N  SD V D  W   +D   F S+  D++L           
Sbjct: 257 KVWDLRSHSYKVNRSDLNFNSGSDSVRDVKWMPTYD---FASLGADTSL----------- 302

Query: 236 INTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFH 295
                          S   +N FA+      +  +D RQ  +    +  H     C+ +H
Sbjct: 303 --------------CSSGRSNKFASVHDSGLLLTFDMRQPNQVERKINAHSGPGLCMHWH 348

Query: 296 PKEDGILVSGGADRRVILW 314
           P  D I +SGG D +  LW
Sbjct: 349 PHMDYI-ISGGRDGKCALW 366

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 10/105 (9%)

Query: 216 GSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD-RRQ 274
           GS+   +      +R+  K+      KA F+      H  N  A  G  T++ +YD  R 
Sbjct: 163 GSLGGGTKFSSSMRRNMRKISTISDVKAGFH------HHKNYIAICGTSTSVSIYDINRA 216

Query: 275 TTK--PL-HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           + K  PL   ++ H  +I  + F+  +  +L+SGG D  + +WDL
Sbjct: 217 SAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDL 261

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 63/111 (56%), Gaps = 8/111 (7%)

Query: 211 DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAA----AGLDTN 266
           + +LF S S+DS +K+ D R++S V      K+A      S+H  ++ A     +G+D  
Sbjct: 70  NSDLFASASKDS-VKIFDVRTSSCVATLHNDKSAPFLSLDSRH--DMLACGTELSGVDAE 126

Query: 267 IYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           +++YD ++ +KPL      H D IT  +FHP + G+L+SG  D  V ++DL
Sbjct: 127 LHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDL 177

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
           YOL138C (REAL)
          Length = 1326

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 80/201 (39%), Gaps = 35/201 (17%)

Query: 121 NIIATINGEGNVSIYDRSKSRS--DGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N IA  N    +SIYD +KS S  + L T+L  H  +     FN   SN LISG  D  +
Sbjct: 224 NCIAVCNNSTAISIYDLNKSSSIDNPLITSLYEHTRSINSFDFNMVESNLLISGGQDSCV 283

Query: 179 ALWDIDSGSKSPKS-----VWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTS 233
            +WD+ S    PKS     +  N  SD + D  W       F + SE  T    + +S  
Sbjct: 284 KIWDLRSN--KPKSSNRSDISINTASDSIRDVKW--MPGYNFATKSEQGTSTYGNSKSGY 339

Query: 234 KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQ 293
           K                       FA+      +  +D RQ  +    +  H     CL 
Sbjct: 340 K-----------------------FASIHDSGYLLKFDLRQPAQYEKKLNAHTGPGLCLN 376

Query: 294 FHPKEDGILVSGGADRRVILW 314
           +HP ++ I  +GG D +  LW
Sbjct: 377 WHPHQEYI-ATGGRDGKCCLW 396

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 39/96 (40%), Gaps = 10/96 (10%)

Query: 225 KLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK---PLHV 281
           KL  +   +K       K  FN         N  A     T I +YD  +++    PL  
Sbjct: 199 KLSKRTRQNKFSTIADVKTGFNNYK------NCIAVCNNSTAISIYDLNKSSSIDNPLIT 252

Query: 282 -MAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            +  H  +I    F+  E  +L+SGG D  V +WDL
Sbjct: 253 SLYEHTRSINSFDFNMVESNLLISGGQDSCVKIWDL 288

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 96/217 (44%), Gaps = 25/217 (11%)

Query: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYG--LSFNPNVSNELISGSDDF 176
           D  IIA     G V ++    S  D L++  ++ +  G    + FN   +N L SG    
Sbjct: 73  DDKIIAGALDSGVVELFS---STGDSLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKG 129

Query: 177 TIALWDIDSGSK--------SPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHD 228
            I +WD+++  K        +P      I    V   +W+    ++F S    S   + D
Sbjct: 130 EIYIWDLNTCLKNSEGYTPLTPGVASTPIEE--VTSLAWNQSLAHVFASAGSTSYASIWD 187

Query: 229 KRSTSKVINTIQA------KAAFNTLAF-SKHSANLFAAAGLDTN--IYLYDRRQTTKPL 279
            ++  +VI+   A      K+  + + +  K+S  +  A G DT   I ++D R    PL
Sbjct: 188 LKAKKEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPL 247

Query: 280 HVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
            V++ GH   I  L +  +++ +L+S G D  ++LW+
Sbjct: 248 QVLSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN 284

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 21/32 (65%)

Query: 285 HEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           H+ A   ++F+ K++ +L SGG+   + +WDL
Sbjct: 105 HQGAAKTVKFNSKQNNVLASGGSKGEIYIWDL 136

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 15/133 (11%)

Query: 140 SRSDGLRTTL---KYHKENGYGLSFNPNVSNELISGSD-DFTIALWDIDSGSKSPKSVWD 195
           S S GL++ L   ++H +N   ++          +GSD +  I +WD+ + + +P  V  
Sbjct: 201 SPSTGLKSQLSVVEWHPKNSTRVA--------TATGSDTEPLILVWDLRNAN-TPLQVLS 251

Query: 196 NIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVIN-TIQAKAAFNTLAFSKHS 254
             HS  +    W   DE L  S   D+T+ L +  S  ++     +    F T  F+  +
Sbjct: 252 KGHSKGILSLDWCSQDEELLLSSGRDNTIVLWNPESGQELTQFPTRGNWCFKT-KFAPEA 310

Query: 255 ANLFAAAGLDTNI 267
            +LFA+A  D  I
Sbjct: 311 PDLFASASFDNKI 323

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 94/229 (41%), Gaps = 35/229 (15%)

Query: 91  NRRTKSNIK-IVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRS--DGLRT 147
           N++  SN++ +VKK     ++    Y  K  N +A      +VS+YD +K+ +  + L T
Sbjct: 166 NQKGSSNLRRVVKKISVISDVKAGFYNHK--NYVAICGTSTSVSVYDINKTSTIDNPLVT 223

Query: 148 TLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIH--SDIVNDC 205
           TL  H  +   + FN + +N LISG  D  I +WD+ S  +S      NI+  SD + D 
Sbjct: 224 TLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDLRSSQRSTNRSDININTGSDSIRDI 283

Query: 206 SWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDT 265
            W                       S     N +      +   F       FA+     
Sbjct: 284 KW---------------------MPSYDFATNDVNNSNGISNRGFK------FASIHDSG 316

Query: 266 NIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILW 314
            +  +D RQ  +    +  H     CL +HP ++ I +SGG D +  LW
Sbjct: 317 LLLKFDLRQPNQMEKKINAHSGPGLCLHWHPHQEYI-ISGGRDGKCCLW 364

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 249 AFSKHSANLFAAAGLDTNIYLYDRRQTT---KPL-HVMAGHEDAITCLQFHPKEDGILVS 304
            F  H  N  A  G  T++ +YD  +T+    PL   ++ H  +I  + F+  +  +L+S
Sbjct: 189 GFYNH-KNYVAICGTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLIS 247

Query: 305 GGADRRVILWDL 316
           GG D  + +WDL
Sbjct: 248 GGQDGCIKVWDL 259

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 144/331 (43%), Gaps = 57/331 (17%)

Query: 78  LPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEIN---------RARYMPKDSNIIATING 128
           L D+ V+G  N+ +     N    K  E    I          R+     D   +AT   
Sbjct: 330 LSDDSVSGINNESSSVVAGNGATEKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAE 389

Query: 129 EGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK 188
           +  + I+D S  +   +  TL+ H+++ Y L + P   ++L+SGS D T+ +WD+ +G  
Sbjct: 390 DKLIRIWDLSSKK---ILMTLQGHEQDIYSLDYFP-AGDKLVSGSGDRTVRIWDLRTGQC 445

Query: 189 SPK-SVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNT 247
           S   S+ D + +  V+       D     + S D T+++ D   T  ++  + ++   +T
Sbjct: 446 SLTLSIEDGVTTVAVSPG-----DGKYIAAGSLDRTVRVWDSE-TGFLVERLDSENELST 499

Query: 248 --------LAFSKHSANLFAAAGLDTNIYLYDRRQTT-KPLHVMA-----GHEDAITCLQ 293
                   + F++   ++ + + LD ++ L+D R    +  H        GH+D +  + 
Sbjct: 500 GHKDSVYSVVFTRDGRSVVSGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVA 558

Query: 294 FHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR------SAIN 347
              ++D  ++SG  DR V+ WD A             G+P  L++  GHR      + +N
Sbjct: 559 T-TQDDEYILSGSKDRGVLFWDTAS------------GNP--LLMLQGHRNSVISVAVVN 603

Query: 348 DFTLHPTIPWLSASVEEDNVVQVWKCSKNLS 378
            F L P I  + A+   D   ++WK +K  S
Sbjct: 604 GFPLGPDI-GVFATGSGDCKARIWKYTKKTS 633

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 81/182 (44%), Gaps = 9/182 (4%)

Query: 136 DRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWD 195
           D S +  DGL  T  Y +    GL  + N S  +  G+    I LWD           W 
Sbjct: 157 DESVNTKDGLIKTF-YGEHAFQGLDHHRNNSTFVTGGAQ---IQLWDSSRSKPISNLTWG 212

Query: 196 NIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSA 255
              +D V +  ++  + ++  S   D+++ L+D R+ S     +Q+  + N + ++   A
Sbjct: 213 ---ADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIVQSMRS-NAICWNPMEA 268

Query: 256 NLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
             F  A  D N Y YD R  ++ L+V   H  A+  + F P     LV+G  D+ + ++D
Sbjct: 269 FNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGTE-LVTGSYDKTIRIYD 327

Query: 316 LA 317
           + 
Sbjct: 328 IG 329

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 85/182 (46%), Gaps = 21/182 (11%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSWHH 209
           +++  Y ++ N N  N+L + S D  +  W++ +  +  S K+ +  +    V+   +  
Sbjct: 66  YRDGVYCIAKNYNSLNKLAAASADGVVKYWNMSTREELCSFKAHYGLVTGLCVSPEKYSS 125

Query: 210 -FDENLFGSVSEDSTLKL------------HDKRSTSK--VINTIQAKAAFNTLAFSKHS 254
             +E+   S  +D T+KL             D+   +K  +I T   + AF  L   +++
Sbjct: 126 DKNEHFMISCGDDKTIKLWSVNSEDFANVKDDESVNTKDGLIKTFYGEHAFQGLDHHRNN 185

Query: 255 ANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILW 314
           +  F   G    I L+D  + +KP+  +    D +T ++F+  E  IL S G+D  ++L+
Sbjct: 186 ST-FVTGG--AQIQLWDSSR-SKPISNLTWGADNVTNVKFNQTETDILASTGSDNSIVLY 241

Query: 315 DL 316
           DL
Sbjct: 242 DL 243

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 87/168 (51%), Gaps = 14/168 (8%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F PN S+ +++G+ D T  +WD D  +++PK+     H++ V   SW    E +  + S
Sbjct: 150 AFAPNSSSRMVTGAGDNTARIWDCD--TQTPKATLTG-HTNWVLCVSWCPNGE-VIATGS 205

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNT-LAF------SKHSANLFAAAGLDTNIYLYDR 272
            D+T++L + +S   V + ++    + T LA+              A+A  D  I ++D 
Sbjct: 206 MDNTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDT 265

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
            +    L+ ++GH ++++C+++  +  GIL SG  D+ V  WD+   G
Sbjct: 266 SRRVC-LYTLSGHTNSVSCIKWGGQ--GILYSGSHDKTVRAWDMNSEG 310

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 80/177 (45%), Gaps = 17/177 (9%)

Query: 140 SRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHS 199
           +R   L+   K  K+NG        V   +++ SDDFT+ LW+    +K    +    H 
Sbjct: 352 ARDKALKNYEKVVKKNG-------RVEELMVTASDDFTMFLWNPLKSTKPLGRM--TGHQ 402

Query: 200 DIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFA 259
            +VN  ++   D     S S D+++KL D R   K I+T +   A            L  
Sbjct: 403 KLVNHVAFSP-DGRYIVSASFDNSIKLWDGRD-GKFISTFRGHVASVYQVAWSADCRLLV 460

Query: 260 AAGLDTNIYLYDRRQTTKPLHV-MAGHEDAITCLQFHPKEDGILV-SGGADRRVILW 314
           +   DT + ++D R  T+ L V + GH+D +  + +    DG  V SGG D+ V +W
Sbjct: 461 SCSKDTTLKVWDVR--TRKLSVDLPGHKDEVFTVDW--SVDGKRVCSGGKDKMVRIW 513

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 95/245 (38%), Gaps = 59/245 (24%)

Query: 119 DSNIIATINGEGNVSIYD--RSKSRSDGLRTTLKYHKENGYGLSFNP------NVSNELI 170
           +  +IAT + +  + +++    K   D LR  LK+       L++ P           L 
Sbjct: 197 NGEVIATGSMDNTIRLWEGKSGKPVGDALRGHLKWITS----LAWEPIHLVKAGEQPRLA 252

Query: 171 SGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           S S D TI +WD    S+       + H++ V+   W    + +  S S D T++  D  
Sbjct: 253 SASKDGTIKIWDT---SRRVCLYTLSGHTNSVSCIKWG--GQGILYSGSHDKTVRAWDMN 307

Query: 231 STSKVINTIQAKAAF-NTLAFSKHSA---------------------------------- 255
           S  + IN +++ A + N L+ S   A                                  
Sbjct: 308 SEGRCINVLKSHAHWVNHLSLSTDYALRVGPFDHTGVEPTSPEDARDKALKNYEKVVKKN 367

Query: 256 ----NLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDG-ILVSGGADRR 310
                L   A  D  ++L++  ++TKPL  M GH+  +  + F P  DG  +VS   D  
Sbjct: 368 GRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSP--DGRYIVSASFDNS 425

Query: 311 VILWD 315
           + LWD
Sbjct: 426 IKLWD 430

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  R  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 126 IFKVRPVTRSSSAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARIWDC 173

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 80/170 (47%), Gaps = 15/170 (8%)

Query: 151 YHKENGY-GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHH 209
           +H E+ +  L  +   SN +  G+    I LWD +         W    +D +N   ++ 
Sbjct: 169 FHGEHAFQSLDHHRQKSNFVTGGAQ---IELWDTNRSKPISNLSWG---ADNINHVRFNQ 222

Query: 210 FDENLFGSVSEDSTLKLHDKRS---TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
            + ++  S   D+++ L+D R+   T K++ T++     N++ ++   A  F  A  D N
Sbjct: 223 NEVDILASTGSDNSVVLYDLRTNSPTQKIVQTMRT----NSICWNPVEAFNFVIANEDHN 278

Query: 267 IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            Y YD R  +K LHV   H  A+  + F P  D + V+G  D+ + ++ +
Sbjct: 279 AYYYDMRNMSKALHVFKDHVSAVMDVDFSPTGDEV-VTGSYDKTIRIYQV 327

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 81/181 (44%), Gaps = 20/181 (11%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSWHH 209
           H++  Y ++ N NV N+L + S D  I  W++ +  +  S K+ +  +    V       
Sbjct: 66  HRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLSP 125

Query: 210 FDENLFGSVSEDSTLKL----HDKRSTSK----------VINTIQAKAAFNTLAFSKHSA 255
             EN   S  +D T+KL     D  S  K          +I T   + AF +L   +  +
Sbjct: 126 QRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQKS 185

Query: 256 NLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
           N F   G    ++  +R   +KP+  ++   D I  ++F+  E  IL S G+D  V+L+D
Sbjct: 186 N-FVTGGAQIELWDTNR---SKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYD 241

Query: 316 L 316
           L
Sbjct: 242 L 242

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 114/243 (46%), Gaps = 13/243 (5%)

Query: 80  DEVVTGEANDDNRRTKSNIKIVKKFE--HDGEINRARYMPKDSNIIATINGEGNVSIYDR 137
           D +++G+A+   +  + N  +VK+ +  H   I    +   DS  + T + +  + I++ 
Sbjct: 137 DWMISGDADGTIKIWQPNFNMVKELDRIHTEGIRDVAFSNNDSKFV-TCSDDNILKIWNF 195

Query: 138 SKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNI 197
           S  + + +   L  H  +     ++P +   ++SGS D  + LWD  SG +   ++    
Sbjct: 196 SNGQQERV---LSGHHWDVRSCDWHPELG-LIVSGSKDNLVKLWDPRSG-QCVSTLLKFK 250

Query: 198 HSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANL 257
           H+  V    +     NL  ++S+D + ++ D R++   +  ++ +  F  L +S  + ++
Sbjct: 251 HT--VLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNELMCVRDEVDFMELEWSTINESM 308

Query: 258 FAAAGLDTNIYLYDRRQ-TTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
           F     D ++  +D  Q T KP+H++   HE  I+ + ++P    IL +   DR +  W 
Sbjct: 309 FTVGCYDGSLKHFDLGQDTEKPIHIIPFAHEKCISAIAYNP-VGHILATAAKDRTIRFWT 367

Query: 316 LAE 318
            A 
Sbjct: 368 RAR 370

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 99/271 (36%), Gaps = 78/271 (28%)

Query: 63  TSGEEVDYLKVAALDLP--DEVVTGEAN----DDNRRTKSNIKIVKKFEHDGE------I 110
           +S   + YLK   L LP  +   +  AN    D  +R    + +  KF H         I
Sbjct: 26  SSYNRLYYLKKHGLSLPPIEPETSFTANIMPPDAYKRNDRIVNLPTKFTHLSSNKVKHVI 85

Query: 111 NRARYMPKDSN-IIATINGE-----GNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPN 164
              ++ P+    I+AT +GE     G+   ++      D   TT+KY     +       
Sbjct: 86  PAIQWSPEGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDW------- 138

Query: 165 VSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTL 224
               +ISG  D TI +W  +          D IH++ + D ++ + D   F + S+D+ L
Sbjct: 139 ----MISGDADGTIKIWQPNFNMVKE---LDRIHTEGIRDVAFSNNDSK-FVTCSDDNIL 190

Query: 225 KLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAG 284
           K                                         I+ +   Q  +   V++G
Sbjct: 191 K-----------------------------------------IWNFSNGQQER---VLSG 206

Query: 285 HEDAITCLQFHPKEDGILVSGGADRRVILWD 315
           H   +    +HP E G++VSG  D  V LWD
Sbjct: 207 HHWDVRSCDWHP-ELGLIVSGSKDNLVKLWD 236

>ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL145C
           (COP1)
          Length = 1204

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 89/214 (41%), Gaps = 24/214 (11%)

Query: 177 TIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVI 236
           TI LWD   G    +      H   V    +H   + LF S  +D ++K+    ST K +
Sbjct: 34  TIQLWDYRMGVLLHRF---EEHEGPVRGVDFHP-TQPLFVSAGDDYSIKVWS-LSTHKCL 88

Query: 237 NTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHP 296
            T+     +    F         +A  D  I +++  Q  + +  + GH   + C QFHP
Sbjct: 89  FTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNW-QNRREIACLTGHNHFVMCAQFHP 147

Query: 297 KEDGILVSGGADRRVILWDLA----------------EIGAEQQPDEADDGSPEILMIHA 340
            ED ++VS   D  V +WD++                ++  +Q   +   G   +  I  
Sbjct: 148 TED-LVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILE 206

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 207 GHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMS 239

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 84/215 (39%), Gaps = 48/215 (22%)

Query: 169 LISGSDDFTIALWDIDSGSKSPKSVWDNI--------HSDIVNDCSWHHFDENLFGSVSE 220
           +IS SDD TI +W+           W N         H+  V  C+  H  E+L  S S 
Sbjct: 110 IISASDDQTIRIWN-----------WQNRREIACLTGHNHFVM-CAQFHPTEDLVVSASL 157

Query: 221 DSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLH 280
           D T+++ D     K  ++     +F     ++   NLF     D  +             
Sbjct: 158 DETVRIWDISGLRKR-HSAPGSQSFEEQMITQQ--NLFDGGFGDCVVKF----------- 203

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           ++ GH   +    FHP    ++VSG  DR+V LW ++   A     E D           
Sbjct: 204 ILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMSSTKAW----EVDTCR-------- 250

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
           GH + ++    HP    L  SV ED+ ++VW   K
Sbjct: 251 GHTNNVDSVIFHP-FQNLIISVGEDSTIRVWDLDK 284

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 65/122 (53%), Gaps = 5/122 (4%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           SF+P +   ++SGSDD  + LW + S +K+ +      H++ V+   +H F +NL  SV 
Sbjct: 216 SFHPTLP-LIVSGSDDRQVKLWRM-SSTKAWEVDTCRGHTNNVDSVIFHPF-QNLIISVG 272

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPL 279
           EDST+++ D    + V    + +  F ++  +  + NLF AA  D+ I ++   +   P+
Sbjct: 273 EDSTIRVWDLDKRTPVKQFKREQDRFWSIR-AHPNVNLFGAAH-DSGIMVFKLDRERPPV 330

Query: 280 HV 281
            V
Sbjct: 331 AV 332

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 100/213 (46%), Gaps = 21/213 (9%)

Query: 122 IIATINGEGNVSIYDRSKSRSDGLRTTLKY--HKENGYGLSFNPNVSNELISGSDDFTIA 179
           IIA     G + +Y  +++ +D + +T K+  H  +   + FN    N L SG ++  I 
Sbjct: 76  IIAGALDNGTLELYSTNEA-NDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIF 134

Query: 180 LWDIDSGSKSPKSVWDNIHS-------DIVNDCSWHHFDENLFGSVSEDSTLKLHDKRST 232
           +WD++  ++SP S +  +         D VN  +W+    ++F S    +   + D ++ 
Sbjct: 135 IWDMNKCTESP-STYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAK 193

Query: 233 SKVIN---TIQAKAAFNTLAF----SKHSANLFAAAGLDTN--IYLYDRRQTTKPLHVM- 282
            +VI+   T  +      L+      K+S  +  A G D +  I ++D R    P+  + 
Sbjct: 194 KEVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTLN 253

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
            GH+  I  L +  +++ +L+S G D  V+LW+
Sbjct: 254 QGHQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 216 GSVSEDSTLKLHDKRST--SKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRR 273
            + S DS+L+L    +T   K + ++Q  + FN L +S H+  + A A  +  + LY   
Sbjct: 34  ANFSTDSSLELWSLLATDSEKPLASLQVDSKFNDLDWS-HNNEIIAGALDNGTLELYSTN 92

Query: 274 QTTKPLHVMA---GHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           +    +   A    H  ++  ++F+ ++D +L SGG +  + +WD+
Sbjct: 93  EANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDM 138

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 171 SGSD-DFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDK 229
           +GSD D +I +WD+ + + +P    +  H   +    W   DENL  S   D+T+ L + 
Sbjct: 229 TGSDNDPSILVWDLRNAN-TPMQTLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWNP 287

Query: 230 RSTSKVINTIQAKA--AFNTLAFSKHSANLFAAAGLDTNI 267
            S  + ++   A+    F T  F+  + +LFA A  D  I
Sbjct: 288 ESAEQ-LSQFPARGNWCFKT-KFAPEAPDLFACASFDNRI 325

>CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa]
           {ON} similar to uniprot|Q08281 Saccharomyces cerevisiae
           YOL138c
          Length = 1336

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 83/201 (41%), Gaps = 32/201 (15%)

Query: 120 SNIIATINGEGNVSIYD--RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFT 177
           SN+IA  N   ++S+YD  R+    D +   L  H        FN + +N +ISG  D  
Sbjct: 249 SNVIAICNNSTDISLYDLNRTTPAEDPMIQILSGHTRAINSFDFNMSQTNLIISGGQDGC 308

Query: 178 IALWDIDSGSKSPKSVWD-NIHS--DIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSK 234
           + +WDI S S   +   D NI +  D + D  W     + F S+            +  K
Sbjct: 309 VKVWDIRSDSMKRQGRSDLNIKTANDSIRDVKW--MPSHNFASLPSS---------ADGK 357

Query: 235 VINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYL-YDRRQTTKPLHVMAGHEDAITCLQ 293
            +N       F ++               DT + L YD RQTT+    +  H     CL 
Sbjct: 358 SLNISSPGYTFASIH--------------DTGVLLKYDLRQTTQVDKKINAHSGPGLCLN 403

Query: 294 FHPKEDGILVSGGADRRVILW 314
           +HP +D I  +GG D +  LW
Sbjct: 404 WHPHQDYI-ATGGRDGKCSLW 423

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 226 LHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKP----LHV 281
           L  +   +K+ N    K  F+  +      N+ A     T+I LYD  +TT      + +
Sbjct: 226 LSKRTKGAKISNIADVKCGFHNYS------NVIAICNNSTDISLYDLNRTTPAEDPMIQI 279

Query: 282 MAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQ 324
           ++GH  AI    F+  +  +++SGG D  V +WD+     ++Q
Sbjct: 280 LSGHTRAINSFDFNMSQTNLIISGGQDGCVKVWDIRSDSMKRQ 322

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 73/158 (46%), Gaps = 17/158 (10%)

Query: 162 NPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDEN---LFGSV 218
           NPN     ++G     I LWD++         W       V++ S+  F++N   +  S 
Sbjct: 188 NPN----FVTGGAQ--IQLWDVNRKKPLSNLSWG------VDNVSFVRFNQNEEDILAST 235

Query: 219 SEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKP 278
             D+++ L+D R+ S     +Q +   N L ++      FA A  D N Y YD R  ++ 
Sbjct: 236 GSDNSIVLYDLRTNSPTQKVVQ-RMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRA 294

Query: 279 LHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           LHV   H  A+  + F P  + I V+G  D+ + +++L
Sbjct: 295 LHVFKDHVSAVMDVDFSPTGEEI-VTGSYDKTIRIFNL 331

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 82/188 (43%), Gaps = 30/188 (15%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK----------------SPKSVWD 195
           H++  Y L+ N NV N+L SGS D  +  W++ +  +                +P  +  
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSP 125

Query: 196 NIHSDIVNDCS-------WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTL 248
                 +  C        W   + + F S+ +D+  K+        ++ T   + AF ++
Sbjct: 126 TKKDSFMLSCGDDKTIKLW-SVNSDDFNSIKDDT--KIVSDTGDGALLKTFYGEHAFQSI 182

Query: 249 AFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
              + + N F   G    ++  +R+   KPL  ++   D ++ ++F+  E+ IL S G+D
Sbjct: 183 DHHRRNPN-FVTGGAQIQLWDVNRK---KPLSNLSWGVDNVSFVRFNQNEEDILASTGSD 238

Query: 309 RRVILWDL 316
             ++L+DL
Sbjct: 239 NSIVLYDL 246

>YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {ON}
            SEC27Essential beta'-coat protein of the COPI coatomer,
           involved in ER-to-Golgi and Golgi-to-ER transport;
           contains WD40 domains that mediate cargo selective
           interactions; 45% sequence identity to mammalian
           beta'-COP
          Length = 889

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 91/210 (43%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N +I GSDDF I +++ ++G    K V    H D +   + H     +  S S+D T+KL
Sbjct: 68  NWIIVGSDDFRIRVFNYNTGE---KVVDFEAHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +  +   +  T +    F   +AF+    + FA+  LD  + ++   Q+T    +  G 
Sbjct: 124 WNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   +++   D  + +WD                +   +    GH S
Sbjct: 184 ERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQ--------------TKSCVATLEGHMS 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  +++W  S
Sbjct: 230 NVSFAVFHPTLP-IIISGSEDGTLKIWNSS 258

>Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa]
           {ON} YGL137W (REAL)
          Length = 891

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N +I GSDDF I +++ ++G    K V    H D +   + H     +  S S+D T+KL
Sbjct: 62  NWIIVGSDDFRIRVFNYNTGE---KVVDFEAHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 117

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +  +   +  T +    F   +AF+      FA+  LD  + ++   Q+T    +  G 
Sbjct: 118 WNWENNWALEQTFEGHEHFVMCVAFNPKDPTTFASGCLDRTVKVWSLGQSTPNFTLTTGQ 177

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   +++   D  + +WD                +   +    GH S
Sbjct: 178 ERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQ--------------TKSCVATLEGHMS 223

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  +++W  S
Sbjct: 224 NVSFAVFHPTLP-IIISGSEDGTLKIWNSS 252

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 83/168 (49%), Gaps = 14/168 (8%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +++G  D T  +WD D  +++PK V  N H + V   SW   D  +  + S
Sbjct: 152 AFAPHTSSRVVTGGGDNTARIWDCD--TQTPK-VTLNGHRNWVLCVSW-SADGEVIATGS 207

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTL-------AFSKHSANLFAAAGLDTNIYLYDR 272
            D+T++L D  S   + + ++  + + T             S    A+A  D  I ++D 
Sbjct: 208 MDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDS 267

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
            +    L  + GH ++++C+++    +GIL SG  D+ V  WD+ + G
Sbjct: 268 SRRV-CLMTLGGHTNSVSCVKW--GGEGILYSGSHDKTVRAWDMKQNG 312

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 94/246 (38%), Gaps = 55/246 (22%)

Query: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNP------NVSNELISG 172
           D  +IAT + +  + ++D    +   L   L+ H +    L++ P           L S 
Sbjct: 199 DGEVIATGSMDNTIRLWDAESGKP--LGDALRGHSKWITSLTWEPIHLVEPGSKPRLASA 256

Query: 173 SDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRST 232
           S D TI +WD    S+    +    H++ V+   W    E +  S S D T++  D +  
Sbjct: 257 SKDGTIRIWD---SSRRVCLMTLGGHTNSVSCVKWG--GEGILYSGSHDKTVRAWDMKQN 311

Query: 233 SKVINTIQAKAAF-NTLAFSKHSA------------------------------------ 255
            K IN +++ A + N L+ S   A                                    
Sbjct: 312 GKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGK 371

Query: 256 --NLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDG-ILVSGGADRRVI 312
              L   A  D  ++L++  + TKP+  M GH+  +  + F P  DG  +VS   D  + 
Sbjct: 372 HEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP--DGKYIVSASFDNSIK 429

Query: 313 LWDLAE 318
           LWD  E
Sbjct: 430 LWDGKE 435

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 44/108 (40%), Gaps = 25/108 (23%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEA 328
           ++  +  T+    +AGH   I C  F P     +V+GG D    +WD             
Sbjct: 128 VFKVKPITRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIWD------------C 175

Query: 329 DDGSPEILMIHAGHRSAINDFTLHPTIPW-----LSASVEEDNVVQVW 371
           D  +P++ +   GHR+ +        + W     + A+   DN +++W
Sbjct: 176 DTQTPKVTL--NGHRNWV------LCVSWSADGEVIATGSMDNTIRLW 215

>Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa]
           {ON} YGL137W (REAL)
          Length = 887

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N +I GSDDF I +++ ++G    K V    H D +   + H     +  S S+D T+KL
Sbjct: 62  NWIIVGSDDFRIRVFNYNTGE---KVVDFEAHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 117

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +  +   +  T +    F   +AF+      FA+  LD  + ++   Q+T    +  G 
Sbjct: 118 WNWENNWALEQTFEGHEHFVMCVAFNPKDPTTFASGCLDRTVKVWSLGQSTPNFTLTTGQ 177

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   +++   D  + +WD                +   +    GH S
Sbjct: 178 ERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQ--------------TKSCVATLEGHMS 223

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  +++W  S
Sbjct: 224 NVSFAVFHPTLP-IIISGSEDGTLKIWNSS 252

>AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL137W
           (SEC27); 1-intron
          Length = 832

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 88/205 (42%), Gaps = 21/205 (10%)

Query: 169 LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHD 228
           +I GSDDF I +++ ++G K    V    H D +   + H     +  S S+D T+KL +
Sbjct: 70  IIVGSDDFKIRVFNYNTGEKV---VDFEAHPDYIRALAVHPTRSYVL-SASDDLTVKLWN 125

Query: 229 KRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHED 287
                 +  T +    F  ++ F+    N FA A LD  + ++   Q T    + A  E 
Sbjct: 126 WEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEK 185

Query: 288 AITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAI 346
            +  + ++P +D   L++   DR V +WD                +   +    GH S +
Sbjct: 186 GVNFVDYYPFQDKPYLITSSDDRTVKVWDYQ--------------TKSCVATLEGHLSNV 231

Query: 347 NDFTLHPTIPWLSASVEEDNVVQVW 371
           +    HP +P +  S  ED  V++W
Sbjct: 232 SYAVYHPMLP-IIISGSEDGTVKIW 255

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 124/302 (41%), Gaps = 47/302 (15%)

Query: 111 NRARYMPKDSN-----IIATINGEGNVSIYD--------------RSKSRSDGLRTTLKY 151
           NR +  P  +N     + AT++  G V I+D               SK     + T   +
Sbjct: 228 NRLKVTPFATNNNQEILTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSH 287

Query: 152 HKENGYGLSFNPNV-SNELISGSDDFTIALWDIDSGS----KSPKSVWDNIHSDIVNDCS 206
               G+GL ++P + S  L++G     I L    +      K   SV +N     + D  
Sbjct: 288 GNVEGFGLDWSPLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKS---IEDIQ 344

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTS--KVINTIQAKAAFNTLAFSKHSANLFAAAGLD 264
           W   ++ +F +   D  +++ D RS      I+T  +    N +++++    L A+ G D
Sbjct: 345 WSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLAS-GDD 403

Query: 265 TNIY-LYDRRQ------TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA 317
             ++ ++D RQ         P+     H+ AIT + F+P ++  +     D  V LWDL+
Sbjct: 404 KGVWGVWDLRQFSPSQENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLS 463

Query: 318 ------EIGAE-QQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQV 370
                 EI  +  +  E +   P++L +H   +  + D   H  IP    S   D  + V
Sbjct: 464 VEADDEEIKQQTHETKELEQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNV 520

Query: 371 WK 372
           WK
Sbjct: 521 WK 522

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 9/164 (5%)

Query: 169 LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHD 228
           +IS S D  I LWD  SG+    ++    H+  V    +     N+  ++S+D + ++ D
Sbjct: 220 IISASKDNLIKLWDPRSGN-CVSTILKFKHT--VLKVKFQPTGGNMIAAISKDKSCRVFD 276

Query: 229 KRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQ-TTKPLHVMA-GHE 286
            R + K +  ++ +  + TL ++  + ++F     D +I  +D  Q  TKP HV+   H+
Sbjct: 277 IRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIPYAHD 336

Query: 287 DAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD 330
             +T L ++P  + IL S   DR V  W  A   +   P+  DD
Sbjct: 337 KCVTSLSYNPMGN-ILASASKDRTVRFWTRA---SPIDPNAYDD 376

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 95/220 (43%), Gaps = 18/220 (8%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H E    ++F+ N S + +S SDD  + +W+  +G    + V    H D V  C WH  +
Sbjct: 162 HTECIRDVAFSGNDS-KFVSCSDDNILKIWNFSNGKL--ERVLSGHHWD-VKSCDWHP-E 216

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
             L  S S+D+ +KL D RS + V   ++ K     + F     N+ AA   D +  ++D
Sbjct: 217 MGLIISASKDNLIKLWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFD 276

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDG 331
            R + K L  +    D +T L ++P  + +   G  D  +  +DL +           D 
Sbjct: 277 IRHSMKELLCVRDEVDYMTLL-WNPINESMFTVGNYDGSIKHFDLLQ-----------DL 324

Query: 332 SPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
           +    +I   H   +   + +P    L AS  +D  V+ W
Sbjct: 325 TKPTHVIPYAHDKCVTSLSYNPMGNIL-ASASKDRTVRFW 363

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 90/403 (22%), Positives = 161/403 (39%), Gaps = 65/403 (16%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEE-DTRQYMILGTHTSGE-----EVDYLKVAA 75
           P +Y+ +    L WP L+   +P   GSE  +  Q ++L T T        E+  LK++ 
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 76  LD---LPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDS----NIIATING 128
           L    + ++    E +DD    +  I   +        NR +  P  S     + A+++ 
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMSE 246

Query: 129 EGNVSIYDRS--------------KSRSDGLRTTLKYHKENGYGLSFNP-NVSNELISGS 173
            G V I+D                K+    + T   +    GY L ++P N S  L++G 
Sbjct: 247 NGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGD 306

Query: 174 DDFTIAL-------WDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
               + L       W  D      K+ +   ++  + D  +   +  +F +   D  +++
Sbjct: 307 CSGRVYLTQRHTSKWITD------KTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRI 360

Query: 227 HDKRSTSKVINTIQAKAA---FNTLAFSKHSANLFAAAGLDTNIYLYDRRQ-------TT 276
            D RS  K    I  KA+    N +++++    L A+   +    ++D RQ       + 
Sbjct: 361 WDTRS-KKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASV 419

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAE-QQPDEAD 329
            P+   + H+ AIT + F+P +D I+     D  V LWDL+      EI  +  +  E  
Sbjct: 420 SPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQ 479

Query: 330 DGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
              P++L +H   +  + D   H  IP    S   D  + +WK
Sbjct: 480 QIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 519

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 67/152 (44%), Gaps = 12/152 (7%)

Query: 229 KRSTSKVINTIQAKAAFNT-----LAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVM 282
           +R TSK I    A +A N      + FS+  A +FA  G D  I ++D R +  KP   +
Sbjct: 315 QRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISV 374

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGH 342
                 +  + ++ K   +L SG  +    +WDL +      P+ A   SP  +  ++ H
Sbjct: 375 KASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFS----PNNAASVSP--VAQYSFH 428

Query: 343 RSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           + AI     +P    + A   EDN V +W  S
Sbjct: 429 KGAITSIAFNPLDDSIIAVASEDNTVTLWDLS 460

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 80/170 (47%), Gaps = 15/170 (8%)

Query: 151 YHKENGY-GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHH 209
           Y+ E+ + GL  +   SN +  G     I LWDI+         W    +D +N   ++ 
Sbjct: 173 YYGEHAFQGLDHSRMTSNFVTGGP---RINLWDINRSKPLSDLSWG---ADNINTVKFNQ 226

Query: 210 FDENLFGSVSEDSTLKLHDKRS---TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
            D N+ GS   D+++ L+D R+   T K++ T++     N++ ++   A  F  A  D N
Sbjct: 227 NDANVLGSAGSDNSIVLYDLRTNSATQKIVQTMRV----NSMCWNPMEAFNFVVASEDHN 282

Query: 267 IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            Y YD R  ++ L+V   H  A+  +   P  + + V+   D+ + ++ +
Sbjct: 283 AYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEEV-VTASYDKTIRIFPI 331

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 93/193 (48%), Gaps = 24/193 (12%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIH----SDIVNDC 205
           H++  Y L+ + N  N++ SGS D  I  WD+ S  +  S K+ +  I     +  VN  
Sbjct: 66  HQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNID 125

Query: 206 SWHHFDENLFGSVSEDSTLKL----HDKRS---TSKVINT-------IQAKAAFNTLAFS 251
           S    ++N   S S+D T+KL    H+  +     +VINT          + AF  L  S
Sbjct: 126 SASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDHS 185

Query: 252 KHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRV 311
           + ++N F   G   N++  +R   +KPL  ++   D I  ++F+  +  +L S G+D  +
Sbjct: 186 RMTSN-FVTGGPRINLWDINR---SKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSI 241

Query: 312 ILWDLAEIGAEQQ 324
           +L+DL    A Q+
Sbjct: 242 VLYDLRTNSATQK 254

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 11/117 (9%)

Query: 126 INGEGNVSIYD--RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDI 183
           + G   ++++D  RSK  SD     L +  +N   + FN N +N L S   D +I L+D+
Sbjct: 192 VTGGPRINLWDINRSKPLSD-----LSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDL 246

Query: 184 DSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ 240
            + S + K V     +  VN   W+  +   F   SED     +D R+ S+ +N  +
Sbjct: 247 RTNSATQKIV----QTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFK 299

>KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.239
           YGL137W
          Length = 911

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 89/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N ++ GSDDF + +++ ++G K         H D +   + H     +    S+D T+KL
Sbjct: 68  NWIVVGSDDFRLRIFNYNTGEKISDF---EAHPDYIRSIAVHPTKPYVITG-SDDLTVKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +      +  T +    F  ++AF+    N FA+  LD  + ++   Q+     ++ G 
Sbjct: 124 WNWEKNWALEQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQSQPNFTLVTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   L++   D  V +WD                +   +    GH +
Sbjct: 184 EKGVNYVDYYPLPDKPYLLTASDDMTVKIWDYQ--------------TKSCVATLEGHMA 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  V++W  S
Sbjct: 230 NVSFAIFHPTLP-IIISGSEDGTVKIWNSS 258

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 67/175 (38%), Gaps = 5/175 (2%)

Query: 144 GLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVN 203
            L  T + H      ++FNP   N   SG  D T+ +W +  G   P           VN
Sbjct: 131 ALEQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSL--GQSQPNFTLVTGQEKGVN 188

Query: 204 DCSWHHF-DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAG 262
              ++   D+    + S+D T+K+ D ++ S  + T++   A  + A    +  +  +  
Sbjct: 189 YVDYYPLPDKPYLLTASDDMTVKIWDYQTKS-CVATLEGHMANVSFAIFHPTLPIIISGS 247

Query: 263 LDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA 317
            D  + +++         +  G E +  C+  HP      ++ G D    +  L 
Sbjct: 248 EDGTVKIWNSSTYKIEKTLNLGLERS-WCIASHPTGKKNYIAAGFDNGFTVLSLG 301

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 214 LFGSVSEDSTLKLHDKRSTSKVINT-IQAKAAFNTLAFSKHSANLFAAA----GLDTNIY 268
           LF + + +S +K+ D  ST +V     Q    F +L  S+H   L A      G+D  IY
Sbjct: 77  LFTTATSNS-VKIFDIHSTKEVATIHSQGNVPFPSLD-SRHG--LLACGTELKGVDAAIY 132

Query: 269 LYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAE 322
           +YD R+  +P+  +   H D +TCL++HP +  IL+SG  D    ++DL+E   E
Sbjct: 133 IYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/321 (22%), Positives = 140/321 (43%), Gaps = 55/321 (17%)

Query: 83  VTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRS 142
           ++ +AN+     ++ +        D  I    + P D   +AT   +  + I+D S  R 
Sbjct: 354 ISQDANNSGENGENAVSSASTSSSDLYIRSVCFSP-DGKFLATGAEDKLIRIWDLSTKR- 411

Query: 143 DGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKS-PKSVWDNIHSDI 201
             +  TL+ H+++ Y L + P+  ++L+SGS D T+ +WD+ +G  S   S+ D + +  
Sbjct: 412 --IVMTLQGHEQDIYSLDYFPS-GDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVA 468

Query: 202 VNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNT--------LAFSKH 253
           V+       +     + S D TL++ D   T  ++  + ++    T        + F++ 
Sbjct: 469 VSPG-----EGKFIAAGSLDRTLRVWDSE-TGFLVERLDSENELGTGHKDSVYSVVFTRD 522

Query: 254 SANLFAAAGLDTNIYLYDRRQT-------TKPLHVMA-----GHEDAITCLQFHPKEDGI 301
              + + + LD ++ L++   T       +KP          GH+D +  +    + D  
Sbjct: 523 GQGVVSGS-LDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATT-QNDKY 580

Query: 302 LVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAI------NDFTLHPTI 355
           ++SG  DR V+ WD               G+P  L++  GHR+++      N F L P  
Sbjct: 581 ILSGSKDRGVLFWD------------TQSGNP--LLMLQGHRNSVISVAVANGFPLGPDY 626

Query: 356 PWLSASVEEDNVVQVWKCSKN 376
             + A+   D   ++WK SKN
Sbjct: 627 -GVFATGSGDCKARIWKYSKN 646

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 82/167 (49%), Gaps = 13/167 (7%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           GL ++P+  N L+SG  D  + LWD+ S S          H+  V+    H     L  S
Sbjct: 220 GLDWHPD-GNHLLSGGGDNLVKLWDMTSNSFEEL----RGHAGRVSRVKVHP-SGRLAAS 273

Query: 218 VSEDSTLKLHD-KRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT 276
            S D T  L D +R     +    +KA + T+AF    A L A+AGLD    ++D R + 
Sbjct: 274 ASFDLTWILWDLERKVELQLQEGHSKAVY-TIAFQSDGA-LLASAGLDAVCAIWDLR-SG 330

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGI-LVSGGADRRVILWDLAEIGAE 322
           +P+  + GH  AI+ + + P  +G  L + GAD  V +WD+  +G E
Sbjct: 331 EPIMKLEGHAGAISGVDWSP--NGYQLATAGADGTVRVWDIRNVGTE 375

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 41/95 (43%), Gaps = 17/95 (17%)

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGH 342
           A HE  I  L +HP  + +L SGG D  V LWD+               S E L  HAG 
Sbjct: 212 AAHEGKIGGLDWHPDGNHLL-SGGGDNLVKLWDMTS------------NSFEELRGHAGR 258

Query: 343 RSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
            S +    +HP+   L+AS   D    +W   + +
Sbjct: 259 VSRVK---VHPS-GRLAASASFDLTWILWDLERKV 289

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 98/204 (48%), Gaps = 31/204 (15%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F PN S+ +++G+ D T  +WD D  +++PK+      + ++  C  +  +  +  + S
Sbjct: 150 AFAPNTSSRMVTGAGDNTARIWDCD--TQTPKATLTGHFNWVL--CVSYCPNGEVIATGS 205

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNT-LAF------SKHSANLFAAAGLDTNIYLYD- 271
            D+T++L D +    + + ++    + T LA+          +   A+A  D  I ++D 
Sbjct: 206 MDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDI 265

Query: 272 -RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD 330
            RR     L+ M+GH ++++C+++  +  GI+ SG  D+ V +WD+           AD 
Sbjct: 266 TRRVC---LYTMSGHTNSVSCIKWSGQ--GIIYSGSHDKTVRVWDM----------NADG 310

Query: 331 GSPEILMIHA---GHRSAINDFTL 351
               IL  HA    H S   D+ L
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYAL 334

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 95/245 (38%), Gaps = 52/245 (21%)

Query: 115 YMPKDSNIIATINGEGNVSIYDR--SKSRSDGLRTTLKYHKENGYGLS--FNPNVSNELI 170
           Y P +  +IAT + +  + ++D    K   D LR  LK+     +       P  S  L 
Sbjct: 194 YCP-NGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLA 252

Query: 171 SGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           S S D TI +WDI   ++       + H++ V+   W    + +  S S D T+++ D  
Sbjct: 253 SASKDGTIRIWDI---TRRVCLYTMSGHTNSVSCIKWS--GQGIIYSGSHDKTVRVWDMN 307

Query: 231 STSKVINTIQAKA------------AFNTLAFSKHSAN---------------------- 256
           +  K IN +++ A            A    AF    A                       
Sbjct: 308 ADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKN 367

Query: 257 -----LFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDG-ILVSGGADRR 310
                L   A  D  ++L++  ++ KP+  M GH+  +  + F P  DG  +VS   D  
Sbjct: 368 GKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP--DGRYIVSASFDNS 425

Query: 311 VILWD 315
           + LWD
Sbjct: 426 IKLWD 430

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  +  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDC 173

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 95  KSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKE 154
           KSN  I +   H   +N   + P D   I + + + ++ ++D    R     +T + H  
Sbjct: 390 KSNKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWD---GRDGKFISTFRGHVA 445

Query: 155 NGYGLSFNPNVSNELISGSDDFTIALWDI 183
           + Y ++++ +    L+S S D T+ +WD+
Sbjct: 446 SVYQVAWSADC-RLLVSCSKDTTLKVWDV 473

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 56/124 (45%), Gaps = 21/124 (16%)

Query: 250 FSKHSANLFAAAGLDTN--IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGA 307
           FS    NLFA A  D    ++  DR     P+ ++AGH   + C+ FHP    +  +G +
Sbjct: 810 FSPTGNNLFATASSDNTARVWSCDR---VYPVRILAGHLSDVDCVSFHPNGQYVF-TGSS 865

Query: 308 DRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNV 367
           D+   +WDL+              S + + +  GH SA+    + P   WLS +  ED  
Sbjct: 866 DKTSRMWDLS--------------SGDSVRLFIGHSSAVTATAVSPDGRWLS-TANEDGT 910

Query: 368 VQVW 371
           + VW
Sbjct: 911 ITVW 914

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 38/102 (37%), Gaps = 15/102 (14%)

Query: 274 QTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSP 333
           Q       + GH DA+  + F P  +  L+SG  D+   LW                   
Sbjct: 748 QINSIFKTLVGHSDAVYSVNFSPC-NRFLLSGSGDKTARLWSTDTYKG------------ 794

Query: 334 EILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
             L+ + GH   I D    PT   L A+   DN  +VW C +
Sbjct: 795 --LVSYKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCDR 834

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 148 TLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSW 207
           + K H++  + ++F+P  +N   + S D T  +W  D     P  +     SD+  DC  
Sbjct: 797 SYKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCDR--VYPVRILAGHLSDV--DCVS 852

Query: 208 HHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNI 267
            H +     + S D T ++ D  S   V   I   +A    A S       + A  D  I
Sbjct: 853 FHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSP-DGRWLSTANEDGTI 911

Query: 268 YLYDRRQTTKPLHVMAGH-EDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
            ++D   + K L  M GH +++I  L ++ K   ILVS GAD  V +WD+ +
Sbjct: 912 TVWDI-GSGKKLKSMRGHGKNSIYSLSYN-KTGNILVSSGADNSVRVWDIKK 961

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 66/145 (45%), Gaps = 21/145 (14%)

Query: 123  IATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWD 182
            ++T N +G ++++D    +   L++   + K + Y LS+N    N L+S   D ++ +WD
Sbjct: 902  LSTANEDGTITVWDIGSGKK--LKSMRGHGKNSIYSLSYNK-TGNILVSSGADNSVRVWD 958

Query: 183  IDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQA- 241
            I   +  P    + I+  + ND            S+++D  +K + +R T    N + A 
Sbjct: 959  IKKNTHEPSLEPEEIYPGLGNDN---------VTSMNQD--IKEYGRRRTIVATNDLMAT 1007

Query: 242  ----KAAFNTLAFSKHSANLFAAAG 262
                K     + ++  SANL  A G
Sbjct: 1008 YFTKKTPVYKVKYT--SANLLLAGG 1030

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
           YOL138C (REAL)
          Length = 1332

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 81/203 (39%), Gaps = 31/203 (15%)

Query: 121 NIIATINGEGNVSIYDRSKSRS--DGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N IA  N    +SIYD +KS S  + L T+L  H  +     FN   SN +ISG  D  +
Sbjct: 225 NCIAVCNNSTAISIYDLNKSSSIENPLITSLCEHTRSINSFDFNMVESNLIISGGQDSCV 284

Query: 179 ALWDIDSGSKSPKSVWD---NIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKV 235
            +WD+ S +    +  D   N  SD + D  W       F S +E  +    + +S  K 
Sbjct: 285 KIWDLRSNTSKSSNRADININTASDSIRDVKW--MPGYNFASKNEQGSSTYGNSKSGYK- 341

Query: 236 INTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFH 295
                                 FA+      +  +D RQ  +    +  H     CL +H
Sbjct: 342 ----------------------FASIHDSGYLLKFDLRQPAQYEKKLNAHTGPGLCLSWH 379

Query: 296 PKEDGILVSGGADRRVILWDLAE 318
           P ++ I  +GG D +  LW + E
Sbjct: 380 PHQEYI-ATGGRDGKCSLWYVGE 401

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 68/181 (37%), Gaps = 24/181 (13%)

Query: 141 RSDGLRTTLKYHKENGYGLSFN-PNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHS 199
           +S GL  T K +KE       N PN++  + +G     +  +      +S K V D I  
Sbjct: 128 KSSGLIYTTKMNKELSSIDKVNDPNINGLVCAGKTH--LGFYKFSPSDRSIKCVHDFITP 185

Query: 200 DIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFA 259
           +            N    V+     KL  +   +K       K  FN         N  A
Sbjct: 186 N-----------NNTSTKVATSLLPKLSKRTRQNKFSTIADVKTGFNNYK------NCIA 228

Query: 260 AAGLDTNIYLYDRRQTT---KPLHV-MAGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
                T I +YD  +++    PL   +  H  +I    F+  E  +++SGG D  V +WD
Sbjct: 229 VCNNSTAISIYDLNKSSSIENPLITSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWD 288

Query: 316 L 316
           L
Sbjct: 289 L 289

>ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [2694
           bp, 897 aa] {ON} highly similar to uniprot|P41811
           Saccharomyces cerevisiae YGL137W SEC27 Involved in
           beta'-subunit of yeast coatomer
          Length = 897

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 89/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N +I G DD+ I +++ ++G K    V    H D +   + H     L  S S+D T+KL
Sbjct: 68  NWIIVGCDDYRIRVFNYNTGEKV---VDFEAHPDYIRSIAVHPTKPYLL-SGSDDLTVKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +      +  T +    F   +AF+    + FA+  LD+ + ++   Q T    +  G 
Sbjct: 124 WNWEKNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDSTVKVWSLGQPTPNYTLTTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   +++   D  V +WD                +   +    GH S
Sbjct: 184 ERGVNFVDYYPLPDKPYMITSSDDLTVKIWDYQ--------------TKSCVATLEGHMS 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  +++W  S
Sbjct: 230 NVSFAVFHPTLP-VIISGSEDGTLKIWNAS 258

>TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 888
           aa] {ON} 
          Length = 888

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N ++ GSDDF I +++ ++G K         H D +   + H     +  S S+D T+KL
Sbjct: 68  NWIVVGSDDFRIRIFNYNTGEKVSDF---EAHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +      +  T +    F  ++AF+    + FA+  LD  + ++   Q++    +  G 
Sbjct: 124 WNWEKNWALEQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVWSLGQSSPNFTLTTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   L++   D  V +WD                +   +    GH S
Sbjct: 184 EKGVNYVDYYPLPDKPYLITSSDDFSVKIWDYQ--------------TKSCVATLEGHMS 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HP++P +  S  ED  V++W  +
Sbjct: 230 NVSFAVFHPSLP-IIVSGSEDGTVKLWSST 258

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 67/166 (40%), Gaps = 5/166 (3%)

Query: 144 GLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVN 203
            L  T + H+     ++FNP   +   SG  D T+ +W +  G  SP           VN
Sbjct: 131 ALEQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVWSL--GQSSPNFTLTTGQEKGVN 188

Query: 204 DCSWHHF-DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAG 262
              ++   D+    + S+D ++K+ D ++ S  + T++   +  + A    S  +  +  
Sbjct: 189 YVDYYPLPDKPYLITSSDDFSVKIWDYQTKS-CVATLEGHMSNVSFAVFHPSLPIIVSGS 247

Query: 263 LDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
            D  + L+    T K L  M    +   C+  HP      ++ G D
Sbjct: 248 EDGTVKLWS-STTYKVLKTMNLGLERAWCVATHPTGKKNYIAAGFD 292

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 85/203 (41%), Gaps = 34/203 (16%)

Query: 121 NIIATINGEGNVSIYD--RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N +A  +    +SIYD  RSKS ++ L ++ + H  +     FN   +N +ISG  D  I
Sbjct: 193 NYVAVSSNSTVISIYDINRSKSTNNPLVSSFQQHTRSINSFDFNMVHTNLIISGGQDGCI 252

Query: 179 ALWDIDSGSKSPKSVWDNIHSDIVNDCSW---HHFDENLFGSVSEDSTLKLHDKRSTSKV 235
            +WD+ S + +   V  +  SD V D  W   H+F     G +   S             
Sbjct: 253 KIWDLRSNNPNRCDVSISTSSDSVRDVKWMPYHNFSSTPTGGLEASSE------------ 300

Query: 236 INTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFH 295
            N++  K A      S H + L            +D RQ  +    +  H     CL +H
Sbjct: 301 -NSMGYKFA------SIHDSGLLLK---------FDIRQPNQVEQKINAHTGPGLCLNWH 344

Query: 296 PKEDGILVSGGADRRVILWDLAE 318
           P  + I  +GG D ++ +W+L +
Sbjct: 345 PNLNYI-TTGGRDGKLCVWNLGD 366

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 105/220 (47%), Gaps = 21/220 (9%)

Query: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKY--HKENGYGLSFNPNVSNELISGSDDF 176
           ++ IIA     G++ +Y  ++  +D + +  K+  H  +   + FN    N L SG ++ 
Sbjct: 73  NNKIIAGALDNGSLELYSTNE-VNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 177 TIALWDIDSGSKSPK-----SVWDNIHS-DIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
            I +WD++  ++SP      +   ++ S D VN  +W+    ++F S    +   + D +
Sbjct: 132 EIFIWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 231 STSKVINTIQA------KAAFNTLAF-SKHSANLFAAAGLDTN--IYLYDRRQTTKPLHV 281
           +  +VI+          K   + + +  K+S  +  A G D +  I ++D R    PL  
Sbjct: 192 AKKEVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQT 251

Query: 282 M-AGHEDAITCLQFHPKEDGILVSGGADRRVILW--DLAE 318
           +  GH+  I  L +  +++ +L+S G D  V+LW  +LAE
Sbjct: 252 LNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPELAE 291

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 216 GSVSEDSTLKLHD--KRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRR 273
            + S DS+L+L       + K I ++Q  + FN L +S H+  + A A  + ++ LY   
Sbjct: 34  ANFSSDSSLELWSLLASDSEKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTN 92

Query: 274 QTTKPLHVMA---GHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           +    +  MA    H  ++  ++F+ K+D +L SGG +  + +WD+
Sbjct: 93  EVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDM 138

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 104/262 (39%), Gaps = 33/262 (12%)

Query: 135 YDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSD--------DFTIALWDIDSG 186
           Y   K+    L +   +    GYGL ++P +    I   D          T + W  D  
Sbjct: 266 YQIPKTAQKPLHSIRNHGNVEGYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTD-- 323

Query: 187 SKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTS--KVINTIQAKAA 244
            K P +V +N     + D  W   +  +F +   D  +++ D RS      ++ + +   
Sbjct: 324 -KQPFTVGNNKS---IEDIQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTD 379

Query: 245 FNTLAFSKHSANLFAAAGLDTNIYLYDRRQ-------TTKPLHVMAGHEDAITCLQFHPK 297
            N +++++    L A+        ++D RQ        T P+     H+ AIT + F+P 
Sbjct: 380 VNVMSWNEKIGYLLASGDDSGTWGVWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPL 439

Query: 298 EDGILVSGGADRRVILWDLA------EIGAE-QQPDEADDGSPEILMIHAGHRSAINDFT 350
           ++ I+     D  V LWDL+      EI  +  +  E     P++L +H   +  + D  
Sbjct: 440 DESIIAVASEDNTVTLWDLSVEADDEEIKQQTAETAELQQIPPQLLFVH--WQRDVKDVK 497

Query: 351 LHPTIPWLSASVEEDNVVQVWK 372
            H  IP    S   D  + +WK
Sbjct: 498 WHRQIPGCLVSTGTDG-LNIWK 518

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 9/145 (6%)

Query: 232 TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD-RRQTTKP-LHVMAGHEDAI 289
           T K   T+    +   + +S+    +FA  G+D +I ++D R +  KP L VM    D +
Sbjct: 322 TDKQPFTVGNNKSIEDIQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTD-V 380

Query: 290 TCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDF 349
             + ++ K   +L SG       +WDL +  A+      +  +P  +  +  H++AI   
Sbjct: 381 NVMSWNEKIGYLLASGDDSGTWGVWDLRQFSAQN----TEKTTP--VAQYNFHKAAITSI 434

Query: 350 TLHPTIPWLSASVEEDNVVQVWKCS 374
           + +P    + A   EDN V +W  S
Sbjct: 435 SFNPLDESIIAVASEDNTVTLWDLS 459

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 77/160 (48%), Gaps = 18/160 (11%)

Query: 169 LISGSDDFTIALWDIDSGSKSPKSVWDNI-------HSDI--VNDCSWHHFDENLFGSVS 219
            ++G+++ T++LW++D+   +   + + +       HS +  +ND  W+  D+ +F +  
Sbjct: 64  FLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMFFTCG 123

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIY--LYDRRQTTK 277
            D  +KL D   T+K IN       FN+  F   +AN F    LD + Y  L D R    
Sbjct: 124 NDKFVKLWD---TNKFINV--QDLEFNSNLFQMDTANQFILVTLD-DYYPRLIDLRNMNL 177

Query: 278 PLHVMAGHEDAIT-CLQFHPKEDGILVSGGADRRVILWDL 316
            + +   H ++ T C + +P  D ++ S   D  + +WD+
Sbjct: 178 GITIFGKHLNSKTLCCKINPVRDNLIASSDNDGMIRIWDV 217

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 104/233 (44%), Gaps = 19/233 (8%)

Query: 88  NDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRT 147
           N+  R  ++ I  VK   H G I    + P D+ ++ + + +  + ++      S   RT
Sbjct: 534 NEKTRSQETPITTVKLVGHSGAIYSTSFSP-DNKLLVSASEDKTIRLW------SMDTRT 586

Query: 148 TL---KYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           TL   K H    + + F+P V +   + S D T  LW  D     P  ++    SD+  D
Sbjct: 587 TLVTYKGHNHPVWDVQFSP-VGHYFATASHDQTARLWSCDH--IFPLRIFSGHISDV--D 641

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLD 264
           C   H +     + S D T ++ D  +   V   I   A   ++A +     L A    D
Sbjct: 642 CVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRL-ATGSED 700

Query: 265 TNIYLYDRRQTTKPLHVMAGH-EDAITCLQFHPKEDGILVSGGADRRVILWDL 316
             I+++D   T K L  + GH + A+  L ++ KE  ILVSGG+D  V +WDL
Sbjct: 701 GVIHIWDI-GTGKSLKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIWDL 751

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 127/334 (38%), Gaps = 66/334 (19%)

Query: 26  LMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEEVDYLKVAALDLPDEVVTG 85
           L +D V+E  +T+P  T QW P S    R++            D L++ +          
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQP-SMTHPRRFATCS--------DSLRIWSF--------- 191

Query: 86  EANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDG- 144
              + N + + N+ + K   +D +   A      S + A   G G++    + +    G 
Sbjct: 192 CEEERNLQEQINLSLCK---YDKQQQGA------SRVNAAAGGSGSIRTNPQQQQGLIGE 242

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           L     +H        +NP   N LIS S D T  +WD+ S +     +    H   V D
Sbjct: 243 LPPITSFH--------WNPVDPNLLISSSIDTTCIVWDLQSSNYVRTQLI--AHDSEVYD 292

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAF-------------- 250
             +      LF S   D ++++ D R  +      +  ++  TL                
Sbjct: 293 VRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSSSAADSDT 352

Query: 251 ---------SKHSANLFAAAGLDT-NIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDG 300
                    S    N+ A   +D+  + + D R    P+ V+ GH  A+  +++HP +  
Sbjct: 353 GVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRN 412

Query: 301 ILVSGGADRRVILWDLAEI----GAEQQPDEADD 330
           +L+S   D +V+ WDL         +Q PD A D
Sbjct: 413 VLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVD 446

>Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa]
           {ON} YGL137W (REAL)
          Length = 897

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 89/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N +I GSDDF I  ++ ++G    K V    H D +   + H     +  S S+D T+KL
Sbjct: 68  NWIIVGSDDFRIRAFNYNTGE---KVVDFEAHPDYIRSIAVHPTKPYVL-SGSDDLTIKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +  +   +  T +    F   +AF+      FA+  LD  + ++   Q+T    +  G 
Sbjct: 124 WNWENNWALEQTFEGHEHFVMCVAFNPKDPTTFASGCLDRTVKVWSLGQSTPNFTLTTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   +++   D  + +WD                +   +    GH S
Sbjct: 184 ERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQ--------------TKSCVATLEGHMS 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  +++W  S
Sbjct: 230 NVSFAVFHPTLP-VIISGSEDGTLKIWNSS 258

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/356 (22%), Positives = 153/356 (42%), Gaps = 59/356 (16%)

Query: 48  GSEEDTRQYMILGTHTSGEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEHD 107
           G  + T+ Y +    ++GE +  L   A   P      +A+  +   K++  +      D
Sbjct: 418 GCNKTTQVYKV----STGELIARLSEDASSAPS---GADASATSENAKASPAVATSASSD 470

Query: 108 GEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSN 167
             I    + P D   +AT   +  + I+D +  R   +  TL+ H+++ Y L + P+  +
Sbjct: 471 LYIRSVCFSP-DGKFLATGAEDKLIRIWDLATRR---IVMTLQGHEQDIYSLDYFPS-GD 525

Query: 168 ELISGSDDFTIALWDIDSGSKS-PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           +L+SGS D T+ +WD+ +G  S   S+ D + +  V+       D  L  + S D T+++
Sbjct: 526 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPG-----DGKLIAAGSLDRTVRI 580

Query: 227 HDKRSTSKVINTIQAKAAFNT--------LAFSKHSANLFAAAGLDTNIYLYDRRQ---- 274
            D   T  ++  + ++    T        + F++    + + + LD ++ L++ R     
Sbjct: 581 WDSE-TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGS-LDRSVKLWNLRSANGG 638

Query: 275 -------TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDE 327
                  T        GH+D +  +    + D  ++SG  DR V+ WD            
Sbjct: 639 TAEGKANTAASEVTYTGHKDFVLSVATT-QNDEFILSGSKDRGVLFWD------------ 685

Query: 328 ADDGSPEILMIHAGHRSAINDFTL---HPTIP--WLSASVEEDNVVQVWKCSKNLS 378
              G+P +LM+  GHR+++    +   HP  P   + A+   D   ++WK SK  S
Sbjct: 686 TPSGNP-LLMLQ-GHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQTS 739

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 143/319 (44%), Gaps = 51/319 (15%)

Query: 80  DEVVTGEANDD--NRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDR 137
           +E  TG AN+   +   +++  I      D  I    + P D   +AT   +  + I+D 
Sbjct: 323 NEASTGPANNGTADNGGENSATIQPASSSDLYIRSVCFSP-DGKYLATGAEDKLIRIWDL 381

Query: 138 SKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKS-PKSVWDN 196
           +  +   +  TL+ H+++ Y L + P   ++L+SGS D T+ +WD+ +G  S   S+ D 
Sbjct: 382 TTKK---ILMTLQGHEQDIYSLDYFP-AGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDG 437

Query: 197 IHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNT--------L 248
           + +  V+       D     + S D T+++ D   T  ++  + ++   +T        +
Sbjct: 438 VTTVAVSPG-----DGKYIAAGSLDRTVRVWDSE-TGFLVERLDSENELSTGHKDSVYSV 491

Query: 249 AFSKHSANLFAAAGLDTNIYLYDRRQTT-KPLHVMA-----GHEDAITCLQFHPKEDGIL 302
            F++    + + + LD ++ L+D R    +  H        GH+D +  +    ++D  +
Sbjct: 492 VFTRDGQGVISGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATT-QDDEYI 549

Query: 303 VSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR------SAINDFTLHPTIP 356
           +SG  DR V+ WD A             G+P  L++  GHR      + +N F L P + 
Sbjct: 550 LSGSKDRGVLFWDTAS------------GNP--LLMLQGHRNSVISVAVVNGFPLGPDV- 594

Query: 357 WLSASVEEDNVVQVWKCSK 375
            + A+   D   ++WK +K
Sbjct: 595 GVFATGSGDCKARIWKYTK 613

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 76/174 (43%), Gaps = 9/174 (5%)

Query: 141 RSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSD 200
           + DGL  T  Y     +GL  + N S  +  G+    I LWD +         W    +D
Sbjct: 162 KGDGLLKTY-YGDHAFFGLDHHRNNSTFVTGGAQ---IQLWDANRSKPISNLTWG---AD 214

Query: 201 IVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAA 260
            V    ++  + ++  S   D+++ L+D R+ S     I+     N + ++   A  F  
Sbjct: 215 NVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPT-QKIRQSMRTNAICWNPMEAFNFVI 273

Query: 261 AGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILW 314
           A  D N Y YD R  ++ L+V   H  A+  + F P  D I V+G  D+ + ++
Sbjct: 274 ANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIY 326

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 67/165 (40%), Gaps = 42/165 (25%)

Query: 158 GLSFNPNVS----NE--LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           GL   P  S    NE  +IS  DD T+ LW +DS                          
Sbjct: 115 GLCVRPETSATNKNEHYMISCGDDKTVKLWSVDS-------------------------- 148

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
            N F +  +D T+   D      ++ T     AF  L   ++++  F   G    ++  +
Sbjct: 149 -NDFSNNKKDDTIHKGDG-----LLKTYYGDHAFFGLDHHRNNST-FVTGGAQIQLWDAN 201

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           R   +KP+  +    D +T ++F+  E  IL S G+D  ++L+DL
Sbjct: 202 R---SKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDL 243

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 98/218 (44%), Gaps = 21/218 (9%)

Query: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKY--HKENGYGLSFNPNVSNELISGSDDF 176
           D+ IIA     G+V ++  +   +D L++  K+  HK       FN    N L +G    
Sbjct: 73  DNKIIAGALDNGSVELFSYN---ADSLKSEAKFQRHKTTAKVARFNAKQFNVLATGGTKG 129

Query: 177 TIALWDIDSGSKSPKS----VWDNIHSDI--VNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
            I +WD++   ++P         N  + +  +   +W+    ++F S    S   + D +
Sbjct: 130 EIFIWDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLK 189

Query: 231 STSKVIN------TIQAKAAFNTLAF-SKHSANLFAAAGLDTN--IYLYDRRQTTKPLHV 281
           +  +VI+          KA  + + +  K+S  +  A G D +  I ++D R    PL V
Sbjct: 190 AKKEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQV 249

Query: 282 MA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
           ++ GH   +  L +  +++ +L+S G D  V+LW+  E
Sbjct: 250 LSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQE 287

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 93/216 (43%), Gaps = 21/216 (9%)

Query: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENG--YGLSFNPNVSNELISGSDDF 176
           D  IIA     G V  +D        L++  K HK  G    L FN   +N L+SG    
Sbjct: 73  DDKIIAGALENGVVEFFD-----PKALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQG 127

Query: 177 TIALWD---IDSGSKSPKSV-WDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRST 232
            I +WD   I S   SP S    N   D V+  SW+    ++F S S      + D ++ 
Sbjct: 128 EIFVWDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAK 187

Query: 233 SKVI------NTIQAKAAFNTLAFSKHSANLFA-AAGLDTN--IYLYDRRQTTKPLHVMA 283
            +V+      +T   K     + +   S+ + A A+  DT   +  +D R    PL V++
Sbjct: 188 KQVLHLNHSSSTTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLS 247

Query: 284 -GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
            GH   +  L +  +++ +L+S G D   +LW+  E
Sbjct: 248 QGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQE 283

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 4/105 (3%)

Query: 219 SEDSTLKLHDKRS--TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT 276
           S  STL+L    S   SK   ++ A   FN L +S    +   A  L+  +  +   +  
Sbjct: 37  SSTSTLELWSLLSFDGSKPSGSVVADGKFNDLDWSGD--DKIIAGALENGVVEFFDPKAL 94

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGA 321
           K +  +  H+  +  L+F+ K++ +LVSGG    + +WD  +IG+
Sbjct: 95  KSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIGS 139

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 90/182 (49%), Gaps = 16/182 (8%)

Query: 146 RTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGS-KSPKSVWDNIHSDIVND 204
           +   +Y +EN + L   P   + L++   D ++ L  +D G+ K+  S+    H+  +ND
Sbjct: 5   KYKCRYFEENNWCLKLQPLYQHGLMTSISDGSVHL--LDWGNLKTISSI--QCHTTSIND 60

Query: 205 CSWHHFDEN---LFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAA 261
               + D +   +F + +ED  +K+ D R+ + V +    KA+      S+H  N+ A  
Sbjct: 61  MKVINSDFDTGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPFFSLDSRH--NMLACG 117

Query: 262 ----GLDTNIYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
                 D  +++YD R  TKP+      H D IT ++FHP +  +L+SG  D  V ++DL
Sbjct: 118 TELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDL 177

Query: 317 AE 318
            +
Sbjct: 178 TQ 179

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 75/196 (38%), Gaps = 26/196 (13%)

Query: 121 NIIATINGEGNVSIYD--RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N +A       VS++D  R+      L ++L  H  +     FN   +N LISG  D  +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 179 ALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINT 238
            +WDI +          N  + IVN C         FGS+ +   +  ++     +    
Sbjct: 265 KIWDIRT----------NNPTKIVNTCDVR--INTTFGSIRDIKWMPGYNFSGNDR---- 308

Query: 239 IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKE 298
                  N      H    FA+      +  +D RQ  +P   +  H     CL +HP +
Sbjct: 309 -------NYTDLRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHPHQ 361

Query: 299 DGILVSGGADRRVILW 314
           D I  SGG D +  LW
Sbjct: 362 DYI-ASGGRDGKCCLW 376

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 256 NLFAAAGLDTNIYLYD---RRQTTKPL-HVMAGHEDAITCLQFHPKEDGILVSGGADRRV 311
           N  A     T + L+D     QT   L   +A H  ++    F+  +  +L+SGG D  V
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 312 ILWDL 316
            +WD+
Sbjct: 265 KIWDI 269

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 89/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N +I GSDDF I +++ ++G    K V    H D +   + H     +  S S+D T+KL
Sbjct: 68  NWIIVGSDDFKIRVFNYNTGE---KVVDFEAHPDYIRSIAVHPTKPYVL-SGSDDLTVKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +   + ++         F   + F+    + FA+A LD  + ++   Q      ++ G 
Sbjct: 124 WNWEKSWELEQQFDGHTHFVMCVTFNPKDPSTFASACLDRTVKVWSLGQQDPNFTLVTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   +++   D  V +WD                +   +    GH S
Sbjct: 184 EKGVNYIDYYPLPDKPYMITASDDLTVKIWDYQ--------------TKSCVATLEGHMS 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  V++W  S
Sbjct: 230 NVSYAVFHPTLP-IIISGSEDGTVKIWNSS 258

>NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {ON}
           Anc_6.239 YGL137W
          Length = 888

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 86/210 (40%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N +I G DDF I +++ ++G K         H D +   + H     +  S S+D T+KL
Sbjct: 70  NWVIVGCDDFRIRVYNYNTGEKIADF---EAHPDYIRSIAVHPTKPYIL-SASDDMTIKL 125

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +      +  T Q    F   +AF+      FA+A LD  + ++   Q+T    +  G 
Sbjct: 126 WNWEKQWDLQQTFQGHEHFVMCVAFNPKDPTTFASACLDRTVKVWSLGQSTPNFTLNTGQ 185

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   LV+   D  V +WD                +   +   + H +
Sbjct: 186 EKGVNYVDYYPLPDKPYLVTASDDHTVKIWDYQ--------------TKSCVATLSKHTA 231

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HP++P +  S  ED  V  W  S
Sbjct: 232 NVSFAIFHPSLP-VIVSGSEDGQVIAWNSS 260

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 64/172 (37%), Gaps = 48/172 (27%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           L+ T + H+     ++FNP       S   D T+ +W +  G  +P    +      VN 
Sbjct: 134 LQQTFQGHEHFVMCVAFNPKDPTTFASACLDRTVKVWSL--GQSTPNFTLNTGQEKGVNY 191

Query: 205 CSWHHF-DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGL 263
             ++   D+    + S+D T+K+ D           Q K+   TL  SKH+AN+  A   
Sbjct: 192 VDYYPLPDKPYLVTASDDHTVKIWD----------YQTKSCVATL--SKHTANVSFAI-- 237

Query: 264 DTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
                                         FHP    ++VSG  D +VI W+
Sbjct: 238 ------------------------------FHPSLP-VIVSGSEDGQVIAWN 258

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 99/255 (38%), Gaps = 47/255 (18%)

Query: 142 SDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDS--------GSKSPKSV 193
           +D   TTL  H    Y  SF+P+ +  L+SGS+D T+ LW  D+        G   P  V
Sbjct: 538 NDNTSTTLIGHSGAVYSTSFSPD-NRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHP--V 594

Query: 194 WDNIHSDIVN--------------------------------DCSWHHFDENLFGSVSED 221
           WD   S + +                                DC   H +     + S D
Sbjct: 595 WDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSD 654

Query: 222 STLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHV 281
            T ++ D  +   V   +   A     A S       A    D  I L+D   T K L V
Sbjct: 655 KTCRMWDISTGDSVRLFLGHTAPVLCTAVSP-DGRWLATGSEDGIINLWDI-GTAKRLKV 712

Query: 282 MAGH-EDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           M GH ++AI  L +  KE  +LVSGGAD  V +WDL +  AE  P+  +     I  + A
Sbjct: 713 MRGHGKNAIHSLSYC-KEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEEQFVGYIGNLTA 771

Query: 341 GHRSAINDFTLHPTI 355
                I DF    TI
Sbjct: 772 SINQDIKDFGRRRTI 786

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 90/191 (47%), Gaps = 18/191 (9%)

Query: 143 DGLRTTLKY--HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSV-----WD 195
           D + +T K+  H  +   + FN    N L SG ++  I +WD++  ++SP S        
Sbjct: 96  DTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLTPGQ 155

Query: 196 NIHS-DIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVIN---TIQAKAAFNTLAF- 250
           ++ S D VN  +W+    ++F S    +   + D ++  +VI+   T         L+  
Sbjct: 156 SMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVV 215

Query: 251 ---SKHSANLFAAAGLDTN--IYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVS 304
               K+S  +  A G D +  I ++D R    PL  ++ GH+  I  L +  +++ +L+S
Sbjct: 216 EWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLS 275

Query: 305 GGADRRVILWD 315
            G D  V+LW+
Sbjct: 276 SGRDNTVLLWN 286

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 6/106 (5%)

Query: 216 GSVSEDSTLKLHDKRST--SKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY--- 270
            + S DS+L+L    +T   K + ++Q  + FN L +S H+    A A  +  + LY   
Sbjct: 34  ANFSTDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWS-HNNKTIAGALDNGTLELYSIG 92

Query: 271 DRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           D   T       + H  ++  ++F+ K+D +L SGG +  + +WD+
Sbjct: 93  DAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDM 138

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
           YOL138C (REAL)
          Length = 1336

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 79/199 (39%), Gaps = 31/199 (15%)

Query: 121 NIIATINGEGNVSIYDRSKSRS--DGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N IA  N    +SIYD +KS S  + L T+L  H  +     FN   SN +ISG  D  +
Sbjct: 227 NCIAVCNNSTAISIYDLNKSSSLDNPLVTSLCEHTRSINSFDFNMVESNLIISGGQDSCV 286

Query: 179 ALWDIDSG---SKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKV 235
            +WD+ S    S +   +  N  SD + D  W       F S +E  +    + +S  K 
Sbjct: 287 KIWDLRSSNFKSSNRSDISINTASDSIRDVKW--MPGYNFASRNEQGSSTYGNSKSGYK- 343

Query: 236 INTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFH 295
                                 FA+      +  +D RQ  +    +  H     CL +H
Sbjct: 344 ----------------------FASIHDSGYLLKFDLRQPAQYEKKLNAHTGPGLCLNWH 381

Query: 296 PKEDGILVSGGADRRVILW 314
           P ++ I  +GG D +  LW
Sbjct: 382 PHQEYI-ATGGRDGKCCLW 399

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 39/96 (40%), Gaps = 10/96 (10%)

Query: 225 KLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT---KPLHV 281
           KL  +   +K       K  FN         N  A     T I +YD  +++    PL  
Sbjct: 202 KLSKRTRQNKFSTIADVKTGFNNYK------NCIAVCNNSTAISIYDLNKSSSLDNPLVT 255

Query: 282 -MAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            +  H  +I    F+  E  +++SGG D  V +WDL
Sbjct: 256 SLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDL 291

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 97/212 (45%), Gaps = 30/212 (14%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           + NE   +GS+D TI +WD+ +G K   ++  +I +  V D         +F S SED  
Sbjct: 140 IDNEWFATGSNDTTIKIWDLATG-KLKLTLSGHIMT--VKDICISKRHPYMF-SASEDKL 195

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D      + +     +  +T+     + NL A AG D+ + L+D R T  P+  MA
Sbjct: 196 VKCWDLEKNRVIRDYHGHLSGVHTVDIHP-TLNLIATAGRDSVVRLWDIR-TKLPVMTMA 253

Query: 284 GHEDAIT---CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           GH+  I    CL   P+    +VS  AD  V LWD+               + + L +  
Sbjct: 254 GHKSPINRVKCLPVDPQ----VVSCSADATVRLWDIT--------------AGKTLKVLT 295

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            H+ ++ D  +HP    +S++  +D  ++ WK
Sbjct: 296 HHKRSVRDIGIHPGEFSISSACTDD--IRSWK 325

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 42/100 (42%), Gaps = 15/100 (15%)

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEIL 336
           K + V+ GH   +  +   P ++    +G  D  + +WDLA              + ++ 
Sbjct: 120 KLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLA--------------TGKLK 165

Query: 337 MIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           +  +GH   + D  +    P++  S  ED +V+ W   KN
Sbjct: 166 LTLSGHIMTVKDICISKRHPYM-FSASEDKLVKCWDLEKN 204

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 99/210 (47%), Gaps = 29/210 (13%)

Query: 171 SGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           +GS+D +I +WD+ SG K   ++  +I +  V D +       +F S SED T+K  D  
Sbjct: 140 TGSNDTSIKVWDLASG-KLKLTLSGHIMT--VRDLAISERHPYMF-SASEDKTIKCWDLE 195

Query: 231 STSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAIT 290
               + N     +  +T++    + +L  +AG D+ + L+D R T  P+  + GH+  I 
Sbjct: 196 KNMVIRNYHGHLSGVHTVSLHP-TLDLVVSAGRDSVVKLWDMR-TRVPVMNLIGHKSPIN 253

Query: 291 ---CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAIN 347
              CL   P+    ++S   D  + LWD+              G    ++ H  H+ ++ 
Sbjct: 254 KVRCLPVDPQ----IISCSTDANIRLWDITA------------GKSAKILTH--HKRSVR 295

Query: 348 DFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
           DF LHP+   ++++  +D  ++ WK  + +
Sbjct: 296 DFALHPSEFSMASACTDD--IRSWKLPEGI 323

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 89/215 (41%), Gaps = 16/215 (7%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNV 165
           H G +      P D+   AT + + ++ ++D +  +   L+ TL  H      L+ +   
Sbjct: 121 HIGWVRCVEVDPVDNAWYATGSNDTSIKVWDLASGK---LKLTLSGHIMTVRDLAISER- 176

Query: 166 SNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDI--VNDCSWHHFDENLFGSVSEDST 223
              + S S+D TI  WD++        V  N H  +  V+  S H    +L  S   DS 
Sbjct: 177 HPYMFSASEDKTIKCWDLEK-----NMVIRNYHGHLSGVHTVSLHP-TLDLVVSAGRDSV 230

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +KL D R+   V+N I  K+  N +        + + +  D NI L+D     K   ++ 
Sbjct: 231 VKLWDMRTRVPVMNLIGHKSPINKVRCLPVDPQIISCS-TDANIRLWD-ITAGKSAKILT 288

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
            H+ ++     HP E  +  +   D R   W L E
Sbjct: 289 HHKRSVRDFALHPSEFSMASACTDDIRS--WKLPE 321

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 89/192 (46%), Gaps = 19/192 (9%)

Query: 95  KSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKE 154
           ++ + ++    H   IN+ R +P D  II+  + + N+ ++D +  +S  +   L +HK 
Sbjct: 237 RTRVPVMNLIGHKSPINKVRCLPVDPQIISC-STDANIRLWDITAGKSAKI---LTHHKR 292

Query: 155 NGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENL 214
           +    + +P+  +   + +DD  I  W +  G       + +  + I+N  S +H D+ L
Sbjct: 293 SVRDFALHPSEFSMASACTDD--IRSWKLPEGILLTN--FQSTSTGIINSLSINH-DDVL 347

Query: 215 FGSVSEDSTLKLHDKRS--------TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
           F    +D TL  +D +S        T+++  +++++      +F +    L     +D +
Sbjct: 348 FAG-GDDGTLSFYDYKSGHKYQSLLTTEIPGSLESERGILCSSFDQTGLRLITGE-IDKS 405

Query: 267 IYLYDRRQTTKP 278
           I ++ + ++  P
Sbjct: 406 IKIWKQEESATP 417

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 44/101 (43%), Gaps = 15/101 (14%)

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEIL 336
           K + V+ GH   + C++  P ++    +G  D  + +WDLA              S ++ 
Sbjct: 113 KLIRVINGHIGWVRCVEVDPVDNAWYATGSNDTSIKVWDLA--------------SGKLK 158

Query: 337 MIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNL 377
           +  +GH   + D  +    P++  S  ED  ++ W   KN+
Sbjct: 159 LTLSGHIMTVRDLAISERHPYM-FSASEDKTIKCWDLEKNM 198

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 89/169 (52%), Gaps = 16/169 (9%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +++G+ D T  +WD    +++P SV    HS+ V   +W   D  L  + S
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDC--ATQTPLSVLKG-HSNWVLCVAWSP-DGELIATGS 205

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAA--------AGLDTNIYLYD 271
            D+T++L + ++     + ++  + + T + +    +L AA        A  D  I ++D
Sbjct: 206 MDNTIRLWESKAGKPWGDAMKGHSKWIT-SLTWEPLHLVAAGDKPRLASASKDGTIKIWD 264

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
             + T  L+ ++GH ++++C+++  +  G+L +G  D+ + +WD+   G
Sbjct: 265 ASRRTC-LYTLSGHTNSVSCVKWGGQ--GLLYTGSHDKTIRVWDIKAGG 310

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 87/209 (41%), Gaps = 37/209 (17%)

Query: 119 DSNIIATINGEGNVSIYDRSKSRS----DGLRTTLKYHKENGYGLSFNPNVSNELISGSD 174
           D   +A+ + +G + I+D S+        G   ++   K  G GL         L +GS 
Sbjct: 247 DKPRLASASKDGTIKIWDASRRTCLYTLSGHTNSVSCVKWGGQGL---------LYTGSH 297

Query: 175 DFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH-HFDENLFGSVSEDSTLKLHDKRSTS 233
           D TI +WDI +G K             +N    H H+  +L  S+S D  +++       
Sbjct: 298 DKTIRVWDIKAGGK------------CINILKSHAHWVNHL--SLSTDYAIRVGPFGPDG 343

Query: 234 KVINTIQ-----AKAAFNTLAF-SKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHED 287
           K   + Q     AK  +  +   S     L   A  D  ++L++  ++ KPL  M GH+ 
Sbjct: 344 KASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQK 403

Query: 288 AITCLQFHPKEDG-ILVSGGADRRVILWD 315
            +  + F P  DG  +VS   D  + LWD
Sbjct: 404 LVNHVAFSP--DGRYIVSASFDNSIKLWD 430

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 15/104 (14%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEA 328
           ++  R  T+    +AGH   I C  F P     +V+G  D    +WD     A Q P   
Sbjct: 126 VFKVRPITRSSAAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDC----ATQTP--- 178

Query: 329 DDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
                  L +  GH + +      P    L A+   DN +++W+
Sbjct: 179 -------LSVLKGHSNWVLCVAWSPDGE-LIATGSMDNTIRLWE 214

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 65/122 (53%), Gaps = 12/122 (9%)

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAF-SKHSANLFAA--AGLDTNIY 268
           ENLF + S  + +K+ D R  +K + T++ +   N L+  S H    + +   G+D +++
Sbjct: 65  ENLFAA-SNGNKVKVFDLRE-NKEVATLEQENGANVLSLGSGHGMLAYGSEQQGVDAHLH 122

Query: 269 LYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDE 327
           L+D R  +KP+      H+D IT + FHP +  +L+SG  D    ++DL E      P+E
Sbjct: 123 LFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLE------PEE 176

Query: 328 AD 329
            D
Sbjct: 177 ED 178

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 87/173 (50%), Gaps = 20/173 (11%)

Query: 157 YGLSFNPNVSNELISGSDDFTIALWDIDSGS-----KSPKSVWDNIHSDIVNDCSWHHFD 211
           + L   P+  + L++G  +  I L D  +G      K+ ++  +++   I +D S  H  
Sbjct: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAINDMKV-IGSDFSAGH-- 73

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTI-QAKAAFNTLAFSKHSANLFAAA----GLDTN 266
             L  S S D+ +K+ D R+  ++     +A + F +L  S+H   L A      G+D  
Sbjct: 74  --LVSSASIDA-VKVFDIRTNDRIAQIQNEANSPFISLD-SRHG--LLACGTELQGIDAA 127

Query: 267 IYLYDRRQTTKPLH-VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
           +Y+YD R+   PL  ++  H D +TC++FHP +  IL+SG  D    ++DL +
Sbjct: 128 VYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 109/260 (41%), Gaps = 42/260 (16%)

Query: 157 YGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFG 216
           + +++N   +N++++   D ++ L+DI+   + P S++   H   V  C+W+  ++  F 
Sbjct: 64  FDVAWNEGHANQVLAAQGDGSLRLFDINL-PQYPISIFQE-HQKEVFSCNWNLVNKQTFV 121

Query: 217 SVSEDSTLKLHD---KRSTSKVINT-------IQAKAAFNTLA----------------- 249
           S S D T+K+     + S + ++         ++AKA    L+                 
Sbjct: 122 SSSWDGTVKIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQ 181

Query: 250 --FSKHSANLFAAAGLDTNIYLYDRRQ---TTKPLHVMAGHEDAITCLQFHPKEDGILVS 304
             FS H  NL      ++ + L+D RQ   T +   +  G  + +TC  F+     I+ +
Sbjct: 182 AQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTC-DFNKYRPHIVAT 240

Query: 305 GGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEE 364
           GG D+ V +WDL  +     P +      EI     GH  AI   +  P    L  S   
Sbjct: 241 GGVDKLVKIWDLRMVRKFSNPLQQPMSINEI----PGHELAIRKVSWSPHHSNLVLSTSY 296

Query: 365 DNVVQVWKCSKNLSRVGGTP 384
           D   +VW    +LS   G P
Sbjct: 297 DMTCRVW---DDLSDSNGRP 313

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 63/165 (38%), Gaps = 17/165 (10%)

Query: 110 INRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNEL 169
           I +A++ P D N+I    G   V+++D  +  +   +  + +         FN    + +
Sbjct: 179 IYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIV 238

Query: 170 ISGSDDFTIALWDIDSGSK------SPKSVWDNI--HSDIVNDCSWHHFDENLFGSVSED 221
            +G  D  + +WD+    K       P S+ + I  H   +   SW     NL  S S D
Sbjct: 239 ATGGVDKLVKIWDLRMVRKFSNPLQQPMSI-NEIPGHELAIRKVSWSPHHSNLVLSTSYD 297

Query: 222 STLKLHD------KRSTSKVINTIQAKAAFNTLAFSKHSANLFAA 260
            T ++ D       R T K  +    K       F  H+  +F A
Sbjct: 298 MTCRVWDDLSDSNGRPTGKTNSIDPTKGC--RFIFPHHTEFVFGA 340

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 93/401 (23%), Positives = 165/401 (41%), Gaps = 61/401 (15%)

Query: 25  PLMYDFVSETRLTWPSLTAQWLP---GSEE-DTRQYMILGTHTSGE-----EVDYLKVAA 75
           P +Y+ +    L WP +T   +P   GSE  +  Q +++ T T        E+  LK++ 
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 76  L--DLPDEVVTGEANDDNRRTKSNIKIVKK--FEHDGEINRARYMPKDSN----IIATIN 127
           L   L  +   G  +D++   +    I++    +     NR +  P  +     + AT++
Sbjct: 185 LAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLAATMS 244

Query: 128 GEGNVSIYDRSKS----RSDGLRT---------TLKYHKE-NGYGLSFNPNV-SNELISG 172
             G   I+D         S G +          T+K H    GYGL ++P + +  L++G
Sbjct: 245 ENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALLTG 304

Query: 173 SDDFTIALWDIDSGS----KSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHD 228
                + L    S      K P +V DN  S  + D  W   +  +F +   D  +++ D
Sbjct: 305 DCSGRVFLTQRTSSKWITDKQPFTV-DNNKS--IEDIKWSPSENTVFATCGVDGHVRIWD 361

Query: 229 KRSTS--KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT------KPLH 280
            RS      ++   +    N +++++  + L A    +    ++D RQ +       P+ 
Sbjct: 362 IRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSPVA 421

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------EIGAEQQPDEADDGS-- 332
               H+ AIT + F+P ++ I+     D  V LWDL+      EI  +QQ  E  +    
Sbjct: 422 QYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEI--KQQAAEVKELQQI 479

Query: 333 -PEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            P++L +H   +  + D   H  IP    S   D  + VWK
Sbjct: 480 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 517

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 66/152 (43%), Gaps = 13/152 (8%)

Query: 229 KRSTSKVIN-----TIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD-RRQTTKPLHVM 282
           +R++SK I      T+    +   + +S     +FA  G+D ++ ++D R +  KP   +
Sbjct: 314 QRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSV 373

Query: 283 AGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGH 342
              +  +  + ++ K   +L +G  +    +WDL +   +Q       G    +  +  H
Sbjct: 374 KVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQ-------GGVSPVAQYDFH 426

Query: 343 RSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           + AI   + +P    + A   EDN V +W  S
Sbjct: 427 KGAITSISFNPLDESIIAVASEDNTVTLWDLS 458

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 11/135 (8%)

Query: 214 LFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHS--ANLFAAAGLDTNIYLYD 271
           L  + +EDS +K+ D RS+  V      K+A      S+H   A     +G+D  +++YD
Sbjct: 73  LIATAAEDS-VKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTELSGVDAELHIYD 131

Query: 272 RRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD 330
            +   +PL  +   H D IT ++FHP +  +L+SG  D  V ++DL       QP+E DD
Sbjct: 132 MKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLT------QPEE-DD 184

Query: 331 GSPEILMIHAGHRSA 345
              +++   + H S 
Sbjct: 185 ALHQVINFASIHSSG 199

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 84/190 (44%), Gaps = 22/190 (11%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V+NE  I+GS+D T+ +WD+ +G           H   V D +       LF SVSED T
Sbjct: 150 VNNEWFITGSNDTTMKVWDLATGKLRTTLAG---HVMTVRDIAISDRHPYLF-SVSEDKT 205

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D      + +     +   T++    + +L A AG D+ I L+D R T  P+  + 
Sbjct: 206 VKCWDLEKNQIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDIR-TRVPVITLV 263

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GH+  I  +Q  P  D  +VS   D  V LWD+              G    ++ H  H+
Sbjct: 264 GHKGPINQVQCTPV-DPQIVSSSTDATVRLWDVVA------------GKAMKVLTH--HK 308

Query: 344 SAINDFTLHP 353
            ++    LHP
Sbjct: 309 RSVRATALHP 318

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 15/97 (15%)

Query: 280 HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIH 339
            V+ GH   + C    P  +   ++G  D  + +WDLA              + ++    
Sbjct: 133 RVINGHLGWVRCAAIDPVNNEWFITGSNDTTMKVWDLA--------------TGKLRTTL 178

Query: 340 AGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           AGH   + D  +    P+L  SV ED  V+ W   KN
Sbjct: 179 AGHVMTVRDIAISDRHPYL-FSVSEDKTVKCWDLEKN 214

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 53/118 (44%), Gaps = 25/118 (21%)

Query: 258 FAAAGLDTNIYLYD----RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVIL 313
           F     DT + ++D    + +TT   HVM   + AI+    HP     L S   D+ V  
Sbjct: 155 FITGSNDTTMKVWDLATGKLRTTLAGHVMTVRDIAIS--DRHP----YLFSVSEDKTVKC 208

Query: 314 WDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
           WDL +               +I+  + GH S +   ++HPT+  L A+   D+V+++W
Sbjct: 209 WDLEK--------------NQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVIKLW 251

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 80/172 (46%), Gaps = 13/172 (7%)

Query: 151 YHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHF 210
           +H +    L+ N      L S S D T+ LWD++SG+ + +S+    H   V+   WH  
Sbjct: 291 HHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAA-RSLNQVHHGSRVSSSQWHQT 349

Query: 211 DENLFGSVSEDSTL-----KLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDT 265
           D ++  +   DS +     ++ D+++ SK  N +  +    T +F      L   AG D 
Sbjct: 350 DGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGE-EIETASFINDYTVL---AGTDN 405

Query: 266 -NIYLYDRRQT-TKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI-LW 314
            N+Y +D R   +KPL  +  H+  I  L       G+L++G    +VI LW
Sbjct: 406 GNVYSFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%)

Query: 280 HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGS 332
           HV   H DA+  L  +     IL S  AD  V LWDL    A +  ++   GS
Sbjct: 287 HVTTHHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAARSLNQVHHGS 339

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 72/171 (42%), Gaps = 22/171 (12%)

Query: 166 SNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLK 225
           +N +IS S D T  +WD+ S       +    H   V D  +      LF S   D +++
Sbjct: 256 TNLIISSSIDTTCIVWDLQSSHYVKTQLI--AHDSEVFDVRFLTKSTQLFASCGGDGSVR 313

Query: 226 LHDKRSTS-------------------KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
           + D RS +                    +  + +   A   L  S +  N+ A    D+N
Sbjct: 314 VFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSN 373

Query: 267 -IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            I + D R    P+  + GH  ++  +++HP +  +L+S G D +V+ WDL
Sbjct: 374 KIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 77/185 (41%), Gaps = 33/185 (17%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK-AAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D +S+  V   + A  +    + F   S  LFA+ G D 
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 266 NIYLYDRRQTT-------KPLHVMAGH-----------EDAITCLQFHPKEDGILVSGGA 307
           ++ ++D R           P   ++G             DA+  L+  P +  +L +  A
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAA 370

Query: 308 D-RRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDN 366
           D  ++I+ D+      + P+        IL +  GH S++N    HPT   +  S  +D 
Sbjct: 371 DSNKIIILDM------RNPESP------ILNLQ-GHGSSVNGIKWHPTKRNVLLSCGDDC 417

Query: 367 VVQVW 371
            V  W
Sbjct: 418 QVLYW 422

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 64/159 (40%), Gaps = 27/159 (16%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYD-------------RSKSRSDGLRTTLKYH 152
           HD E+   R++ K + + A+  G+G+V ++D              S S S     T+   
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPS 345

Query: 153 KENGYGL------SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNI--HSDIVND 204
            +    L       ++PNV       +D   I + D+    ++P+S   N+  H   VN 
Sbjct: 346 SKGSDALLRLEPSPYDPNVLATF--AADSNKIIILDM----RNPESPILNLQGHGSSVNG 399

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKA 243
             WH    N+  S  +D  +   D  S+   IN   +K+
Sbjct: 400 IKWHPTKRNVLLSCGDDCQVLYWDLNSSFMEINAAGSKS 438

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 87/188 (46%), Gaps = 34/188 (18%)

Query: 157 YGLSFNPNVSNELISGSDDFTIALWDIDSG--------SKSPKSVWDNIHSDIVNDCSWH 208
           + L   P   + L++G  +  I L D ++G        S++  +    I SD V      
Sbjct: 17  WCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDMKIIDSDFVAG---- 72

Query: 209 HFDENLFGSVSEDSTLKLHDKRSTSKV--INTIQAKAAFNTLAFSKHSANLFAAA----G 262
               NL  S S DS +K+ D RS   V  IN  +  + F +L  S+H   L A      G
Sbjct: 73  ----NLISSASIDS-VKVFDIRSNDCVAKINN-ETNSPFLSLD-SRHG--LLACGTELQG 123

Query: 263 LDTNIYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGA 321
           +D  I++YD R+   PL  +   H D +TC++FHP +  +L+SG  D    ++DL     
Sbjct: 124 IDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL----- 178

Query: 322 EQQPDEAD 329
            +Q DE D
Sbjct: 179 -KQDDEED 185

>TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7.310
           YDL195W
          Length = 1265

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/258 (21%), Positives = 111/258 (43%), Gaps = 53/258 (20%)

Query: 88  NDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRT 147
           N +N   +SN +++K   H G I    + P+  N++ +  GEG ++  + +K+       
Sbjct: 92  NQENDSIQSN-ELIKNNRHTGPIRSITFNPRQDNLLLS-GGEGIINSSNSAKTL------ 143

Query: 148 TLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHS-DIVNDCS 206
                          P ++N   + S+ F   L D+D+    P S    ++  + ++  +
Sbjct: 144 ---------------PTINNIQNTTSEIFIYDLNDVDNPETLPMSPNMTMNRFETISSLA 188

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVIN------TIQAKAAFNTL------------ 248
           W+    ++F +    S + + D ++  +VIN      T   K  F+ +            
Sbjct: 189 WNKSLSHVFSAAGNTSAVSIFDLKAKKEVINLNYINPTTGMKEIFSVVEWHPKNSTRIAT 248

Query: 249 AFSKHSAN-LFAAAGLDTNIYLYDRRQTTKPLHVMA----------GHEDAITCLQFHPK 297
           A S + +N L A A    +IY++D R +  PL +++          GH D I  L +  +
Sbjct: 249 ATSNNISNPLNATANAGDSIYIWDLRNSNAPLQILSPQQFENNTIVGHTDGIQSLDWCAQ 308

Query: 298 EDGILVSGGADRRVILWD 315
           ++  L+S G D  ++LW+
Sbjct: 309 DETFLLSSGRDNSIMLWN 326

>TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1262

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 91/243 (37%), Gaps = 38/243 (15%)

Query: 121 NIIATINGEGNVSIYD--RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N +A  +    +S++D  R+ S      T L  H  +     FN   +N +ISG  D  I
Sbjct: 189 NYVAVCSSSTAISVFDMNRTGSSESSFVTALSEHTRSINSFDFNTVQTNLIISGGQDSCI 248

Query: 179 ALWDIDSGSKSPKSVWD---NIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKV 235
            +WD+ S +       D   N  SD + D  W  F    F    E               
Sbjct: 249 KVWDLRSSNAKNSKNCDLSINTASDSIRDVKWMPFQNYAFNHQQE--------------F 294

Query: 236 INTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFH 295
            N   A   F ++ +S          GL  N   +D RQ  +    +  H     CL +H
Sbjct: 295 KNGSNAGFKFASIHYS----------GLLLN---FDLRQPGQIEKRINAHSGPGLCLSWH 341

Query: 296 PKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR--SAINDFTLHP 353
           P  + I  +GG D +  LW    +G  QQ + A       L  H+ H   +A+ + TL  
Sbjct: 342 PNLEYI-ATGGRDGKCGLW---YVGDRQQYENACGTPSSNLYGHSAHANLAALPETTLST 397

Query: 354 TIP 356
            +P
Sbjct: 398 GLP 400

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 85/170 (50%), Gaps = 13/170 (7%)

Query: 157 YGLSFNPNVSNELISGSDDFTIALWDIDSGS--KSPKSVWDNIHS-DIVNDCSWHHFDEN 213
           + L   P  S  L+  S + ++ L D +S S  K  +    NI+S  ++N+     F+  
Sbjct: 16  WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINN----DFENG 71

Query: 214 LFGSVSEDSTLKLHDKRSTSKVINTIQ--AKAAFNTLAFSKHSANLFAA--AGLDTNIYL 269
              + +  +++K++D R+    + TI+    + F +L  S+H   +      G+D  +++
Sbjct: 72  CIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLE-SRHDMLVCGTELTGVDAEMFI 130

Query: 270 YDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
           YD R  +KP+      H D IT ++FHP +  IL+SG  D    ++DLA+
Sbjct: 131 YDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180

>ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 92/214 (42%), Gaps = 24/214 (11%)

Query: 177 TIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVI 236
           TI LWD   G+   +  +++ H   V    +H   + LF S  +D  +K+     T+K +
Sbjct: 34  TIQLWDYRMGTLLHR--YED-HEGPVRAVDFHP-TQPLFVSAGDDYNIKVWS-LDTNKCL 88

Query: 237 NTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHP 296
            T+     +    F  +      +A  D  I +++  Q  K +  + GH   +   QFHP
Sbjct: 89  YTLTGHLDYVRTVFFHNELPWIISASDDQTIRIWNW-QNRKEIACLTGHNHFVMSAQFHP 147

Query: 297 KEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILM----------------IHA 340
            ED ++VS   D  + +WD++ +  +     A     ++LM                I  
Sbjct: 148 TED-LVVSASLDETIRVWDISGLRKKHSAPGATSLEDQMLMQQNLLDGGFGDCVVKFILE 206

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
           GH   +N  + HPT+P L  S  +D  V++W+ S
Sbjct: 207 GHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 95/237 (40%), Gaps = 50/237 (21%)

Query: 169 LISGSDDFTIALWDIDSGSKSPKSVWDNI-HSDIVNDCSWHHFDENLFGSVSEDSTLKLH 227
            +S  DD+ I +W +D+     K ++    H D V    +H+ +     S S+D T+++ 
Sbjct: 68  FVSAGDDYNIKVWSLDTN----KCLYTLTGHLDYVRTVFFHN-ELPWIISASDDQTIRIW 122

Query: 228 DKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD----RRQTTKP----- 278
           + ++  K I  +     F   A    + +L  +A LD  I ++D    R++ + P     
Sbjct: 123 NWQN-RKEIACLTGHNHFVMSAQFHPTEDLVVSASLDETIRVWDISGLRKKHSAPGATSL 181

Query: 279 --------------------LHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
                                 ++ GH   +    FHP    ++VSGG DR+V LW ++ 
Sbjct: 182 EDQMLMQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMSS 240

Query: 319 IGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
             A     E D           GH + ++    HP    L  SV ED  ++VW   K
Sbjct: 241 TKAW----EVDTCR--------GHTNNVDSVIFHPH-QNLIISVGEDKTLRVWDLDK 284

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 57/132 (43%), Gaps = 25/132 (18%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH---------HF 210
           SF+P +   ++SG DD  + LW + S        W+      V+ C  H         H 
Sbjct: 216 SFHPTLP-LIVSGGDDRQVKLWRMSS-----TKAWE------VDTCRGHTNNVDSVIFHP 263

Query: 211 DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY 270
            +NL  SV ED TL++ D    + V    +    F  +A   H  NLF AA  D+ I ++
Sbjct: 264 HQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAH-DSGIMVF 321

Query: 271 --DRRQTTKPLH 280
             DR +    +H
Sbjct: 322 KLDRERPCSVIH 333

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 5/137 (3%)

Query: 178 IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVIN 237
           I LWD      +    W    +D +    ++  D N+  S   D+++ L+D R+ S    
Sbjct: 194 IQLWDTSRSKSTSNLSWG---ADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQK 250

Query: 238 TIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPK 297
            +Q +   N+L ++      F     D N Y YD R+  + L+V   H  A+  + F P 
Sbjct: 251 IVQ-QMRTNSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPT 309

Query: 298 EDGILVSGGADRRVILW 314
            D I V+G  D+ + ++
Sbjct: 310 GDEI-VTGSYDKTIRIF 325

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 83/204 (40%), Gaps = 46/204 (22%)

Query: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNE------LISG 172
           D N +AT +G+G V  ++ S S       + K H     GL  +P ++++      ++S 
Sbjct: 79  DLNKMATGSGDGVVKFWNMSSSEE---LCSFKAHYGIVTGLCVSPVLASKNKNLQYMLSC 135

Query: 173 SDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRST 232
            DD T+ LW +D+                             +  V +D  L      +T
Sbjct: 136 GDDKTVKLWSVDTDD---------------------------YADVKDDQNL------NT 162

Query: 233 SKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCL 292
             ++ T     +F  +   + S + F   G    ++   R ++T  L   A   D IT +
Sbjct: 163 RGLLKTFYGDHSFQGIDHHR-SNSAFVTGGAQIQLWDTSRSKSTSNLSWGA---DNITSV 218

Query: 293 QFHPKEDGILVSGGADRRVILWDL 316
           +F+  +  IL S G+D  ++L+DL
Sbjct: 219 KFNQNDSNILASTGSDNSIVLYDL 242

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 85/211 (40%), Gaps = 29/211 (13%)

Query: 171 SGSDDFTIALWDIDSG---SKSPKSVWDNI-------HSDIVNDCSWHHFDENLFGSVSE 220
           +G  D  I LW +D     SK P    + I       HS  V   S+   D     S SE
Sbjct: 438 AGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSP-DNKYLLSASE 496

Query: 221 DSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLH 280
           D T++L    + S +++          ++FS    + FA A  D    L+       PL 
Sbjct: 497 DKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPL-GHYFATASHDQTARLWSCDHI-YPLR 554

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           + AGH + + C+ FHP    +  +G  D+   +WD+              G+ + + +  
Sbjct: 555 IFAGHLNDVDCVSFHPNGTYVF-TGSTDKTCRMWDI--------------GTGDSVRLFL 599

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
           GH + +    + P   WLS    ED ++ VW
Sbjct: 600 GHTAPVISTAVSPDGRWLSTG-SEDGIINVW 629

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 89/226 (39%), Gaps = 47/226 (20%)

Query: 138 SKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDS--------GSKS 189
           SK R     TTL  H    Y  SF+P+ +  L+S S+D T+ LW +D+        G   
Sbjct: 461 SKQREKINNTTLIGHSGTVYSTSFSPD-NKYLLSASEDKTVRLWSMDTYSSLVSYKGHNH 519

Query: 190 PKSVWD------------------------------NIHSDIVND--CSWHHFDENLFGS 217
           P  VWD                               I +  +ND  C   H +     +
Sbjct: 520 P--VWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFT 577

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
            S D T ++ D  +   V   +   A   + A S       +    D  I ++D   T K
Sbjct: 578 GSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSP-DGRWLSTGSEDGIINVWDI-GTGK 635

Query: 278 PLHVMAGH-EDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAE 322
            L  M GH ++A+  L +  KE  +LVSGGAD  V +WDL    AE
Sbjct: 636 RLKQMRGHGKNAVYSLSYS-KEGTVLVSGGADHSVRVWDLKRSTAE 680

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 85/185 (45%), Gaps = 12/185 (6%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDI---DSGSKSPKSVWDNIHSDI 201
           LR TL+ H      LS +P   N L+SGS D T+  W +   D     P   +   HS I
Sbjct: 25  LRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKG-HSHI 83

Query: 202 VNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAA 261
           V DC+  H D     S S D TL+L D +S   +   +  K+   +++    +  + +A+
Sbjct: 84  VQDCTVTH-DGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSAS 142

Query: 262 GLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKE---DGI-LVSGGADRRVILWDLA 317
             D  + +++       +  + GH D ++ ++  P E   D + ++S G D+ V +WDL 
Sbjct: 143 -RDKTVKVWN--TVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQ 199

Query: 318 EIGAE 322
               E
Sbjct: 200 SFTIE 204

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 17/102 (16%)

Query: 282 MAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAG 341
           + GH   +T L   P +  +L+SG  D+ +I W L   G +QQ      G P  +    G
Sbjct: 29  LEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLT--GEDQQY-----GVP--VRSFKG 79

Query: 342 HRSAINDFTL-HPTIPWLSASVEEDNVVQVW-----KCSKNL 377
           H   + D T+ H     LSAS   D  +++W     KC K  
Sbjct: 80  HSHIVQDCTVTHDGKYALSAS--WDKTLRLWDLQSGKCIKRF 119

>KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 875

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 87/207 (42%), Gaps = 21/207 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N ++ GSDDF I +++ ++G K         H D +   + H     +  S S+D T+K 
Sbjct: 68  NWIVVGSDDFKIRVFNYNTGEKIADF---EAHPDYIRSIAVHPTRPYVL-SASDDLTMKF 123

Query: 227 HDKRSTSKVINTIQAKAAFNT-LAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +      +  T +    F   +AF+    + FA+A LD  + ++   Q T    + A  
Sbjct: 124 WNWEKNWSLEQTFEGHEHFVMGVAFNPKDPSTFASACLDHTVKIWSLGQPTANFTLHAHE 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
              +  + ++P +D   L++   DR V +WD                +   +    GH +
Sbjct: 184 TRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQ--------------TKSCVATLEGHMA 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVW 371
            ++    HP +P +  S  ED  ++VW
Sbjct: 230 NVSFAVFHPALP-IIISGSEDGTLKVW 255

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 106/267 (39%), Gaps = 31/267 (11%)

Query: 118 KDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFT 177
           KD +I+A     G V  +   + RS      +K H      L FN   SN L+SG     
Sbjct: 72  KDGSILAGALDNGVVEFFKPEELRS---VAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGE 128

Query: 178 IALWD---IDSGSKSPKSVWDNIHS-DIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTS 233
           I +WD   I +   SP      +   + V   +W+    ++F S        + D ++  
Sbjct: 129 IYVWDTNKIATQGYSPFGPGVAMTPIEEVQSLAWNQTLAHVFASAGSSGFASIWDLKAKK 188

Query: 234 KVIN---TIQAKAAFNTLAF----SKHSANLFAAAGLDTN--IYLYDRRQTTKPLHVMA- 283
           +VI+   T       N L+       +S  +  A G D    I ++D R +  PL V++ 
Sbjct: 189 EVIHLSYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDNEPVILVWDLRNSNAPLKVLSQ 248

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GH   I  L +  ++D +++S G D   ILW+         P+EA     + L       
Sbjct: 249 GHSKGILSLDWCQQDDKLMISSGRDNTCILWN---------PEEA-----QKLTQFPTRG 294

Query: 344 SAINDFTLHPTIPWLSASVEEDNVVQV 370
           +        P  P L AS   DN VQV
Sbjct: 295 NWCFKTKFAPEAPDLFASASFDNKVQV 321

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 239 IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKE 298
           I A A FN L +SK  + L  A  LD  +  + + +  + +  +  H  A+  L+F+ K+
Sbjct: 59  IVADAKFNDLEWSKDGSIL--AGALDNGVVEFFKPEELRSVAKVKKHTTAVQTLRFNAKQ 116

Query: 299 DGILVSGGADRRVILWDLAEIGAE 322
             +LVSGG+   + +WD  +I  +
Sbjct: 117 SNVLVSGGSQGEIYVWDTNKIATQ 140

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 102/252 (40%), Gaps = 69/252 (27%)

Query: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELIS 171
           R+     D   +AT   +  + I+D ++ +   +   L+ H+++ Y L +  +  N+L+S
Sbjct: 377 RSVCFSPDGKFLATGAEDKLIRIWDIAQRK---IVMVLRGHEQDIYSLDYFQS-GNKLVS 432

Query: 172 GSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS 231
           GS D TI +WD+ +G                  CS                TL + D   
Sbjct: 433 GSGDRTIRIWDLHTGQ-----------------CSL---------------TLSIED--- 457

Query: 232 TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNI--------YLYDRRQTTKPLHVMA 283
                          T+A S  + N  AA  LD  +        +L +R  +     V  
Sbjct: 458 ------------GVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGV-- 503

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEI-GAEQQPDEADDGSPEILMIHAGH 342
           GH+D++  + F  ++   +VSG  DR V LW+L  I GA   P    +G+ E  M + GH
Sbjct: 504 GHKDSVYSVVF-TRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCE--MTYIGH 560

Query: 343 RSAINDFTLHPT 354
           +    DF L  T
Sbjct: 561 K----DFVLSVT 568

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 43/104 (41%), Gaps = 9/104 (8%)

Query: 213 NLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDR 272
           NL   + +D+     D  S S       A     ++ FS       A    D  I ++D 
Sbjct: 350 NLVTELVDDTKTGTEDANSASS------ADLYIRSVCFSP-DGKFLATGAEDKLIRIWDI 402

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            Q  K + V+ GHE  I  L +  +    LVSG  DR + +WDL
Sbjct: 403 AQR-KIVMVLRGHEQDIYSLDYF-QSGNKLVSGSGDRTIRIWDL 444

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 87/191 (45%), Gaps = 10/191 (5%)

Query: 125 TINGEGNVSIYD-RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDI 183
           ++NG+   ++ D ++ +  DGL  T  ++ E+ +    +  V    ++G    TI LWD 
Sbjct: 145 SMNGDDFANVKDDQNLNSQDGLLKT--FYGEHAFQGIDHHKVKTTFVTGGP--TIQLWDT 200

Query: 184 DSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKA 243
                     W    +D +    ++  + ++  S   D+++ L+D R+ S     +Q + 
Sbjct: 201 ARSKPLSNLSWG---ADNITSVKFNQTETDILASTGSDNSIVLYDVRTNSPTQKIVQ-RL 256

Query: 244 AFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILV 303
             N + ++   A  F  A  D N Y YD R  ++ L+V   H  A+  + F P  D I V
Sbjct: 257 RTNAICWNPMEAFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTGDEI-V 315

Query: 304 SGGADRRVILW 314
           +G  D+ + ++
Sbjct: 316 TGSYDKTIRIF 326

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 21/182 (11%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVN-DCSWH 208
           H++  Y ++ + +  N++ SGS D  I  W++ S  +  S K+ +  I    V+   S  
Sbjct: 66  HRDGVYVIAKDYHDLNKVASGSGDGVIKYWNMSSRDEICSFKAHYGLITGLCVSPQRSPL 125

Query: 209 HFDENLFGSVSEDSTLKL--------------HDKRSTSKVINTIQAKAAFNTLAFSKHS 254
           + D++   S  +D T+KL               +  S   ++ T   + AF  +   K  
Sbjct: 126 NRDQHFMLSCGDDKTVKLWSMNGDDFANVKDDQNLNSQDGLLKTFYGEHAFQGIDHHK-V 184

Query: 255 ANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILW 314
              F   G    I L+D  ++ KPL  ++   D IT ++F+  E  IL S G+D  ++L+
Sbjct: 185 KTTFVTGG--PTIQLWDTARS-KPLSNLSWGADNITSVKFNQTETDILASTGSDNSIVLY 241

Query: 315 DL 316
           D+
Sbjct: 242 DV 243

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 18/135 (13%)

Query: 193 VWDNIHSDIVNDCSWH-------HFDEN---LFGSVSEDSTLKLHDKRS---TSKVINTI 239
           +WD+  S  +++ SW         F++N   +  S   D+ + L+D R+   T K+I T+
Sbjct: 196 LWDSNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQKIIQTM 255

Query: 240 QAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKED 299
           +     N + ++   A  F  A  D N Y YD R  ++ LHV   H  A+  + F P  D
Sbjct: 256 RT----NAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGD 311

Query: 300 GILVSGGADRRVILW 314
            I V+G  D+ + ++
Sbjct: 312 EI-VTGSYDKTIRIF 325

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 86/184 (46%), Gaps = 26/184 (14%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVN------DC 205
           H++  Y ++ N N  N+L SGS D  I  W++   S   + V    H  +V       + 
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWNM---STREEFVSFKAHYGLVTGLCVTPEH 122

Query: 206 SWHHFDENLFGSVSEDSTLKL----HDKRSTSK---------VINTIQAKAAFNTLAFSK 252
           +  + +EN   S  +D T+KL    +D  S  K         ++ T   + AF  +   +
Sbjct: 123 TSKNKNENFMLSCGDDKTVKLWSVNNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHR 182

Query: 253 HSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI 312
             A+ F   G    I+L+D  ++ KP+  ++   D IT ++F+  E  IL S G+D  ++
Sbjct: 183 -EASTFVTGG--AQIHLWDSNRS-KPISNLSWGADNITSVKFNQNEVDILASTGSDNAIV 238

Query: 313 LWDL 316
           L+DL
Sbjct: 239 LYDL 242

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 18/136 (13%)

Query: 193 VWDNIHSDIVNDCSWH-------HFDEN---LFGSVSEDSTLKLHDKRS---TSKVINTI 239
           +WD+  S  + D SW         F++N   +  S   D++L L+D R+   T K++ T+
Sbjct: 197 LWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQTM 256

Query: 240 QAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKED 299
           +     N + ++   A  F  A  D N Y YD R  ++ L+V   H  A+  + F P  D
Sbjct: 257 RT----NAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGD 312

Query: 300 GILVSGGADRRVILWD 315
            I V+G  D+ + +++
Sbjct: 313 EI-VTGSYDKTIRIFN 327

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 83/184 (45%), Gaps = 25/184 (13%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDC-SWHHF 210
           H++  Y ++ N    N+L +GS D  +  W++   ++     +   +  I   C +  H 
Sbjct: 66  HRDGVYVIAKNYKNLNKLATGSADGVVKYWNM--STREELCSFKAHYGLITGLCVTPEHL 123

Query: 211 ----DENLFGSVSEDSTLKL--------------HDKRSTSKVINTIQAKAAFNTLAFSK 252
               +EN   S S+D T+KL               D  + S ++ T  +  AF  +   +
Sbjct: 124 SKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHR 183

Query: 253 HSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI 312
             +N F   G    I L+D  ++ KPL  ++   D I+ ++F+  E  IL S G+D  ++
Sbjct: 184 SKSN-FVTGG--AKIQLWDSNRS-KPLTDLSWGADNISTVKFNQNETDILASAGSDNSLV 239

Query: 313 LWDL 316
           L+DL
Sbjct: 240 LYDL 243

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 53/115 (46%), Gaps = 7/115 (6%)

Query: 126 INGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDS 185
           + G   + ++D ++S+     T L +  +N   + FN N ++ L S   D ++ L+D+ +
Sbjct: 189 VTGGAKIQLWDSNRSKP---LTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRT 245

Query: 186 GSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ 240
            S + K V     +   N   W+  +   F   +ED     +D R+ S+ +N  +
Sbjct: 246 NSPTQKIV----QTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFK 296

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 83/190 (43%), Gaps = 22/190 (11%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V NE  I+GS+D T+ +WD+ +G           H   V D +       LF SVSED T
Sbjct: 150 VDNEWFITGSNDTTMKVWDLATGKLKTTLAG---HVMTVRDVAVSDRHPYLF-SVSEDKT 205

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D      + +     +   T++    + +L A AG D+ I L+D R T  P+  + 
Sbjct: 206 VKCWDLEKNQIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDMR-TRIPVITLV 263

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GH+  I  +Q  P  D  +VS   D  V LWD+              G    ++ H  H+
Sbjct: 264 GHKGPINQVQCTP-VDPQVVSSSTDATVRLWDVVA------------GKTMKVLTH--HK 308

Query: 344 SAINDFTLHP 353
            ++    LHP
Sbjct: 309 RSVRATALHP 318

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 15/96 (15%)

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           V+ GH   + C+   P ++   ++G  D  + +WDLA              + ++    A
Sbjct: 134 VINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLA--------------TGKLKTTLA 179

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           GH   + D  +    P+L  SV ED  V+ W   KN
Sbjct: 180 GHVMTVRDVAVSDRHPYL-FSVSEDKTVKCWDLEKN 214

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 25/118 (21%)

Query: 258 FAAAGLDTNIYLYD----RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVIL 313
           F     DT + ++D    + +TT   HVM   + A++    HP     L S   D+ V  
Sbjct: 155 FITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVS--DRHP----YLFSVSEDKTVKC 208

Query: 314 WDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
           WDL +               +I+  + GH S +   ++HPT+  L A+   D+V+++W
Sbjct: 209 WDLEK--------------NQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVIKLW 251

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 103/248 (41%), Gaps = 45/248 (18%)

Query: 110 INRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTL-KYHKE-NGYGLS------- 160
           + R +++PK    +AT +   ++ I+    S  + L  +L KY K+ NG   S       
Sbjct: 111 VTRCQWLPKGGGKLATCSD--SLRIWSVGDSLQEQLNLSLCKYSKQSNGSTASAALGSLP 168

Query: 161 ------FNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENL 214
                 +N   +N +IS S D T  +WD+ S +     +    H   V D  +      L
Sbjct: 169 PVTSFDWNSVDTNLIISSSIDTTCTVWDLQSSNYVKTQL--IAHDSEVYDVKFLTNSTQL 226

Query: 215 FGSVSEDSTLKLHDKRST--SKVI---------NTIQAKAAFNT--------------LA 249
           F S   D ++++ D R    S +I          T+++    N               L 
Sbjct: 227 FASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLE 286

Query: 250 FSKHSANLFAAAGLDTN-IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
            S    N+ A    D+N + + D R    P+  + GH  A+  +++HP +  +L++ G D
Sbjct: 287 PSPFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDD 346

Query: 309 RRVILWDL 316
            +V+ WD+
Sbjct: 347 CQVLYWDI 354

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 117 PKDSNIIATINGEGN-VSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDD 175
           P D N++AT   + N V I D     S  L  TL+ H      + ++P   N L++  DD
Sbjct: 289 PFDPNVVATFTQDSNAVLILDMRYPGSPIL--TLEGHSSAVNQMRWHPTQRNVLLTCGDD 346

Query: 176 FTIALWDIDS 185
             +  WDI+S
Sbjct: 347 CQVLYWDINS 356

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 93/211 (44%), Gaps = 37/211 (17%)

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRS----DGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           P D   +A+ + +G + I+D ++        G   ++   K  G G+         L SG
Sbjct: 244 PGDKPRLASASKDGTIKIWDTARRVCLFTLSGHTNSVSCVKWGGRGV---------LYSG 294

Query: 173 SDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH-HFDENLFGSVSEDSTLKLHDKRS 231
           S D TI  WD+++G K             +N    H H+  +L  S+S D  L++     
Sbjct: 295 SHDKTIRAWDMNAGGK------------CINILKSHAHWINHL--SLSTDYALRVGAFDH 340

Query: 232 TSKVINT---IQAKAAFNTLAFSKHSANL---FAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
           T K  ++    +AKA  N    +K +  L      A  D  +YL+D  ++TKP+  M GH
Sbjct: 341 TGKKPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGH 400

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWD 315
           +  +  + F P  DG  +VS   D  + LWD
Sbjct: 401 QKLVNHVAFSP--DGRYIVSASFDNSIKLWD 429

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 80/169 (47%), Gaps = 16/169 (9%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +++G+ D T  +WD +  + +P       H + V   +W   D  L  + S
Sbjct: 149 AFAPHTSSRMVTGAGDNTARIWDCN--TNTPMQTLKG-HFNWVLCVAWSP-DGELIATGS 204

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANL--------FAAAGLDTNIYLYD 271
            D+T++L          + ++  + + T + S    +L         A+A  D  I ++D
Sbjct: 205 MDNTIRLWQSEKGENFGDALRGHSKWIT-SLSWEPIHLVKPGDKPRLASASKDGTIKIWD 263

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
             +    L  ++GH ++++C+++  +  G+L SG  D+ +  WD+   G
Sbjct: 264 TARRVC-LFTLSGHTNSVSCVKWGGR--GVLYSGSHDKTIRAWDMNAGG 309

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  R  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 125 VFKVRPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDC 172

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 87/194 (44%), Gaps = 28/194 (14%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V NE   +GS+D TI +W++ SG      V    H   V D +  +    +F SVSED T
Sbjct: 126 VDNEWFATGSNDKTIKIWNLASGK---LKVTLKAHDMTVRDLAISNRHPYMF-SVSEDKT 181

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D    + + N     +  +T+     + ++   AG D+ + ++D R T  P+  + 
Sbjct: 182 VKCWDLEKNTAIRNYHGHLSGVHTVDIHP-TVDVVVTAGRDSVVKVWDIR-TRLPVMTLP 239

Query: 284 GHEDAIT---CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           GH+  IT   CL   P+    ++S   D  + LWDL              G    ++ H 
Sbjct: 240 GHKGPITKVRCLPVDPQ----VISSSVDASIRLWDLVA------------GKSMKVLTH- 282

Query: 341 GHRSAINDFTLHPT 354
            H+  + D ++HP+
Sbjct: 283 -HQRTVRDISVHPS 295

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 39/96 (40%), Gaps = 15/96 (15%)

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           V+ GH   + C+     ++    +G  D+ + +W+LA              S ++ +   
Sbjct: 110 VIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLA--------------SGKLKVTLK 155

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
            H   + D  +    P++  SV ED  V+ W   KN
Sbjct: 156 AHDMTVRDLAISNRHPYM-FSVSEDKTVKCWDLEKN 190

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 69/142 (48%), Gaps = 11/142 (7%)

Query: 178 IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS---TSK 234
           I LWD +  +      W    +D V +  ++  + ++  S   D+++ L+D R+   T K
Sbjct: 194 IELWDSNRSNPISNLSWG---ADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPTQK 250

Query: 235 VINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQF 294
           ++ T++     N+L ++   A  F  A  D N Y YD R  ++ L+V   H  A+  + F
Sbjct: 251 IVQTMRT----NSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDF 306

Query: 295 HPKEDGILVSGGADRRVILWDL 316
            P    I V+G  D+ + ++++
Sbjct: 307 SPTGQEI-VTGSYDKTIRIYNI 327

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 77/183 (42%), Gaps = 24/183 (13%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSWHH 209
           H++  Y ++ N N  N+L S S D  I  W++ +  +  S K+ +  +    V   S   
Sbjct: 66  HRDGVYHIAKNYNNLNKLASASADGIIKYWNMSTREEYASFKAHYGLVTGLCVTPVS--E 123

Query: 210 FDENLFGSVSEDSTLKLHDKRS----------------TSKVINTIQAKAAFNTLAFSKH 253
            ++    S  +D  +KL    S                ++ +I T  ++ A   L   + 
Sbjct: 124 KNKQFMLSAGDDKMIKLWSIESDDFADNKNEDDNDNNTSNGLIKTFYSQNAIQGLDHHRI 183

Query: 254 SANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVIL 313
                    +   I L+D  ++  P+  ++   D +T ++F+  E  IL S G+D  ++L
Sbjct: 184 DPTFVTGGPM---IELWDSNRSN-PISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVL 239

Query: 314 WDL 316
           +DL
Sbjct: 240 YDL 242

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 90/224 (40%), Gaps = 18/224 (8%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H E    +SF+ N  ++ ++ SDD  + +W+  +G +  + +    H D V  C WH  +
Sbjct: 166 HTECLRDISFS-NTDSKFVTCSDDNILKIWNFSNGKQ--ERILTGHHWD-VKSCDWHP-E 220

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
             L  S S+D+ +K  D RS   V   +  K       F     N       D +  ++D
Sbjct: 221 MGLIVSGSKDNLVKFWDPRSGQCVSTILNFKHTVLRTRFQPTRGNYLLGISKDKSCRVFD 280

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDG 331
            R  TK L  +    D +T L +HP  + +      D  +  +D+ E           D 
Sbjct: 281 IRNHTKELLTVRDEVDFMT-LSWHPINESVFTLANYDGSIKHFDILE-----------DL 328

Query: 332 SPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
              I  I   H   I   + +P I  + AS  +D  ++ W  SK
Sbjct: 329 EKPIHTIPFAHEKCITAMSYNP-IGHILASASKDRTIRFWTRSK 371

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 60/140 (42%), Gaps = 5/140 (3%)

Query: 141 RSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSD 200
           RS    +T+   K       F P   N L+  S D +  ++DI + +K   +V D +  D
Sbjct: 239 RSGQCVSTILNFKHTVLRTRFQPTRGNYLLGISKDKSCRVFDIRNHTKELLTVRDEV--D 296

Query: 201 IVNDCSWHHFDENLFGSVSEDSTLKLHD-KRSTSKVINTIQAKAAFNTLAFSKHS-ANLF 258
            +   SWH  +E++F   + D ++K  D      K I+TI         A S +   ++ 
Sbjct: 297 FMT-LSWHPINESVFTLANYDGSIKHFDILEDLEKPIHTIPFAHEKCITAMSYNPIGHIL 355

Query: 259 AAAGLDTNIYLYDRRQTTKP 278
           A+A  D  I  + R +   P
Sbjct: 356 ASASKDRTIRFWTRSKPIDP 375

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 89/207 (42%), Gaps = 29/207 (14%)

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDF 176
           P D   +AT + +G + I+D ++        TL  H  +   + +     N L SGS D 
Sbjct: 245 PGDKPRLATASKDGTIKIWDTTRRVC---LLTLCGHTSSVSCVKWGGK--NVLYSGSHDK 299

Query: 177 TIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH-HFDENLFGSVSEDSTLKLH---DKRST 232
           TI  WD+            N++   +N    H H+  +L  S+S D  L+L     K  T
Sbjct: 300 TIRCWDM------------NLNGKCINILKSHAHWVNHL--SLSTDYALRLGAFDHKGET 345

Query: 233 SKVINTIQAKAAFNTLAFSKHSAN---LFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAI 289
                  Q KA  N    +K   +   L   A  D  +YL++  ++TKP+  M GH+  +
Sbjct: 346 PASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLV 405

Query: 290 TCLQFHPKEDG-ILVSGGADRRVILWD 315
             + F P  DG  +VS   D  + LWD
Sbjct: 406 NHVAFSP--DGRYIVSASFDNSIKLWD 430

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 77/165 (46%), Gaps = 16/165 (9%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F PN S+ +++G+ D T  +WD D+ ++         H + V  CSW   D  L  + S
Sbjct: 150 AFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTL---QGHHNWVLCCSWSP-DGELIATGS 205

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANL--------FAAAGLDTNIYLYD 271
            D+T++L +        + ++  + + T + S    +L         A A  D  I ++D
Sbjct: 206 MDNTIRLWESSKGKPYGDALRGHSKWIT-SLSWEPIHLVKPGDKPRLATASKDGTIKIWD 264

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
             +    L  + GH  +++C+++  K   +L SG  D+ +  WD+
Sbjct: 265 TTRRV-CLLTLCGHTSSVSCVKWGGKN--VLYSGSHDKTIRCWDM 306

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  +  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 126 IFKVKPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDC 173

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 95/217 (43%), Gaps = 29/217 (13%)

Query: 159 LSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSV 218
           L  +P  +    +GS+D T+ +WD+ SG           H   V D +       LF S 
Sbjct: 121 LKVDPVDNEWFATGSNDTTVKIWDLASGKLKLTLAG---HVMTVRDVAISQRHPYLF-SA 176

Query: 219 SEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKP 278
           SED  +K  D      + +     +  +T+     + +L A+AG D  + L+D R  T  
Sbjct: 177 SEDKMVKCWDLEKNQIIRDYHGHLSGVHTVDIHP-TLDLIASAGRDGVVKLWDIRSRTAV 235

Query: 279 LHVMAGHEDAIT---CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEI 335
           +  + GH+  IT   CL  +P+    +VS   D  V LWD+              G    
Sbjct: 236 M-TLIGHKSPITKVHCLPVNPQ----VVSSSTDATVRLWDVTA------------GKSYK 278

Query: 336 LMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           ++ H  H+ ++ DF+LHP+   + ++  +D  ++ WK
Sbjct: 279 ILTH--HKRSVRDFSLHPSEFSMVSACTDD--IRSWK 311

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 15/100 (15%)

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEIL 336
           K + V+ GH   + CL+  P ++    +G  D  V +WDLA              S ++ 
Sbjct: 106 KLIRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDLA--------------SGKLK 151

Query: 337 MIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           +  AGH   + D  +    P+L  S  ED +V+ W   KN
Sbjct: 152 LTLAGHVMTVRDVAISQRHPYL-FSASEDKMVKCWDLEKN 190

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 10/112 (8%)

Query: 213 NLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAF-SKHSANLFAAA----GLDTNI 267
           +L  S S D+ +K+ D R+ S  I TIQ ++    L+  S+H   L A      G+D  +
Sbjct: 73  HLVSSASIDA-VKVFDIRTNS-CIATIQNESNSPFLSLDSRH--GLLACGTELQGIDAAV 128

Query: 268 YLYDRRQTTKPLH-VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
           ++YD R+   PL  ++  H D +TC++FHP +  IL+SG  D    ++DL +
Sbjct: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 167 NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226
           N ++ GSDD  + +++ ++G K    V    H D +   + H     +    S+D T+KL
Sbjct: 68  NWIVVGSDDNKVRVFNYNTGEKVADFV---AHPDYIRSIAVHPSKPYILTG-SDDLTVKL 123

Query: 227 HDKRSTSKVINTIQAKAAF-NTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
            +  +   +  T +    F   +AF+    N+FA+  LD  + ++   Q+T    +  G 
Sbjct: 124 WNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQ 183

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRS 344
           E  +  + ++P  D   +++   D  V ++D                +   +    GH S
Sbjct: 184 EKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQ--------------TKSCVATLEGHMS 229

Query: 345 AINDFTLHPTIPWLSASVEEDNVVQVWKCS 374
            ++    HPT+P +  S  ED  V++W  S
Sbjct: 230 NVSFAVFHPTLP-IIISGSEDGTVKLWNSS 258

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 67/165 (40%), Gaps = 5/165 (3%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           L  T K H+     ++FNP   N   SG  D  + +W +  G  +P           VN 
Sbjct: 132 LEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL--GQSTPNFTLHTGQEKGVNY 189

Query: 205 CSWHHF-DENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGL 263
             ++   D+    + S+D+T+K+ D ++ S  + T++   +  + A    +  +  +   
Sbjct: 190 VDYYPLPDKPYMITSSDDTTVKIFDYQTKS-CVATLEGHMSNVSFAVFHPTLPIIISGSE 248

Query: 264 DTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
           D  + L++         +  G E +  C+  HP      ++ G D
Sbjct: 249 DGTVKLWNSSTYKLEKTLNLGLERS-WCIATHPVGRKNCIASGFD 292

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 73/168 (43%), Gaps = 8/168 (4%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H +  Y LSF  + S    +G+D   I +WD+ SG K+  S+  +      +D S + + 
Sbjct: 309 HSKEIYSLSFQTDGSLIATAGADKVGI-IWDLRSG-KNILSLVGHAKPIYCSDWSQNGYQ 366

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
               G    D T+K+ D R    V   +  K     L F K ++    ++  D +I ++ 
Sbjct: 367 XXXSG----DGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFS 422

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEI 319
                K +H + GH D I  +        I VSGG DR V LW +  I
Sbjct: 423 SDSWVK-IHTLQGHNDKILSIDISSDYQTI-VSGGWDRSVKLWSMEAI 468

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 20/167 (11%)

Query: 166 SNELISGSDDFTIALWDIDSGSKSPKSVWDNI--HSDIVNDCSWHHFDENLFGSVSEDST 223
           +N L+S S D T  +WD+    +SP  V   +  H   V D  +     +LF S   D +
Sbjct: 259 TNLLVSSSIDTTCIVWDL----QSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGS 314

Query: 224 LKLHDKRSTSK------------VINTIQAKA-AFNTLAFSKHSANLFAAAGLDT-NIYL 269
           +++ D RS +              +N + A+  A   L  S    N+ A    D+ +I +
Sbjct: 315 VRVFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILI 374

Query: 270 YDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            D R    P   + GH   +  +++HP +  +L+S   D +V+ WDL
Sbjct: 375 LDMRNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 27/134 (20%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGLRTTLKYHKENGYGLS---- 160
           HD E+   R++ + +++ A+  G+G+V ++D RS + S     T+ Y    G G      
Sbjct: 289 HDSEVYDVRFLSQSTHLFASCGGDGSVRVFDLRSLAHS-----TIVYEPPAGEGTVNDVT 343

Query: 161 -------------FNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSW 207
                         +PN+   L++ S D  I    +D  +    ++    HS +VN   W
Sbjct: 344 AQNNALLRLEPSLMDPNIIATLVADSKDILI----LDMRNPESPALTLKGHSSLVNQIKW 399

Query: 208 HHFDENLFGSVSED 221
           H    N+  S S+D
Sbjct: 400 HPTKRNVLLSCSDD 413

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 73/178 (41%), Gaps = 25/178 (14%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK-AAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D +S + V   + A  +    + F   S +LFA+ G D 
Sbjct: 254 WNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDG 313

Query: 266 NIYLYDRRQTTKPLHV------------MAGHEDAITCLQFHPKEDGILVSGGADRRVIL 313
           ++ ++D R       V            +    +A+  L+    +  I+ +  AD + IL
Sbjct: 314 SVRVFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDIL 373

Query: 314 WDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
                I   + P+     SP + +   GH S +N    HPT   +  S  +D  V  W
Sbjct: 374 -----ILDMRNPE-----SPALTL--KGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYW 419

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 119 DSNIIATINGEG-NVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFT 177
           D NIIAT+  +  ++ I D     S  L  TLK H      + ++P   N L+S SDD  
Sbjct: 358 DPNIIATLVADSKDILILDMRNPESPAL--TLKGHSSLVNQIKWHPTKRNVLLSCSDDCQ 415

Query: 178 IALWDIDSG 186
           +  WD+++ 
Sbjct: 416 VLYWDLNTA 424

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 107/266 (40%), Gaps = 64/266 (24%)

Query: 110 INRARYMPKDSNIIATINGEGNV-SIYDRSKSRSDGLRTTLKYHK-----ENGYGLSFNP 163
           ++R ++MP  S  +AT +    + S+ D+ K + +   + +KY K      NG+ L   P
Sbjct: 110 VSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVN--LSLVKYGKGVGDVANGHTLGKLP 167

Query: 164 NVS---------NELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENL 214
            V+         N ++S S D T  +WD+ + +     +    H   V D  +     NL
Sbjct: 168 PVTSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVKTQL--IAHDSEVFDAKFLTQSSNL 225

Query: 215 FGSVSEDSTLKLHDKRS------------------------------------------- 231
           F S   D ++++ D R                                            
Sbjct: 226 FASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAE 285

Query: 232 TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYL-YDRRQTTKPLHVMAGHEDAIT 290
           TS  +++++++A    L  S    N+ A    D+N+ +  D R    P+  + GH  A+ 
Sbjct: 286 TSLAVSSLESQALLR-LEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALN 344

Query: 291 CLQFHPKEDGILVSGGADRRVILWDL 316
            L++HP +  +L + G D +++ WDL
Sbjct: 345 QLRWHPSKPNVLATCGDDCQILYWDL 370

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 85/170 (50%), Gaps = 14/170 (8%)

Query: 157 YGLSFNPNVSNELISGSDDFTIALWDIDSGS--KSPKSVWDNIHSDIVNDCSWHHFDENL 214
           + L   P+    L++G  +  I L D +SG   +  K+   +I+   V D  +     +L
Sbjct: 17  WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFAA--GHL 74

Query: 215 FGSVSEDSTLKLHDKRSTSKVINTI-QAKAAFNTLAFSKHSANLFAAA----GLDTNIYL 269
             S S D+ +K+ D R+ + V     +A + F +L  S+H   L A      G+D  +Y+
Sbjct: 75  VSSASIDA-VKVFDIRTNACVAKIHNEANSPFISLD-SRH--GLLACGTELQGIDAAVYI 130

Query: 270 YDRRQTTKPLH-VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
           YD R+   PL  ++  H D +TC++FHP +  +L+SG  D    ++DL +
Sbjct: 131 YDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ 180

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 131/292 (44%), Gaps = 46/292 (15%)

Query: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELIS 171
           R+     D   +AT   +  + I+D    +   +  TLK H+++ Y L + P+  N+L+S
Sbjct: 410 RSVCFSPDGKFLATGAEDKLIRIWDLETKK---IVMTLKGHEQDIYSLDYFPS-GNKLVS 465

Query: 172 GSDDFTIALWDIDSGSKS-PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           GS D T+ +WD+ +G+ S   S+ D + +  V+       +     + S D T+++ D  
Sbjct: 466 GSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPG-----EGKFIAAGSLDRTVRVWDS- 519

Query: 231 STSKVINTIQAKAAFNT--------LAFSKHSANLFAAAGLDTNIYLYD------RRQTT 276
            T  ++  + ++    T        + F++    + + + LD ++ L++      ++   
Sbjct: 520 DTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGS-LDRSVKLWNLNGLSGQKSHA 578

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEIL 336
           +      GH+D +  +     ++ IL SG  DR V+ WD               G+P  L
Sbjct: 579 ECEVTYTGHKDFVLSVATTQNDEYIL-SGSKDRGVLFWD------------TKSGNP--L 623

Query: 337 MIHAGHRSAINDFTL---HPTIP--WLSASVEEDNVVQVWKCSKNLSRVGGT 383
           ++  GHR+++   T+   HP  P   + A+   D   ++WK SK  S+   T
Sbjct: 624 LMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIWKYSKKNSQQNST 675

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 75/173 (43%), Gaps = 7/173 (4%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           ++  +  H      L+F PN  N L+SG +D  + +WD        +      HS  +N 
Sbjct: 147 IKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDY--KGHSKAINS 204

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLD 264
             ++  D   F S S D T+K+ D     KV   +  K+  N + F   +++ F     +
Sbjct: 205 LDFND-DGTNFISSSFDHTIKIWDTEQ-GKVKTKLHFKSTPNDVKFRPFNSSEFIVGFAN 262

Query: 265 TNIYLYDRR--QTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
           + IY YD R  +    + V   H  +I  L+F P +    +S   D+ V +WD
Sbjct: 263 SKIYHYDTRISENDGRVQVYDHHMSSILALKFFP-DGSKFISSSEDKTVRIWD 314

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 18/94 (19%)

Query: 280 HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIH 339
           + M GH +  T L F P    +L+SGG D  V +WD                   +L  +
Sbjct: 149 YAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-------------KRNLLRDY 195

Query: 340 AGHRSAIN--DFTLHPTIPWLSASVEEDNVVQVW 371
            GH  AIN  DF    T  ++S+S   D+ +++W
Sbjct: 196 KGHSKAINSLDFNDDGT-NFISSSF--DHTIKIW 226

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 97/230 (42%), Gaps = 26/230 (11%)

Query: 99  KIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYG 158
           K+  K       N  ++ P +S+          +  YD   S +DG      +H  +   
Sbjct: 232 KVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDTRISENDGRVQVYDHHMSSILA 291

Query: 159 LSFNPNVSNELISGSDDFTIALWD----------IDSGSKSPKSVWDNIHSDIVNDCSWH 208
           L F P+ S + IS S+D T+ +WD           D+   S  S+  +IH D  N C+  
Sbjct: 292 LKFFPDGS-KFISSSEDKTVRIWDNQVNVPIKQISDTTQYSMPSI--DIHPDKKNFCA-Q 347

Query: 209 HFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNT-LAFSKHSANLFAAAGLDTNI 267
             D  ++       ++K   +R+ +K+    Q  A +   L FS        +    + +
Sbjct: 348 SMDNTIY-----TYSMKPKYRRNPNKMFKG-QTSAGYGIGLTFSA-DGRYVCSGDSKSKV 400

Query: 268 YLYDRRQTTKPLHVMA--GHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
           +++D   TT+ L+ ++  G++  IT + ++P+E   +   G   ++ + D
Sbjct: 401 HIWD-WTTTRLLNTISIPGNK-PITQVAWNPQETSKVACSGNTGKIYILD 448

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 92/196 (46%), Gaps = 39/196 (19%)

Query: 123 IATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWD 182
           +   +GE N+S+ D   S+ D    T   H +    LSF+    + LISGS D TI  WD
Sbjct: 526 VNLFDGE-NISMED---SKEDACVYTFDAHVDEITALSFS---GDNLISGSQDRTIRQWD 578

Query: 183 IDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSV-SEDSTLKLHDKRSTSKVINTIQA 241
           ++SG K  +++  N  S + +  S         G++ S  STL + +++    VI  +Q 
Sbjct: 579 LNSG-KCVQTIDINFASRVNSSTS---------GTLSSRSSTLLVPNEQ---PVIGALQC 625

Query: 242 KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGI 301
             A              A    D  + L+D R + + +  + GH DAIT LQF    D I
Sbjct: 626 YDA------------ALATGTKDGLVRLWDLR-SGQVVRTLQGHTDAITSLQF----DSI 668

Query: 302 -LVSGGADRRVILWDL 316
            L++G  DR + +WDL
Sbjct: 669 NLITGSIDRSIRIWDL 684

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 56/108 (51%), Gaps = 13/108 (12%)

Query: 123 IATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWD 182
           +AT   +G V ++D    RS  +  TL+ H +    L F+   S  LI+GS D +I +WD
Sbjct: 630 LATGTKDGLVRLWDL---RSGQVVRTLQGHTDAITSLQFD---SINLITGSIDRSIRIWD 683

Query: 183 IDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           + +G+ +    ++N  S +        FD +     + ++T+K++D++
Sbjct: 684 LRTGTLADAFAYENPVSHL-------EFDLDKIVVANNENTVKIYDRK 724

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 63/167 (37%), Gaps = 35/167 (20%)

Query: 150 KYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHH 209
           K H+E+   L F+        +G  D TI +WD+   SK  ++   + H   ++      
Sbjct: 448 KAHEESITCLDFDMPFGTMCTAGKLDHTIKVWDL---SKQKQTALMSGHLATISCMQMDQ 504

Query: 210 FDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYL 269
           F+  + G    D+ LKL D                         + NLF       NI +
Sbjct: 505 FNTLITG--GRDALLKLWD----------------------VDRAVNLFDGE----NISM 536

Query: 270 YDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            D ++    ++    H D IT L F       L+SG  DR +  WDL
Sbjct: 537 EDSKEDA-CVYTFDAHVDEITALSFSGDN---LISGSQDRTIRQWDL 579

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
            HE++ITCL F      +  +G  D  + +WDL++
Sbjct: 449 AHEESITCLDFDMPFGTMCTAGKLDHTIKVWDLSK 483

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 89/202 (44%), Gaps = 22/202 (10%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V NE  ++GS+D T+ +WD+ +G           H   V D +       LF SVSED T
Sbjct: 150 VDNEWFVTGSNDTTMKVWDLATGKLKTTLAG---HVMTVRDIAVSDRHPYLF-SVSEDKT 205

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D      + +     +   T++    + +L A AG D+ + L+D R T  P+  + 
Sbjct: 206 VKCWDLEKNHIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVVKLWDIR-TRMPVITLV 263

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GH+  I  +Q  P  D  +VS   D  V LWD+              G    ++ H  H+
Sbjct: 264 GHKGPINQVQCTP-VDPQIVSSSTDATVRLWDIVA------------GKAMKVLTH--HK 308

Query: 344 SAINDFTLHPTIPWLSASVEED 365
            ++    LHP    L+++  +D
Sbjct: 309 RSVRATALHPKEFSLASACTDD 330

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 15/100 (15%)

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEIL 336
           K L V+ GH   + C    P ++   V+G  D  + +WDLA              + ++ 
Sbjct: 130 KLLRVINGHLGWVRCAAIDPVDNEWFVTGSNDTTMKVWDLA--------------TGKLK 175

Query: 337 MIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
              AGH   + D  +    P+L  SV ED  V+ W   KN
Sbjct: 176 TTLAGHVMTVRDIAVSDRHPYL-FSVSEDKTVKCWDLEKN 214

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 85/189 (44%), Gaps = 19/189 (10%)

Query: 95  KSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKE 154
           ++ + ++    H G IN+ +  P D  I+++ + +  V ++D    ++      L +HK 
Sbjct: 254 RTRMPVITLVGHKGPINQVQCTPVDPQIVSS-STDATVRLWDIVAGKA---MKVLTHHKR 309

Query: 155 NGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENL 214
           +    + +P   +   + +DD  I  W I  GS      +++  + I+N  S +  D+ L
Sbjct: 310 SVRATALHPKEFSLASACTDD--IRSWGIADGSLLTN--FESEKTGIINTLSINQ-DDVL 364

Query: 215 FGSVSEDSTLKLHDKRS--------TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
           F    +D TL  +D +S        T +++ +++++ +     F K    L      D +
Sbjct: 365 FAG-GDDGTLSFYDYKSGHKYQSLATREMVGSLESERSVLCSTFDKTGLRLITGEA-DKS 422

Query: 267 IYLYDRRQT 275
           I ++ + +T
Sbjct: 423 IKIWKQDET 431

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 94/242 (38%), Gaps = 81/242 (33%)

Query: 138 SKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDS--------GSKS 189
           SKS+     TTL  H    Y +SF+P+ +  L+S S+D T+ LW +D+        G   
Sbjct: 512 SKSKEASNTTTLIGHSGPVYSVSFSPD-NRYLVSASEDKTVRLWSLDTFTCLVSYKGHNH 570

Query: 190 PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLA 249
           P  VWD      V      H+    F +VS D T                          
Sbjct: 571 P--VWD------VKFSPLGHY----FATVSHDQT-------------------------- 592

Query: 250 FSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADR 309
                A L++      +IY         PL + AGH + + C+ FHP    +L +G +D+
Sbjct: 593 -----ARLWSC----DHIY---------PLRIFAGHLNDVDCVAFHPNGTYVL-TGSSDK 633

Query: 310 RVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQ 369
              +WD+      Q  D         + +  GH +++    + P   WL+    ED V+ 
Sbjct: 634 TCRMWDI------QTGDS--------VRLFLGHTASVVSVAVSPDGRWLTTG-SEDGVII 678

Query: 370 VW 371
           VW
Sbjct: 679 VW 680

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 67/141 (47%), Gaps = 11/141 (7%)

Query: 178 IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS---TSK 234
           I LWD++         W    +D +    ++  + ++  S   D+++ L+D R+   T K
Sbjct: 201 IQLWDVNRVKPVSNLSWG---ADNITSVKFNQNETDILASTGSDNSIVLYDLRTNSPTQK 257

Query: 235 VINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQF 294
           ++ T++     N + ++   A  F  A  D N Y YD R  ++ L+V   H  A+  + F
Sbjct: 258 IVQTMRT----NAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 295 HPKEDGILVSGGADRRVILWD 315
            P  D I V+G  D+ + +++
Sbjct: 314 SPTGDEI-VTGSYDKSIRIYN 333

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 86/189 (45%), Gaps = 29/189 (15%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSWHH 209
           H++  Y ++ N    N+L +GS D  I  W++ +  +  S K+ +  I    V    +H 
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHD 125

Query: 210 F-----DENLFGSVSEDSTLKL--------HDKRSTSK--------VINTIQAKAAFNTL 248
                 ++N   S S+D T+KL         +KRS+          ++ T   ++AF  +
Sbjct: 126 KKPDLKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVINEEGLVRTFDGESAFQGI 185

Query: 249 AFSKHSAN-LFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGA 307
               H  N  FA  G    ++  +R    KP+  ++   D IT ++F+  E  IL S G+
Sbjct: 186 --DSHRVNSTFATGGAKIQLWDVNR---VKPVSNLSWGADNITSVKFNQNETDILASTGS 240

Query: 308 DRRVILWDL 316
           D  ++L+DL
Sbjct: 241 DNSIVLYDL 249

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 4/94 (4%)

Query: 147 TTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCS 206
           + L +  +N   + FN N ++ L S   D +I L+D+ + S + K V     +   N   
Sbjct: 213 SNLSWGADNITSVKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIV----QTMRTNAIC 268

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ 240
           W+  +   F   +ED     +D R+ S+ +N  +
Sbjct: 269 WNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFK 302

>KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3.22
           YOL138C
          Length = 1365

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 80/201 (39%), Gaps = 30/201 (14%)

Query: 121 NIIATINGEGNVSIYD----RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDF 176
           N  A       +SI+D     S S  + + T+   H  +  G  FN   +N +ISG  D 
Sbjct: 236 NYAAICTNSTTISIFDIVKPPSSSEFNPVVTSFNGHTRSVNGFDFNMIQTNLIISGGQDA 295

Query: 177 TIALWDIDSGSKSPKSVWD-NIHS--DIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTS 233
            + +WDI + ++   S  D NI +  D + D  W     N+  + S+ S+   +  RS  
Sbjct: 296 CVKIWDIRTNTRKDSSRSDINITTSYDSIRDIKWMP-GSNILANNSDPSSYGSYGVRS-- 352

Query: 234 KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQ 293
                              HS   FA+      +  +D RQ  +    +  H     CL 
Sbjct: 353 -------------------HSGYKFASIHDSGTVLKFDLRQPNQFEKKINAHTGPGLCLN 393

Query: 294 FHPKEDGILVSGGADRRVILW 314
           +HP +D I  +GG D +  LW
Sbjct: 394 WHPNQDYI-ATGGRDGKCCLW 413

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 84/190 (44%), Gaps = 22/190 (11%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V NE  ++GS+D T+ +WD+ SG      V    H   V D +       LF SVSED T
Sbjct: 150 VDNEWFVTGSNDTTMKVWDLASGK---LKVTLTGHVMTVRDIAVSDRHPYLF-SVSEDKT 205

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D      + +     +   T++    + +L A AG D+ + L+D R T  P+  + 
Sbjct: 206 VKCWDLEKNQIIRDYHGHLSGVRTVSIHP-TLDLIATAGRDSVVKLWDIR-TRVPVITLV 263

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GH+  I  ++  P  D  +VS   D  V LWD+              G    ++ H  H+
Sbjct: 264 GHKGPINQVECAPV-DPQIVSSSTDATVRLWDIVA------------GKAMKVLTH--HK 308

Query: 344 SAINDFTLHP 353
            ++    LHP
Sbjct: 309 RSVRAIALHP 318

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 15/96 (15%)

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           V+ GH   + C    P ++   V+G  D  + +WDLA              S ++ +   
Sbjct: 134 VINGHLGWVRCAAIDPVDNEWFVTGSNDTTMKVWDLA--------------SGKLKVTLT 179

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           GH   + D  +    P+L  SV ED  V+ W   KN
Sbjct: 180 GHVMTVRDIAVSDRHPYL-FSVSEDKTVKCWDLEKN 214

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 84/189 (44%), Gaps = 19/189 (10%)

Query: 95  KSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKE 154
           ++ + ++    H G IN+    P D  I+++ + +  V ++D    ++      L +HK 
Sbjct: 254 RTRVPVITLVGHKGPINQVECAPVDPQIVSS-STDATVRLWDIVAGKA---MKVLTHHKR 309

Query: 155 NGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENL 214
           +   ++ +PN  +   + +DD  I  W +  GS      +++  + I+N  S +  D+ L
Sbjct: 310 SVRAIALHPNEFSMASACTDD--IRSWGLADGSLLTN--FESEKTGIINTLSINQ-DDVL 364

Query: 215 FGSVSEDSTLKLHDKRS--------TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
           F    +D  L  +D +S        T ++I +++++       F K    L      D +
Sbjct: 365 FAG-GDDGMLSFYDYKSGHKYQSLATREMIGSLESERGVLCSTFDKTGLRLITGE-TDKS 422

Query: 267 IYLYDRRQT 275
           I ++ + +T
Sbjct: 423 IKIWKQDET 431

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 93/209 (44%), Gaps = 24/209 (11%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V NE  ++GS+D T+ +WD+ SG         + H+  V D +       +F S SED  
Sbjct: 97  VDNEWFVTGSNDTTLKVWDLASGKLKLTL---SGHTMGVRDVAVSERHPYMF-SASEDKL 152

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D    + + +     +  +T+     + +L A  G D  + L+D R T K +  + 
Sbjct: 153 VKCWDLEKNTAIRDYYGHLSGVHTVDIHP-TLDLIATGGRDAVVKLWDIR-TRKAVKTLV 210

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GH+  IT ++  P  D  +VS   D  V LWD+              G    ++ H  H+
Sbjct: 211 GHKAPITKVKCTPV-DPQVVSSSTDTTVRLWDIVA------------GKSMKVLTH--HK 255

Query: 344 SAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            A+    LHP    L+++  +D  V+ W+
Sbjct: 256 RAVRSIALHPGEFSLASACTDD--VRSWR 282

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 15/96 (15%)

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           V+ GH   + C+   P ++   V+G  D  + +WDLA              S ++ +  +
Sbjct: 81  VINGHLGWVRCVAVEPVDNEWFVTGSNDTTLKVWDLA--------------SGKLKLTLS 126

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           GH   + D  +    P++  S  ED +V+ W   KN
Sbjct: 127 GHTMGVRDVAVSERHPYM-FSASEDKLVKCWDLEKN 161

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 127/289 (43%), Gaps = 51/289 (17%)

Query: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELIS 171
           R+     D   +AT   +  + I+D +  R   +  TL+ H+++ Y L + P+  ++L+S
Sbjct: 452 RSVCFSPDGKFLATGAEDKLIRIWDLTTRR---IVMTLQGHEQDIYSLDYFPS-GDKLVS 507

Query: 172 GSDDFTIALWDIDSGSKS-PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           GS D T+ +WD+ +G  S   S+ D + +  V+       D  L  + S D T+++ D  
Sbjct: 508 GSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPG-----DGKLIAAGSLDRTVRIWDSE 562

Query: 231 STSKVINTIQAKAAFNT--------LAFSKHSANLFAAAGLDTNIYLYDRRQ-------- 274
            T  ++  + ++    T        + F++    + + + LD ++ L++ R         
Sbjct: 563 -TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGS-LDRSVKLWNLRSANGGSTEG 620

Query: 275 ---TTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDG 331
              T        GH+D +  +    + D  ++SG  DR V+ WD               G
Sbjct: 621 KANTAASEVTYTGHKDFVLSVATT-QNDEFILSGSKDRGVLFWD------------TPSG 667

Query: 332 SPEILMIHAGHRSAINDFTL---HPTIP--WLSASVEEDNVVQVWKCSK 375
           +P  L++  GHR+++    +   HP  P   + A+   D   ++WK +K
Sbjct: 668 NP--LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYTK 714

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
           RTC1Subunit of the SEA (Seh1-associated) complex, a
           coatomer-related complex that associates dynamically
           with the vacuole; null mutation suppresses cdc13-1
           temperature sensitivity; has N-terminal WD-40 repeats
           and a C-terminal RING motif
          Length = 1341

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 78/199 (39%), Gaps = 31/199 (15%)

Query: 121 NIIATINGEGNVSIYDRSKSRS--DGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N IA  N    +SIYD +KS S  + L T+L  H  +     FN   SN +ISG  D  +
Sbjct: 224 NCIAVCNNSTAISIYDLNKSSSIDNPLITSLCEHTRSINSFDFNMVESNLIISGGQDSCV 283

Query: 179 ALWDIDSGSKSPKSVWD---NIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKV 235
            +WD+ S      +  D   N  SD + D  W       F S ++               
Sbjct: 284 KIWDLRSNKSKSSNRSDISINTASDSIRDVKW--MPGYNFASKND--------------- 326

Query: 236 INTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFH 295
               Q  + +  L     S   FA+      +  +D RQ  +    +  H     CL +H
Sbjct: 327 ----QGSSTYGNL----KSGYKFASIHDSGYLLKFDLRQPAQYEKKLNAHTGPGLCLNWH 378

Query: 296 PKEDGILVSGGADRRVILW 314
           P ++ I  +GG D +  LW
Sbjct: 379 PNQEYI-ATGGRDGKCCLW 396

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 85/218 (38%), Gaps = 36/218 (16%)

Query: 115 YMPKDSNIIATING----EGNVSIYDRSKS------RSDGLRTTLKYHKENGYGLSFN-P 163
           Y+P D N  A   G    + N+ I  +  +      +S GL  T K  KE       N P
Sbjct: 91  YLPYDKNPYAKTTGSMSNKSNMKIKTKKNAINTNTRKSSGLIYTTKVDKELSSIDKVNDP 150

Query: 164 NVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           N++  + +G     + L+      +S K V D I  +          + +  G+ S    
Sbjct: 151 NINGLVCAGKTH--LGLYKFSPSDRSIKCVHDFITPN---------SNTSTRGTTS---L 196

Query: 224 LKLHDKRSTSKVINTIQ-AKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK---PL 279
           L    KR+     +TI   K  FN         N  A     T I +YD  +++    PL
Sbjct: 197 LPKLSKRTRQNKFSTIADVKTGFNNYK------NCIAVCNNSTAISIYDLNKSSSIDNPL 250

Query: 280 HV-MAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
              +  H  +I    F+  E  +++SGG D  V +WDL
Sbjct: 251 ITSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDL 288

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 73/171 (42%), Gaps = 22/171 (12%)

Query: 166 SNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLK 225
           +N +IS S D T  +WD+ S       +    H   V D  +      LF S   D +++
Sbjct: 256 TNLIISSSIDTTCIVWDLQSSHYVKTQLI--AHDSEVFDVRFLTKSTQLFASCGGDGSVR 313

Query: 226 LHDKRST--SKVINTIQAKAA-----------------FNTLAFSKHSANLFAAAGLDTN 266
           + D RS   S +I    A +A                    L  S +  N+ A    ++N
Sbjct: 314 VFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESN 373

Query: 267 -IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            I + D R    P+  + GH  ++  +++HP +  +L+S G D +V+ WDL
Sbjct: 374 KIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 82/201 (40%), Gaps = 41/201 (20%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK-AAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D +S+  V   + A  +    + F   S  LFA+ G D 
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 266 NIYLYDRRQ---------------------TTKPLHVMAGHEDAITCLQFHPKEDGILVS 304
           ++ ++D R                      TT P    +   DA+  L+  P +  +L +
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTP---ASKGSDALLRLEPSPYDPNVLAT 367

Query: 305 GGAD-RRVILWDLAEIGAEQQPDEADDGSPEILMIHA-GHRSAINDFTLHPTIPWLSASV 362
             A+  ++I+ D+               +PE  +++  GH S++N+   HPT   +  S 
Sbjct: 368 FAAESNKIIILDMR--------------NPESPILNLEGHSSSVNEIKWHPTKRNVLLSC 413

Query: 363 EEDNVVQVWKCSKNLSRVGGT 383
            +D  V  W  + +   + G 
Sbjct: 414 GDDCQVLYWDLNNSFMEINGA 434

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 63/152 (41%), Gaps = 25/152 (16%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGLRTTLKYHKENGYGLSFNPN 164
           HD E+   R++ K + + A+  G+G+V ++D RS + S     T+ Y          N +
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHS-----TIIYEPPASSAPGLNAD 340

Query: 165 VSNELISGSDDF-----------TIALWDIDSGS------KSPKSVWDNI--HSDIVNDC 205
            +     GSD              +A +  +S        ++P+S   N+  HS  VN+ 
Sbjct: 341 TTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNLEGHSSSVNEI 400

Query: 206 SWHHFDENLFGSVSEDSTLKLHDKRSTSKVIN 237
            WH    N+  S  +D  +   D  ++   IN
Sbjct: 401 KWHPTKRNVLLSCGDDCQVLYWDLNNSFMEIN 432

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 78/177 (44%), Gaps = 15/177 (8%)

Query: 143 DGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIV 202
           DGL  T  +H E  +    +    +  ++G     I LWD           W    +D V
Sbjct: 164 DGLLKT--FHGEYAFQSIDHHRTKSTFVTGGAQ--IELWDTGRSKPVSNLSWG---ADNV 216

Query: 203 NDCSWHHFDENLFGSVSEDSTLKLHDKRS---TSKVINTIQAKAAFNTLAFSKHSANLFA 259
               ++  + ++  S   D+++ L+D R+   T K++ T++     N + ++   A  F 
Sbjct: 217 TSVKFNQNETDILASTGSDNSVVLYDLRTNSPTQKIVQTMRT----NAICWNPMEAFNFV 272

Query: 260 AAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            A  D N Y YD R  ++ L+V   H  A+  + F P  D I V+G  D+ V ++ +
Sbjct: 273 IANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTVRIYQV 328

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 84/184 (45%), Gaps = 25/184 (13%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDC-SWHHF 210
           H++  Y ++ N +  N+L + S D  +  W++   ++     +   +  +   C +  H 
Sbjct: 66  HRDGVYVVAKNYHALNKLATASGDGVVKYWNM--STREELCSFKAHYGLVTGLCVTPQHL 123

Query: 211 ----DENLFGSVSEDSTLKL----HDKRSTSK----------VINTIQAKAAFNTLAFSK 252
               +EN   S  +D  +KL     D  S+++          ++ T   + AF ++   +
Sbjct: 124 SKNKNENYMLSCGDDKMIKLWSVNSDDFSSTRDNDELNTGDGLLKTFHGEYAFQSIDHHR 183

Query: 253 HSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI 312
            + + F   G    I L+D  + +KP+  ++   D +T ++F+  E  IL S G+D  V+
Sbjct: 184 -TKSTFVTGG--AQIELWDTGR-SKPVSNLSWGADNVTSVKFNQNETDILASTGSDNSVV 239

Query: 313 LWDL 316
           L+DL
Sbjct: 240 LYDL 243

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 63/121 (52%), Gaps = 12/121 (9%)

Query: 213 NLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAA----AGLDTNIY 268
           +L  + +ED+ +K++D +S   V      K+A      S+H   L       +G+D  ++
Sbjct: 91  SLIATAAEDA-VKIYDLKSNDCVATLKNGKSAPFLSLDSRH--GLLGCGTELSGVDAELH 147

Query: 269 LYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDE 327
           +YD R   +PL  +   H D IT ++FHP +  +L+SG  D  V ++DL     +Q+ D+
Sbjct: 148 VYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDL----TQQEEDD 203

Query: 328 A 328
           A
Sbjct: 204 A 204

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 80/203 (39%), Gaps = 44/203 (21%)

Query: 121 NIIATINGEGNVSIYDRSKSRS--DGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N IA      +VSIYD +K+ +    L T L  H  +   + FN   S+ LISGS D  I
Sbjct: 179 NYIAICGTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCI 238

Query: 179 ALWDIDS--GSKSPKSVWDNIHSDIVNDCSW---HHFDENLFGSVSEDSTL-KLHDKRST 232
            +WD+ S  G K+   +  N  SD V D  W   + F     G  +       +HD    
Sbjct: 239 KVWDLRSSQGRKNKSDLTINSGSDSVRDVKWMPTYDFSPEEQGPSNRGHRFASIHD---- 294

Query: 233 SKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCL 292
                                       +GL   +  YD RQ ++    +  H     CL
Sbjct: 295 ----------------------------SGL---LLTYDLRQPSQAEKRINAHSGPGLCL 323

Query: 293 QFHPKEDGILVSGGADRRVILWD 315
            +HP  D I+ +GG D +  LW+
Sbjct: 324 CWHPTADYIM-TGGRDGKCCLWN 345

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 10/91 (10%)

Query: 230 RSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK---PLH-VMAGH 285
           R ++K       KA FN      +  N  A  G  T++ +YD  +      PL  +++ H
Sbjct: 159 RISNKTSTISDVKAGFN------NHKNYIAICGTSTSVSIYDINKANTLEGPLTTILSKH 212

Query: 286 EDAITCLQFHPKEDGILVSGGADRRVILWDL 316
             +I  + F+  +  +L+SG  D  + +WDL
Sbjct: 213 TRSINSVDFNMAQSSLLISGSQDGCIKVWDL 243

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 66/140 (47%), Gaps = 11/140 (7%)

Query: 178 IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS---TSK 234
           I LWD++         W    +D +    ++  + ++  S   D+++ L+D R+   T K
Sbjct: 201 IHLWDVNRLKPVSNLSWG---ADNITSVKFNQSETDILASTGSDNSIVLYDLRTNSPTQK 257

Query: 235 VINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQF 294
           ++ T++     N + ++   A  F  A  D N Y YD R  ++ L+V   H  A+  + F
Sbjct: 258 IVQTMRT----NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 295 HPKEDGILVSGGADRRVILW 314
            P  D I V+G  D+ + ++
Sbjct: 314 SPTGDEI-VTGSYDKSIRIY 332

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 84/188 (44%), Gaps = 27/188 (14%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSWHH 209
           H++  Y ++ N    N+L +GS D  I  W++ +  +  S K+ +  I    V    +H 
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPRFHD 125

Query: 210 F-----DENLFGSVSEDSTLKL----------------HDKRSTSKVINTIQAKAAFNTL 248
                 ++N   S S+D T+KL                    +   ++ T   ++AF  +
Sbjct: 126 KKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAFQGI 185

Query: 249 AFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
             S    + FA  G    I+L+D  +  KP+  ++   D IT ++F+  E  IL S G+D
Sbjct: 186 D-SHRENSTFATGG--AKIHLWDVNRL-KPVSNLSWGADNITSVKFNQSETDILASTGSD 241

Query: 309 RRVILWDL 316
             ++L+DL
Sbjct: 242 NSIVLYDL 249

>CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q05583 Saccharomyces cerevisiae YDR267c
          Length = 337

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 111/245 (45%), Gaps = 29/245 (11%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALW-----DIDSGSKSPKSVWDNI--HSDIVND 204
           HK+    +++ P+ S+ L +GS D TI++W     D++ G+K    +   I  H + V  
Sbjct: 58  HKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKG 116

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSK---VINTIQ--AKAAFNTLAFSKHSANLFA 259
            SW   D  L  + S D ++ + +     +    I+ +Q  ++   + +  +KH  NL A
Sbjct: 117 ISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH--NLLA 173

Query: 260 AAGLDTNIYLY-DRRQTTKPLHVMAGHEDAITCLQFHPKEDGI-LVSGGADRRVILWDLA 317
           ++  D  + ++ D     +   V+ GHE  I C  F  +ED I L SG  D  V +W   
Sbjct: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKY- 232

Query: 318 EIGAEQQPDEADDGSPEIL--MIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
            IG     D+ DD    +    +   HRS I      P+     ASV  D V+ V+K  +
Sbjct: 233 -IG-----DDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGR--IASVGADGVLAVYKEKQ 284

Query: 376 NLSRV 380
           N S V
Sbjct: 285 NDSEV 289

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 85/168 (50%), Gaps = 14/168 (8%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +++G+ D T  +WD D  +++P       H + V   SW   D  +  + S
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCD--TQTPMHTLKG-HYNWVLCVSWSP-DGEVIATGS 205

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNT-LAF------SKHSANLFAAAGLDTNIYLYDR 272
            D+T++L D +S   + + ++  + + T L++         S    A++  D  I ++D 
Sbjct: 206 MDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDT 265

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
                  + M+GH ++++C+++  +  G+L SG  DR V +WD+   G
Sbjct: 266 VSRVCQ-YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDINSQG 310

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 90/211 (42%), Gaps = 37/211 (17%)

Query: 117 PKDSNIIATINGEGNVSIYDR----SKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           P     +A+ + +G + I+D      +    G   ++   K  G GL         L SG
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL---------LYSG 295

Query: 173 SDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH-HFDENLFGSVSEDSTLKLHDKRS 231
           S D T+ +WDI+S  +             +N    H H+  +L  S+S D  L++     
Sbjct: 296 SHDRTVRVWDINSQGR------------CINILKSHAHWVNHL--SLSTDYALRIGAFDH 341

Query: 232 TSKVINT---IQAKAAFNTLAFSKHSAN---LFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
           T K  +T    Q KA  N     K + N   +   A  D  ++L++  ++TKP+  M GH
Sbjct: 342 TGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGH 401

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWD 315
           +  +  + F P  DG  +VS   D  + LWD
Sbjct: 402 QKLVNHVAFSP--DGRYIVSASFDNSIKLWD 430

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  +  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDC 173

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 82/169 (48%), Gaps = 16/169 (9%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +++G+ D T  +WD D  +++P       HS+ V   +W   D  +  + S
Sbjct: 148 AFAPHTSSRMVTGAGDNTARIWDCD--TQTPLCTLKG-HSNWVLCVAWSA-DGEVIATGS 203

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANL--------FAAAGLDTNIYLYD 271
            D+T++L D      + + ++    + T + S    +L         A+A  D  I ++D
Sbjct: 204 MDATIRLWDSEKGQSLGDALRGHTKWIT-SLSWEPIHLVKPGEKPRLASASKDGTIKIWD 262

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
             +    ++ ++GH  +++C+++  +   +L S   DR V  WD+A  G
Sbjct: 263 TTRRVC-IYTLSGHTSSVSCIKWGGRN--VLYSASHDRTVRCWDMAAGG 308

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 81/177 (45%), Gaps = 17/177 (9%)

Query: 140 SRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHS 199
           +++  LR   K  K+NG        +   +++GSDDFT+ LW+   GSK    +    H 
Sbjct: 350 AQARALRNYEKVAKKNG-------TMEELMVTGSDDFTMYLWNPLKGSKPILRM--TGHQ 400

Query: 200 DIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFA 259
            +VN  ++   D     S S D+++KL D R   K I T +   A            L  
Sbjct: 401 KLVNHVAFSP-DGRYIVSASFDNSIKLWDGRD-GKFIATFRGHVASVYQVAWSSDCRLLV 458

Query: 260 AAGLDTNIYLYDRRQTTKPLHV-MAGHEDAITCLQFHPKEDGILV-SGGADRRVILW 314
           +   DT + ++D +  T+ L V + GH D +  + +    DG  V SGG D+ V LW
Sbjct: 459 SCSKDTTLKVWDVK--TRKLTVDLPGHNDEVYTVDW--SVDGKRVCSGGKDKMVRLW 511

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 86/206 (41%), Gaps = 27/206 (13%)

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDF 176
           P +   +A+ + +G + I+D ++        TL  H  +   + +     N L S S D 
Sbjct: 243 PGEKPRLASASKDGTIKIWDTTRRVCI---YTLSGHTSSVSCIKWGGR--NVLYSASHDR 297

Query: 177 TIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL--HDKRSTSK 234
           T+  WD+ +G K    +    H+  VN     H       S+S D  L++   D   T  
Sbjct: 298 TVRCWDMAAGGKCINIL--KSHAHWVN-----HL------SLSTDYALRMGPFDHTGTKP 344

Query: 235 V-INTIQAKAAFNTLAFSKHSAN---LFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAIT 290
                 QA+A  N    +K +     L      D  +YL++  + +KP+  M GH+  + 
Sbjct: 345 ASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVN 404

Query: 291 CLQFHPKEDG-ILVSGGADRRVILWD 315
            + F P  DG  +VS   D  + LWD
Sbjct: 405 HVAFSP--DGRYIVSASFDNSIKLWD 428

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  R  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 124 VFKVRPVTRSSSAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDC 171

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 83/170 (48%), Gaps = 20/170 (11%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +++G+ D T  +WD D  +++P +  +  HS+ V   SW   D  +  + S
Sbjct: 146 AFAPDTSSRMVTGAGDNTARIWDCD--TQTPLATLEG-HSNWVLCVSWSP-DGEVIATGS 201

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFN-----TLAFSKHSANL--------FAAAGLDTN 266
            DST++L +      V     + +A         + S    +L         A+A  D  
Sbjct: 202 MDSTIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGT 261

Query: 267 IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           I ++D  +    L+ ++GH +++ C+++    +G+L SG  D+ V +WD+
Sbjct: 262 IKIWDTARRVC-LYTLSGHSNSVACVKW--GGEGLLYSGSHDKTVRVWDM 308

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 91/205 (44%), Gaps = 35/205 (17%)

Query: 123 IATINGEGNVSIYDRSKSRS----DGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           +A+ + +G + I+D ++        G   ++   K  G GL         L SGS D T+
Sbjct: 253 LASASKDGTIKIWDTARRVCLYTLSGHSNSVACVKWGGEGL---------LYSGSHDKTV 303

Query: 179 ALWDIDSGSKSPKSVWDNIHSDIVNDCSW-HHFDENLFGSVSEDSTLKLHDKRSTSKVIN 237
            +WD++S +           S + N   W +H       S+S D  L++     T    +
Sbjct: 304 RVWDMNSATVG------KCISILKNHAHWVNHL------SLSTDYALRIGPFDHTGVKPS 351

Query: 238 TI-----QAKAAFNTLAFSKHSAN-LFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITC 291
           T      +A+A ++ +A    SA  L   A  D  ++L++ ++ TKPL  M GH+  +  
Sbjct: 352 TPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNH 411

Query: 292 LQFHPKEDG-ILVSGGADRRVILWD 315
           + F P  DG  +VS   D  + LWD
Sbjct: 412 VAFSP--DGRYIVSASFDNSIKLWD 434

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  +  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 122 IFKVKPVTRSASAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDC 169

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 66/140 (47%), Gaps = 11/140 (7%)

Query: 178 IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS---TSK 234
           I LWD++         W    +D +    ++  + ++  S   D+++ L+D R+   T K
Sbjct: 201 IHLWDVNRLKPVSDLSWG---ADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQK 257

Query: 235 VINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQF 294
           ++ T++     N + ++   A  F  A  D N Y YD R  ++ L+V   H  A+  + F
Sbjct: 258 IVQTMRT----NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 295 HPKEDGILVSGGADRRVILW 314
            P  D I V+G  D+ + ++
Sbjct: 314 SPTGDEI-VTGSYDKSIRIY 332

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 86/188 (45%), Gaps = 27/188 (14%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSWHH 209
           H++  Y ++ N    N+L +GS D  I  W++ +  +  S K+ +  +    V    +H 
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHD 125

Query: 210 F-----DENLFGSVSEDSTLKL--------HDKRSTSK--------VINTIQAKAAFNTL 248
                  +N   S S+D T+KL         +K S+          +I T   ++AF  +
Sbjct: 126 KKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGI 185

Query: 249 AFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
             S    + FA  G    I+L+D  +  KP+  ++   D IT L+F+  E  IL S G+D
Sbjct: 186 D-SHRENSTFATGG--AKIHLWDVNRL-KPVSDLSWGADNITSLKFNQNETDILASTGSD 241

Query: 309 RRVILWDL 316
             ++L+DL
Sbjct: 242 NSIVLYDL 249

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 4/92 (4%)

Query: 149 LKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH 208
           L +  +N   L FN N ++ L S   D +I L+D+ + S + K V     +   N   W+
Sbjct: 215 LSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIV----QTMRTNAICWN 270

Query: 209 HFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ 240
             +   F + +ED     +D R+ S+ +N  +
Sbjct: 271 PMEAFNFVTANEDHNAYYYDMRNLSRSLNVFK 302

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 88/188 (46%), Gaps = 27/188 (14%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK--SPKSVWDNIHSDIVNDCSWHH 209
           H++  Y ++ N    N+L +GS D  I  W++ +  +  S K+ +  I    V    +H 
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHD 125

Query: 210 F-----DENLFGSVSEDSTLKL--------HDKRSTSK--------VINTIQAKAAFNTL 248
                 ++N   S S+D T+KL         +KRS+          ++ T   ++AF  +
Sbjct: 126 KKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQGI 185

Query: 249 AFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
             S    + FA  G    I+L+D  +  KP+  ++   D IT ++F+  E  IL S G+D
Sbjct: 186 D-SHRENSTFATGG--AKIHLWDVNRL-KPISNLSWGADNITSVRFNQNETDILASTGSD 241

Query: 309 RRVILWDL 316
             ++L+DL
Sbjct: 242 NSIVLYDL 249

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 65/140 (46%), Gaps = 11/140 (7%)

Query: 178 IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS---TSK 234
           I LWD++         W    +D +    ++  + ++  S   D+++ L+D R+   T K
Sbjct: 201 IHLWDVNRLKPISNLSWG---ADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPTQK 257

Query: 235 VINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQF 294
           ++ T++     N + ++   A  F  A  D N Y YD R  ++ L V   H  A+  + F
Sbjct: 258 IVQTMRT----NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVDF 313

Query: 295 HPKEDGILVSGGADRRVILW 314
            P  D I V+G  D+ + ++
Sbjct: 314 SPTGDEI-VTGSYDKSIRMY 332

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 94/212 (44%), Gaps = 30/212 (14%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V NE   +GS+D TI +WD+ SG      +  + H+  V D +  +    LF S SED  
Sbjct: 122 VDNEWFATGSNDTTIKIWDLASGK---LKITLSGHAMTVRDIAISNRHPYLF-SASEDKL 177

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
            K  D    + + +     +  +T+     + +L A AG D+ + L+D R    P+  + 
Sbjct: 178 AKCWDLEKNTAIRDYHGHLSGVHTVDIHP-TLDLIATAGRDSVVKLWDIRSRV-PVVTLI 235

Query: 284 GHEDAIT---CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           GH+  I    CL  +P+    ++S   D  + LWD+              G    ++ H 
Sbjct: 236 GHKSPINKVHCLPVNPQ----VISSSVDATIRLWDIVA------------GKASKVLTH- 278

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            H+ +I D   HP+   ++ +  +D  ++ WK
Sbjct: 279 -HKRSIRDIAFHPSEFSMATACTDD--IRSWK 307

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 15/100 (15%)

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEIL 336
           K + V+ GH   + C+Q  P ++    +G  D  + +WDLA              S ++ 
Sbjct: 102 KLMRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLA--------------SGKLK 147

Query: 337 MIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           +  +GH   + D  +    P+L  S  ED + + W   KN
Sbjct: 148 ITLSGHAMTVRDIAISNRHPYL-FSASEDKLAKCWDLEKN 186

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 83/201 (41%), Gaps = 33/201 (16%)

Query: 121 NIIATINGEGNVSIYDRSKSR-SDG-LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178
           N +A      +VSIYD +++   DG     L  H  +   + FN   ++ LISGS D  I
Sbjct: 179 NYVAICGTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCI 238

Query: 179 ALWDIDS--GSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVI 236
            +WD+ S  G K+   +  N  SD V D  W                +  +D  +   V+
Sbjct: 239 KVWDLRSSQGRKNKSDLTINSGSDSVRDVKW----------------MPTYDFPNNDDVV 282

Query: 237 NTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHP 296
                       A   + ++ FA+      +  YD RQ ++    +  H     CL +HP
Sbjct: 283 ------------AGPSNRSHRFASIHDSGLLLTYDLRQPSQAEKRINAHSGPGLCLSWHP 330

Query: 297 KEDGILVSGGADRRVILWDLA 317
             D I+ +GG D +  LW++ 
Sbjct: 331 TLDYIM-TGGRDGKCCLWNMG 350

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 230 RSTSKVINTIQ-AKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT----KPLHVMAG 284
           R+T++  +TI   KA F+         N  A  G  T++ +YD  +          V++ 
Sbjct: 158 RTTTRKTSTISDVKAGFHNYK------NYVAICGTSTSVSIYDINRANLVDGPASMVLSK 211

Query: 285 HEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           H  +I  + F+  +  +L+SG  D  + +WDL
Sbjct: 212 HTRSINSVDFNMAQTSLLISGSQDGCIKVWDL 243

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 169 LISGSDDFTIALWDID-SGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLH 227
           +IS S+   I +W++  S SK+ + V    H   + D ++H     +  + S D+     
Sbjct: 85  VISTSNQKAI-VWNLSRSSSKAVEHVLHG-HFRAITDINFHPLQPEILATSSIDTYALAW 142

Query: 228 DKRSTSK-VINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHE 286
           D RS  K    T   ++    + ++  ++N+ A +  +  +Y++D R+ T PL V+ GH 
Sbjct: 143 DMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSNI-VYVWDVRKGTSPLSVLEGHS 201

Query: 287 DAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQ 324
            ++  + F+P  +  ++S G D  V  WD  ++  E Q
Sbjct: 202 GSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDELQ 239

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 48/136 (35%), Gaps = 35/136 (25%)

Query: 273 RQTTKPL-HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA------------EI 319
           R ++K + HV+ GH  AIT + FHP +  IL +   D   + WD+               
Sbjct: 100 RSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRS 159

Query: 320 GAEQQP--------------------DEADDGSPEILMIHAGHRSAINDFTLHPTIPWLS 359
           GA Q                      D     SP  L +  GH  ++N    +P      
Sbjct: 160 GAAQVKWNHKNSNVLATSHSNIVYVWDVRKGTSP--LSVLEGHSGSVNSIDFNPFNETEI 217

Query: 360 ASVEEDNVVQVWKCSK 375
            S   D  V+ W  +K
Sbjct: 218 MSSGNDGTVKFWDYNK 233

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 89/176 (50%), Gaps = 10/176 (5%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H ++   L+++P+ S  +++ ++D  I +WD+ SG     +  D  H+  V    +    
Sbjct: 340 HFDSTNSLTYSPDGS-RVVTAAEDGKIKVWDVVSGF--CLATLDE-HTAAVTQVQFAKKG 395

Query: 212 ENLFGSVSEDSTLKLHDK-RSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY 270
           + LF S S D T+K  D  R  +  + T   +  FN+LA       + A +  + +I+++
Sbjct: 396 QVLF-SASLDGTVKAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSMDNFDIHVW 454

Query: 271 DRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPD 326
              QT + L  ++GHE  ++CL F  +E+G+L S   D+ + +W +   G  QQ D
Sbjct: 455 SV-QTGQLLDSLSGHEGPVSCLAF-SQENGVLASASWDKTIRIWYI--FGRSQQVD 506

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 73/173 (42%), Gaps = 24/173 (13%)

Query: 166 SNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLK 225
           +N +IS S D T  +WD+ S       +    H   V D  +      LF S   D +++
Sbjct: 256 TNLIISSSIDTTCIVWDLQSSHYVKTQLI--AHDSEVFDVRFLTKSTQLFASCGGDGSVR 313

Query: 226 LHDKRST--SKVI-----------------NTIQAKAAFNTLAF--SKHSANLFAAAGLD 264
           + D RS   S +I                  T  +  ++  L    S +  N+ A    D
Sbjct: 314 VFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAAD 373

Query: 265 TN-IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           +N I + D R    P+  + GH  ++  +++HP +  +L+S   D +V+ WDL
Sbjct: 374 SNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDL 426

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 82/201 (40%), Gaps = 41/201 (20%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK-AAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D +S+  V   + A  +    + F   S  LFA+ G D 
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 266 NIYLYDRRQ-----------------------TTKPLHVMAGHEDAITCLQFHPKEDGIL 302
           ++ ++D R                        TT P    +    A+  L+  P +  +L
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTP---SSDGSYALLRLEPSPYDPNVL 367

Query: 303 VSGGAD-RRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSAS 361
            +  AD  ++I+ D+      + P+     SP  ++   GH S++N+   HPT   +  S
Sbjct: 368 ATFAADSNKIIILDM------RNPE-----SP--ILTLEGHSSSVNEIKWHPTKRNVLLS 414

Query: 362 VEEDNVVQVWKCSKNLSRVGG 382
             +D  V  W  + +   + G
Sbjct: 415 CSDDCQVLYWDLNNSFMEING 435

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 67/161 (41%), Gaps = 29/161 (18%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGL--------------RTTLK 150
           HD E+   R++ K + + A+  G+G+V ++D RS + S  +                T  
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTT 345

Query: 151 YHKENGYGL------SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNI--HSDIV 202
              +  Y L       ++PNV       +D   I + D+    ++P+S    +  HS  V
Sbjct: 346 PSSDGSYALLRLEPSPYDPNVLATF--AADSNKIIILDM----RNPESPILTLEGHSSSV 399

Query: 203 NDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKA 243
           N+  WH    N+  S S+D  +   D  ++   IN    K+
Sbjct: 400 NEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFMEINGGSVKS 440

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 91/188 (48%), Gaps = 11/188 (5%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H +   GL+++P+ S  +++ S+D  I +WD+ SG     + ++  H+  V+   +    
Sbjct: 340 HFDTLNGLTYSPDGS-RVVTASEDGKIKIWDVVSGF--CLATFEE-HTSAVSAVQFSKRG 395

Query: 212 ENLFGSVSEDSTLKLHDK-RSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLY 270
           + LF S S D T++  D  R  +    T   +  FN+LA    S  +  A  +D      
Sbjct: 396 QVLF-SASLDGTVRAWDLIRYRNFRTFTAAERIQFNSLAVDP-SGEVVCAGSIDNYEIQV 453

Query: 271 DRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD 330
              QT + L  +AGHE  ++CL F  +E+ +L S   D+ + +W +   G  QQ  E  D
Sbjct: 454 WSVQTGQLLDCLAGHEGPVSCLAF-SQENNVLASASWDKTIRVWSI--FGRSQQV-EPID 509

Query: 331 GSPEILMI 338
            S ++L +
Sbjct: 510 VSADVLAL 517

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 124/302 (41%), Gaps = 52/302 (17%)

Query: 126 INGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDS 185
           IN + + S +DR     D   +TL  H    Y  SF+P+ +  L+SGS+D T+ LW +D+
Sbjct: 508 INPKYSSSQFDRFSQ--DNTCSTLVGHSGTVYSTSFSPD-NMYLVSGSEDKTVKLWSMDT 564

Query: 186 --------GSKSPKSVWDNIHSDIVNDCS----------W---HHFDENLF-GSVSEDST 223
                   G   P  VWD   S + +  +          W   H +   +F G  ++  T
Sbjct: 565 HTALVNYKGHNHP--VWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDT 622

Query: 224 LKLHDKR------STSKVINTIQAKAAFNTLAFSKHSANLF-----------AAAGLDTN 266
           +  H         S+ K           +   F  H+A +            A    D  
Sbjct: 623 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGV 682

Query: 267 IYLYDRRQTTKPLHVMAGH-EDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQP 325
           I L+D   T K +  M GH ++A+  L F+ KE  +L+SGGAD  V +WD+     EQ P
Sbjct: 683 ICLWDI-GTGKRIKQMRGHGKNAVHSLSFN-KEGNVLISGGADHSVRVWDVKHGTTEQGP 740

Query: 326 DEADDGSPEILMIHAGHRSAINDF----TLHPTIPWLSA-SVEEDNVVQVWKCSKNLSRV 380
           +     +  +  I A     I D+    T+ PT   +++   +   V +V     NL+  
Sbjct: 741 EPEQPFNAHVGDITASINQDIKDYGRRRTIIPTNDLVASFYTKRSPVFKVKFTRSNLALA 800

Query: 381 GG 382
           GG
Sbjct: 801 GG 802

>ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q12206 Saccharomyces cerevisiae YOR229W WTM2
           WD repeat containing transcriptional modulator 2
           Transcriptional modulator
          Length = 432

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 81/189 (42%), Gaps = 14/189 (7%)

Query: 196 NIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSA 255
           N+ + +++  S+   D NL+ + S+++ +   DKRS S++ +   ++    T   S    
Sbjct: 229 NVEASVIHSVSF--LDNNLYVTCSDENVVSFWDKRSDSQLWSFTDSQDGNITSLSSSSQL 286

Query: 256 NLFAAAGLDTN-IYLYDRR----QTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRR 310
           + F A G D   I L+D R    Q  + +     +ED +  LQF P      +S G    
Sbjct: 287 DGFFATGTDAGVIKLWDLRAIMSQQQEMVSFYHSNEDPVVDLQFSPTNSTEFLSVGKSGN 346

Query: 311 VILWDLAEIGAEQQPDEADDGSPEILMIH-AGHRSAI------NDFTLHPTIPWLSASVE 363
           V  WD       ++ DE D     +  +H  G R +I      N    HP I  L  +++
Sbjct: 347 VYQWDTDFFFTNEEVDEEDLHLQCLKFLHTGGSRRSIGANDKRNMVNWHPAIDQLVGTID 406

Query: 364 EDNVVQVWK 372
            D  +  +K
Sbjct: 407 NDCSIAAYK 415

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 44/115 (38%), Gaps = 14/115 (12%)

Query: 245 FNTLAFSKHSA-----NLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKED 299
           FN  A   HS      NL+     +  +  +D+R  ++        +  IT L    + D
Sbjct: 228 FNVEASVIHSVSFLDNNLYVTCSDENVVSFWDKRSDSQLWSFTDSQDGNITSLSSSSQLD 287

Query: 300 GILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPT 354
           G   +G     + LWDL  I ++QQ         E++  +  +   + D    PT
Sbjct: 288 GFFATGTDAGVIKLWDLRAIMSQQQ---------EMVSFYHSNEDPVVDLQFSPT 333

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 85/168 (50%), Gaps = 14/168 (8%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +++G+ D T  +WD D  +++P       H + V   SW   D  +  + S
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCD--TQTPMHTLKG-HYNWVLCVSWSP-DGEVIATGS 205

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNT-LAF------SKHSANLFAAAGLDTNIYLYDR 272
            D+T++L D ++   + + ++  + + T L++         S    A++  D  I ++D 
Sbjct: 206 MDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDT 265

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
                  + M+GH ++++C+++  +  G+L SG  DR V +WD+   G
Sbjct: 266 VSRVCQ-YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDINSQG 310

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 90/211 (42%), Gaps = 37/211 (17%)

Query: 117 PKDSNIIATINGEGNVSIYDR----SKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           P     +A+ + +G + I+D      +    G   ++   K  G GL         L SG
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL---------LYSG 295

Query: 173 SDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH-HFDENLFGSVSEDSTLKLHDKRS 231
           S D T+ +WDI+S  +             +N    H H+  +L  S+S D  L++     
Sbjct: 296 SHDRTVRVWDINSQGR------------CINILKSHAHWVNHL--SLSTDYALRVGAFDH 341

Query: 232 TSKVINT---IQAKAAFNTLAFSKHSAN---LFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
           T K  +T    Q KA  N     K + N   +   A  D  ++L++  ++TKP+  M GH
Sbjct: 342 TGKRPSTPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGH 401

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWD 315
           +  +  + F P  DG  +VS   D  + LWD
Sbjct: 402 QKLVNHVAFSP--DGRYIVSASFDNSIKLWD 430

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  +  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDC 173

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 82/173 (47%), Gaps = 14/173 (8%)

Query: 151 YHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSG--SKSPKSVWDNIHSDIVNDCSWH 208
           +H +    LS N +    L S S D T+ LWD++SG  ++S  S+ +N +   V+   WH
Sbjct: 287 HHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSGNAARSMASIHNNKN---VSSSQWH 343

Query: 209 HFDENLFGSVSEDSTLKLHDKRSTSK----VINTIQAKAAFNTLAFSKHSANLFAAAGLD 264
           H + ++  +   DS + L D R +++       ++       T+ F+    N+  A    
Sbjct: 344 HGNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFADE--NIILAGTDS 401

Query: 265 TNIYLYDRRQT--TKPLHVMAGHEDAITCLQFHPKEDGILVSGG-ADRRVILW 314
            NIY +D R    +KP+  +  H+  I+ L  +    G++ +G   ++ V LW
Sbjct: 402 GNIYSFDIRNNAGSKPVWTLKAHDAGISSLSVNNFIPGLMSTGAMGEKAVKLW 454

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 71/160 (44%), Gaps = 19/160 (11%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           G + N +++N +  G+ D  I +W++D      K+  D I  + VN         N   S
Sbjct: 223 GSNDNDSLANFVAVGTFDPQIEIWNLDC---VEKAFPDMILGEPVN---------NSMAS 270

Query: 218 VSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTK 277
           +++      H++  TS   + +       +L+ +KH   + A+   D  + L+D      
Sbjct: 271 LTKKKKKTKHNQHITSHHTDAVL------SLSHNKHFRAVLASTSADHTVKLWDLNSGNA 324

Query: 278 PLHVMAGHEDA-ITCLQFHPKEDGILVSGGADRRVILWDL 316
              + + H +  ++  Q+H     IL++GG D R+ L D+
Sbjct: 325 ARSMASIHNNKNVSSSQWHHGNGSILLTGGYDSRIALTDV 364

>KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 911

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 85/172 (49%), Gaps = 8/172 (4%)

Query: 158 GLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGS 217
           GL ++P+ S ++++ S +  I +WD+ SG     + +D  H+  V+   +    + LF S
Sbjct: 346 GLCYSPDGS-KIVTASHEGKIKIWDVASGF--CLATFDE-HAGGVSAVEFAKKGQVLF-S 400

Query: 218 VSEDSTLKLHDK-RSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTT 276
            S D T+K  D  R  +    T   +  FN+LA       + A +    +I+++   QT 
Sbjct: 401 ASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSV-QTG 459

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEA 328
           + +  ++GHE  I+CL F   E+G+L S   D+ + +W L     + +P E 
Sbjct: 460 QLVDTLSGHEGPISCLSF-SNENGVLASASWDKTIRVWSLFGRSQQVEPFEV 510

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 90/209 (43%), Gaps = 24/209 (11%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V NE   +GS+D TI +WD  SG      +  + H   V D         +F S SED  
Sbjct: 119 VDNEWFATGSNDSTIKVWDFASGK---LKLTLSGHVMGVRDLVVSKRHPYMF-SASEDKL 174

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D    + + +     +  +T+     + +L A+AG D+ + L+D R + K +  + 
Sbjct: 175 VKCWDLEKNAPIRDYFGHLSGVHTVDIHP-TLSLIASAGRDSVVKLWDIR-SKKAVITLV 232

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHR 343
           GH+  I  ++  P  D  ++S   D  VI WDL                P  ++ H  HR
Sbjct: 233 GHKSPINSVKCTP-ADPQIISCSNDTTVITWDLVA------------AKPMKVITH--HR 277

Query: 344 SAINDFTLHPTIPWLSASVEEDNVVQVWK 372
            A+ D  +HP     S +    N ++ WK
Sbjct: 278 KAVRDIAVHPGE--FSVASCSTNDIRSWK 304

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 15/96 (15%)

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHA 340
           V+ GH   + C+   P ++    +G  D  + +WD A              S ++ +  +
Sbjct: 103 VINGHLGWVRCIAMDPVDNEWFATGSNDSTIKVWDFA--------------SGKLKLTLS 148

Query: 341 GHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           GH   + D  +    P++  S  ED +V+ W   KN
Sbjct: 149 GHVMGVRDLVVSKRHPYM-FSASEDKLVKCWDLEKN 183

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 95/231 (41%), Gaps = 29/231 (12%)

Query: 159 LSFNPNVSNELISGSDDFTIALWDIDSGS----------KSPKSVWDNIHSDIVNDCSWH 208
           LS N N  N ++S SDD T+ LW ++S             +   +    +SDI      H
Sbjct: 123 LSKNKN-DNFMLSCSDDKTVKLWSVNSEDYVNLKDDEQLNTTSGLLKTFYSDIAFQGIDH 181

Query: 209 HFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIY 268
           H   + F  V+  + ++L D   ++ + N         T+ F+++  ++FA+AG D +I 
Sbjct: 182 HRSNSNF--VTGGAQIQLWDSNRSTPLSNLSWGADNITTVKFNQNETDIFASAGSDNSIV 239

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEA 328
           LYD R  +    ++        C  ++P E    V G  D     +D+  +         
Sbjct: 240 LYDLRTNSPTQKIVQTMRTNAIC--WNPMEAFNFVIGNEDHNAYYYDMRNMS-------- 289

Query: 329 DDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKNLSR 379
                  + +   H SA+ D    PT   +  +   D  ++++K ++  SR
Sbjct: 290 -----RAINVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIFKTNQGHSR 334

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 83/184 (45%), Gaps = 25/184 (13%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDC-SWHHF 210
           H++  Y ++ N    N+L +GS D  I  W++   ++     +   +  I   C +  H 
Sbjct: 66  HRDGVYVIAKNYRNLNKLATGSADGVIKYWNM--STRDEVCSFKAHYGLITGLCVTPEHL 123

Query: 211 ----DENLFGSVSEDSTLKL--------------HDKRSTSKVINTIQAKAAFNTLAFSK 252
               ++N   S S+D T+KL                  +TS ++ T  +  AF  +   +
Sbjct: 124 SKNKNDNFMLSCSDDKTVKLWSVNSEDYVNLKDDEQLNTTSGLLKTFYSDIAFQGIDHHR 183

Query: 253 HSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVI 312
            ++N F   G    I L+D  ++T PL  ++   D IT ++F+  E  I  S G+D  ++
Sbjct: 184 SNSN-FVTGG--AQIQLWDSNRST-PLSNLSWGADNITTVKFNQNETDIFASAGSDNSIV 239

Query: 313 LWDL 316
           L+DL
Sbjct: 240 LYDL 243

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 11/167 (6%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSW--HH 209
           H +  + L+F  + S  L S   D T  +WDI SG+ +   +  + H+  +    W    
Sbjct: 306 HGKEVFCLAFQSDGS-LLCSAGLDCTGMIWDIRSGNCA---MVLSGHTKPIYSVDWSPRG 361

Query: 210 FDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYL 269
           F+     + S D T+ + D R T++    +   +  + + F KH+     + G D NI +
Sbjct: 362 FE---VATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINV 418

Query: 270 YDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           Y      K + ++ GH D I  L      DG +VS G DR V  W++
Sbjct: 419 YSGDSWNK-ITILKGHTDKILALDL-GTHDGSVVSAGWDRSVKSWNV 463

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 97/246 (39%), Gaps = 39/246 (15%)

Query: 146 RTTLKYHKEN----GYGLSFNPNVSNELISGSDD-FTIALWD-----IDSGSKSPKSVWD 195
           R TL +  EN    G  ++ +  +S+   S  D    +  WD     I +GS + KS  +
Sbjct: 158 RRTLAHQLENIGLLGSQIASSRPISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVE 217

Query: 196 NIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTS-KVINTIQAK----AAFNTLAF 250
           N H+  V +  W+    +L  +  ED  +KL   +S   + +  +Q      A      F
Sbjct: 218 NAHTGKVGEVDWNS-SGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPF 276

Query: 251 SKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDG-ILVSGGADR 309
            ++     A+A  D    L+D  +T   L +  GH   + CL F  + DG +L S G D 
Sbjct: 277 GRY----IASASFDNTWRLWD-AETNHELLLQEGHGKEVFCLAF--QSDGSLLCSAGLDC 329

Query: 310 RVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQ 369
             ++WD+               S    M+ +GH   I      P   +  A+   D  V 
Sbjct: 330 TGMIWDIR--------------SGNCAMVLSGHTKPIYSVDWSPR-GFEVATASGDGTVN 374

Query: 370 VWKCSK 375
           +W   K
Sbjct: 375 IWDIRK 380

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 64/122 (52%), Gaps = 2/122 (1%)

Query: 198 HSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQA-KAAFNTLAFSKHSAN 256
           HS  + D +++  + ++  + S D+ +   D RS  +   T  A ++  + + ++   +N
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSN 175

Query: 257 LFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           + A+A    +IY++D R  + PLH + GH+ ++  + F+  +   ++S   D  V  WD+
Sbjct: 176 ILASAH-SNDIYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDI 234

Query: 317 AE 318
           ++
Sbjct: 235 SK 236

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 280 HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           HV+ GH  AIT + F+P+   IL +   D  V  WD+
Sbjct: 111 HVLHGHSRAITDINFNPENPDILATCSVDTYVHAWDM 147

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 118 KDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFT 177
           KDSNI+A+ +   ++ I+D     +   +  L  H  +   + FN   S+E++S S+D T
Sbjct: 172 KDSNILASAHS-NDIYIWDLRMGSTPLHK--LVGHDSSVNSIDFNRFKSSEIMSSSNDGT 228

Query: 178 IALWDIDSGS 187
           +  WDI  GS
Sbjct: 229 VKFWDISKGS 238

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 12/180 (6%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H ++   L+++P+ S  +++ SDD  I +WD+ SG     + +D+ H+  V    +    
Sbjct: 341 HFDSMNSLTYSPDGS-RVVTSSDDGKIKIWDVVSGF--CLATFDD-HTSSVTAVQFAKKG 396

Query: 212 ENLFGSVSEDSTLKLHDK-RSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDT-NIYL 269
           + LF S S D T+K  D  R  +    T   +  FN LA    S  +  A  +D+  I++
Sbjct: 397 QVLF-SASLDGTVKAWDLIRYRNFRTFTAAERIQFNCLAVDP-SGEVVCAGSVDSFEIHV 454

Query: 270 YDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEAD 329
           +   QT   L  +AGHE  ++CL F   E+ +L S   D+ + +W +   G  QQ +  D
Sbjct: 455 WSV-QTGNLLDTLAGHEGPVSCLSF-SNENSVLASASWDKTIRIWSI--FGRSQQVEPFD 510

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 76/153 (49%), Gaps = 8/153 (5%)

Query: 165 VSNE-LISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDST 223
           V NE   +GS+D TI +WD+ SG K   ++  ++ +      S  H    L  S SED  
Sbjct: 136 VDNEWFATGSNDTTIKVWDLASG-KLKLTLAGHVMTVRSIAISQRH---PLMFSASEDKL 191

Query: 224 LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMA 283
           +K  D    + V +     +  +T+     + +L A+AG D  + L+D R T  P+  +A
Sbjct: 192 VKCWDLEKNTVVRDYHGHFSGVHTVDVHP-TLDLIASAGRDAVVRLWDIR-TRVPVMTLA 249

Query: 284 GHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           GH+  I  ++  P +  I+ SG AD  V LWD+
Sbjct: 250 GHKGPINQVKCFPVDPQIM-SGSADSTVRLWDI 281

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 41/100 (41%), Gaps = 15/100 (15%)

Query: 277 KPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEIL 336
           K + V+ GH   + C+   P ++    +G  D  + +WDLA              S ++ 
Sbjct: 116 KLMRVINGHNGWVRCVCVDPVDNEWFATGSNDTTIKVWDLA--------------SGKLK 161

Query: 337 MIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWKCSKN 376
           +  AGH   +    +    P L  S  ED +V+ W   KN
Sbjct: 162 LTLAGHVMTVRSIAISQRHP-LMFSASEDKLVKCWDLEKN 200

>KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {ON}
           Anc_6.325 YCR057C
          Length = 906

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 91/179 (50%), Gaps = 10/179 (5%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H ++   L+++P+ S  +++ ++D  I +WD+ SG     + ++  H+  V    +    
Sbjct: 339 HFDSTNSLTYSPDGS-RVVTAAEDGKIKVWDVVSGF--CLATFEE-HTSSVTQVQFAKKG 394

Query: 212 ENLFGSVSEDSTLKLHDK-RSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDT-NIYL 269
           + LF S S D T++  D  R  +  + T   +  FN+LA    S  +  A  +D+ +I++
Sbjct: 395 QVLF-SASLDGTVRAWDLIRYRNFRVFTAAERIQFNSLAVDP-SGEVVCAGSVDSFDIHV 452

Query: 270 YDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEA 328
           +   QT + L  +AGHE  I+CL F  +E+ IL S   D+ + +W +     + +P E 
Sbjct: 453 WSV-QTGQLLDTLAGHEGPISCLAF-SQENSILASASWDKTIRIWSIFGRSQQVEPIEV 509

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 84/224 (37%), Gaps = 54/224 (24%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFD 211
           H E    ++F+ N S + +S SDD  + +W+  +G +  + V    H D V  C WH   
Sbjct: 165 HTECIRDVAFSANDS-KFVSCSDDNILKIWNFTNGQQ--ERVLTGHHWD-VKSCDWHP-T 219

Query: 212 ENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
             L  S S+D+ +KL D R+ + V   ++ K       F     NL      D +  ++D
Sbjct: 220 MGLIASASKDNLVKLWDPRTGNCVSTILKFKHTVLKTRFQPGGGNLLLGISKDKSCRVFD 279

Query: 272 RRQT--------------------------------------------TKPLHVMA-GHE 286
            RQ                                             TKP+HV+   H+
Sbjct: 280 IRQNMTELMVFRDDVDYMTLLWHPINHSTFTVGNYDGSIKHFDVLQDITKPVHVIPFAHD 339

Query: 287 DAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADD 330
             +T L ++P  + IL S   DR +  W  A       P+  DD
Sbjct: 340 KCVTSLSYNPAGN-ILASASKDRTIRFWTRAR---PVDPNAYDD 379

>KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|Q12523 Saccharomyces
           cerevisiae YPL247C Hypothetical ORF
          Length = 493

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 256 NLFAAAGLDTN-IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILW 314
           N+      D+N I + D R    PL  + GH   +  +Q+HPK+ G+LVS G D +V+ W
Sbjct: 369 NVIVTVAQDSNAIIVLDMRYPGTPLLTLEGHIGPVNQVQWHPKKSGVLVSCGDDCQVLYW 428

Query: 315 DLAEIGAEQQPDEA 328
           D + +  +   + A
Sbjct: 429 DTSALLGQTSSNTA 442

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 83/204 (40%), Gaps = 23/204 (11%)

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRS----DGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           P D   +A+ + +G + I+D S+        G   ++   K  G GL         L SG
Sbjct: 245 PGDKPRLASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWGGQGL---------LYSG 295

Query: 173 SDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRST 232
           S D T+ +WD++ G K    +    H+  VN  S         G     +T     + + 
Sbjct: 296 SHDKTVRVWDMNVGGKCINIL--KSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEAR 353

Query: 233 SKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCL 292
            K +   +  A  N  A       L   A  D  ++L+D  ++ KPL  + GH+  +  +
Sbjct: 354 KKALENYEKIAKRNGKA-----EELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHV 408

Query: 293 QFHPKEDG-ILVSGGADRRVILWD 315
            F P  DG  +VS   D  + LWD
Sbjct: 409 AFSP--DGRFIVSASFDNSIKLWD 430

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 81/163 (49%), Gaps = 14/163 (8%)

Query: 161 FNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSE 220
           F P+ S+ +++G+ D T  +WD D  +++P +     H + V   +W   D     + S 
Sbjct: 151 FAPHTSSRMVTGAGDNTARVWDCD--TQTPMATLSG-HQNWVLCVAWSP-DGETIATGSM 206

Query: 221 DSTLKLHDKRSTSKVINTIQAKAAFNT------LAFSKHS-ANLFAAAGLDTNIYLYDRR 273
           D T++L D ++   + + ++    + T      L   K       A+A  D  I ++D  
Sbjct: 207 DCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTS 266

Query: 274 QTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           +    ++ ++GH ++++C+++  +  G+L SG  D+ V +WD+
Sbjct: 267 RRVC-IYTLSGHTNSVSCVKWGGQ--GLLYSGSHDKTVRVWDM 306

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 22/48 (45%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  +  T+    +AGH   I C QF P     +V+G  D    +WD 
Sbjct: 126 VFKVKPITRSSSAIAGHGATILCSQFAPHTSSRMVTGAGDNTARVWDC 173

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 60/132 (45%), Gaps = 16/132 (12%)

Query: 63  TSGEEV------DYLKVAALDLPDEVVTGEANDDNRR-----TKSNIKIVKKFEHDGEIN 111
           TS EE       +Y K+A  +   E +   A+DD        TKS   + +   H   +N
Sbjct: 347 TSAEEARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVN 406

Query: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELIS 171
              + P D   I + + + ++ ++D    R+    +T + H  + Y ++++ +    L+S
Sbjct: 407 HVAFSP-DGRFIVSASFDNSIKLWD---GRNGTFISTFRGHVASVYQVAWSSDC-RLLVS 461

Query: 172 GSDDFTIALWDI 183
            S D T+ +WD+
Sbjct: 462 CSKDTTLKVWDV 473

>TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON}
           Anc_7.231 YIL046W
          Length = 574

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 15/168 (8%)

Query: 149 LKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH 208
            K H +    L FN  +   L +GS D TIA+WD+ SG    +    N HSD +      
Sbjct: 236 FKGHMDGVLTLQFNYRL---LFTGSYDSTIAIWDLYSGKLIRRL---NGHSDGIKT---L 286

Query: 209 HFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIY 268
           +FDEN   + S D T+++ D +   + I+T +  +  +++        L  +   D ++ 
Sbjct: 287 YFDENKLITGSLDKTIRVWDYKG-GRCISTYKGHS--DSILSVDCYKKLIVSGSADCSVK 343

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++   + T   + + GH + + C++ HP       S   D  + +WDL
Sbjct: 344 VWHIERRT--CYTLKGHTEWVNCVKLHPTSFSCF-SASDDCTIRMWDL 388

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 78/164 (47%), Gaps = 3/164 (1%)

Query: 162 NPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSED 221
           +P+  + +IS S+   + LW++   S        + HS  + D ++H     +  + S D
Sbjct: 78  HPSKPSWVISTSNQKAL-LWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSID 136

Query: 222 STLKLHDKRSTSKVINTIQA-KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLH 280
           + +   D RS  +   +     A  + + ++  ++N+ A+A    ++Y++D R+   PLH
Sbjct: 137 AYVHAWDMRSPRRAYYSASVWSAGASQVKWNYKNSNVMASAH-SNDVYIWDLRKGCTPLH 195

Query: 281 VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQ 324
           V+ GH +++  + F   ++  ++S   D  V  WD +    E Q
Sbjct: 196 VLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWDYSLSDKEPQ 239

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 15/136 (11%)

Query: 238 TIQAKAAFNTLAFSKHSANLFAAA--GLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFH 295
           +++    FN ++ S    ++  A+  GL   I L D     + LH +   E A      H
Sbjct: 20  SLRVDGGFNAVSISPSGRDVVLASRQGLYV-IDLDDPFSAPRWLHHITSWEVADVQWSPH 78

Query: 296 PKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTI 355
           P +   ++S  ++++ +LW+L+            + S  I  +  GH  AI D   HPT 
Sbjct: 79  PSKPSWVIST-SNQKALLWNLSR-----------NSSDAIEHVLHGHSRAITDINFHPTH 126

Query: 356 PWLSASVEEDNVVQVW 371
           P + A+   D  V  W
Sbjct: 127 PEILATCSIDAYVHAW 142

>TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.663
           YKL021C
          Length = 393

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 19/111 (17%)

Query: 264 DTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGI---LVSGGADRRVILWDLAEIG 320
           D +I +YD  Q  K L  +  H+ +IT L+F   ED     L S   D+ +I+W + +  
Sbjct: 61  DEHIRIYDL-QKRKELGTLLAHQGSITGLKFSKTEDNKSKWLFSSSDDKNIIIWRVKD-- 117

Query: 321 AEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
                        E   I  GH + INDF +HP+   ++ SV ED+ +++W
Sbjct: 118 ------------WENFGILKGHMNRINDFDIHPS-NRIAVSVSEDHTIRLW 155

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 53/121 (43%), Gaps = 27/121 (22%)

Query: 114 RYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNP---NVSNELI 170
           RY+   SN       + ++ IYD  K +  G   TL  H+ +  GL F+    N S  L 
Sbjct: 53  RYLVSGSN-------DEHIRIYDLQKRKELG---TLLAHQGSITGLKFSKTEDNKSKWLF 102

Query: 171 SGSDDFTIALWDIDSGSKSPKSVWDNI-----HSDIVNDCSWHHFDENLFGSVSEDSTLK 225
           S SDD  I +W +          W+N      H + +ND   H     +  SVSED T++
Sbjct: 103 SSSDDKNIIIWRVKD--------WENFGILKGHMNRINDFDIHP-SNRIAVSVSEDHTIR 153

Query: 226 L 226
           L
Sbjct: 154 L 154

>NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4.122
          Length = 575

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 91/198 (45%), Gaps = 18/198 (9%)

Query: 123 IATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWD 182
           +A   G G V IYD  K +   +RT L  H +    LS+N ++   L SGS D TI   D
Sbjct: 322 LAVGQGNGIVEIYDVVKRKC--IRT-LPGHVDRTSCLSWNNHI---LSSGSRDHTILHRD 375

Query: 183 IDSGSKSPKSVWDNI--HSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ 240
           +    +  +  ++ I  HS  V    W+  DEN   S   D+ + ++D  S+S V    +
Sbjct: 376 V----RMAEPFFERIKTHSQEVCGLKWN-VDENKLASGGNDNMVYVYDGTSSSPVFKITE 430

Query: 241 AKAAFNTLAFSKHSANLFAAAG--LDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKE 298
            KAA   +A+S H     A  G  +D  + +++   +TK   +  G +  +  + +    
Sbjct: 431 HKAAVKAMAWSPHKRGTLATGGGTVDRKLKIWNINTSTKTSDIDTGSQ--VCNMVWSKNT 488

Query: 299 DGILVSGGADR-RVILWD 315
           D ++ S G  +  + LWD
Sbjct: 489 DELVTSHGYSKYNLTLWD 506

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 93/209 (44%), Gaps = 37/209 (17%)

Query: 132 VSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKS-- 189
           + ++D +KS   G    LK HK     L  +    N +IS   D T+ LW++D G +S  
Sbjct: 390 IKLWDLTKSTQIG---ELKGHKATVNSLQMDLTY-NMVISAGKDATVKLWNVDLGIESFN 445

Query: 190 ------PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQ--- 240
                 P     + H+D +   S +H  ENL  S S D T++  D + T K I  +    
Sbjct: 446 TERYFNPCIYTFDSHTDEITAISSYH--ENLV-SGSRDKTIRQWDLK-TGKCIQILNIGF 501

Query: 241 ---AKAAFNTL----------AFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHED 287
               K    T+          A     A L A  G D  + L+D R   K +  ++GHE+
Sbjct: 502 LNSQKELLGTVDPIRSPPPIGALQCRDAAL-ATGGQDGIVRLWDLR-IGKVVRSLSGHEN 559

Query: 288 AITCLQFHPKEDGILVSGGADRRVILWDL 316
           AIT L+F   +D  +V+G  D+  I WDL
Sbjct: 560 AITALKF---DDLHVVTGSLDKTAITWDL 585

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 15/92 (16%)

Query: 280 HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIH 339
           +V   HED IT L F      +  +G  D  + LWDL +             S +I  + 
Sbjct: 359 YVQKAHEDNITTLDFDFPNGTLSTAGHLDHTIKLWDLTK-------------STQIGEL- 404

Query: 340 AGHRSAINDFTLHPTIPWLSASVEEDNVVQVW 371
            GH++ +N   +  T   +  S  +D  V++W
Sbjct: 405 KGHKATVNSLQMDLTYNMV-ISAGKDATVKLW 435

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 129/289 (44%), Gaps = 52/289 (17%)

Query: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELIS 171
           R+     D   +AT   +  + I+D ++ +   +   L+ H+++ Y L + P+  ++L+S
Sbjct: 466 RSVCFSPDGKFLATGAEDRLIRIWDIAQKK---IVMVLQGHEQDIYSLDYFPS-GDKLVS 521

Query: 172 GSDDFTIALWDIDSGSKS-PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           GS D T+ +WD+ +G  S   S+ D + +  V+       D     + S D  +++ D  
Sbjct: 522 GSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPG-----DGKYIAAGSLDRAVRVWDSE 576

Query: 231 STSKVINTIQAKAAFNT--------LAFSKHSANLFAAAGLDTNIYLYDRR----QTTKP 278
            T  ++  + ++    T        + F++   N+ + + LD ++ L++ R    Q  KP
Sbjct: 577 -TGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGS-LDRSVKLWNLRGDNNQDVKP 634

Query: 279 ------LHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGS 332
                      GH+D +  +    + D  ++SG  DR V+ WD               G+
Sbjct: 635 NVPGTCEVTYTGHKDFVLSVATT-QNDEYILSGSKDRGVLFWD------------TKSGN 681

Query: 333 PEILMIHAGHRSAI------NDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
           P  L++  GHR+++      N F L P +  + A+   D   ++WK ++
Sbjct: 682 P--LLMLQGHRNSVISVAVANGFPLGPNV-GVFATGSGDCKARIWKYTR 727

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 109/229 (47%), Gaps = 16/229 (6%)

Query: 99  KIVKKFEHDG-EINRAR-----YMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYH 152
           K +KKFE  G ++  +R      +  D +++AT +  G++ I   S    + ++     H
Sbjct: 167 KSLKKFELSGSQLVSSRPVSQVAISSDDSMVATCSWGGDLKIL--STETLEIIKAFDTAH 224

Query: 153 KENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDE 212
                G+ +NP+    L++G+ +  I +W++++ S+SP       H + V    +H   +
Sbjct: 225 DSKIGGVDWNPD-GTALVTGAANGEIRIWNLNNDSESPAGTLTG-HENRVARVRFHPSGK 282

Query: 213 NLFGSVSEDSTLKLHD-KRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYD 271
            +  S S D T +L D ++     +    AK  +  +AF K   +L  + GLD+   ++D
Sbjct: 283 YV-ASASFDMTWRLWDVEKQIELQLQEGHAKEVY-CVAFQK-DGSLLCSTGLDSVGLVWD 339

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
            R + K +  + GH   I  L + P    I  +G AD  + LWD+ ++G
Sbjct: 340 LR-SGKSIMALEGHIKPIYGLDWSPNGYDI-ATGSADGTIRLWDVRKVG 386

>ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 371

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 98/252 (38%), Gaps = 43/252 (17%)

Query: 157 YGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFG 216
           + +++N    N+++    D T+ L+D     + P +++ N H   V  C+W+   +  F 
Sbjct: 64  FDVAWNEAHENQVLVAQGDGTLRLFDTKL-KQYPIAIF-NEHQKEVFSCNWNLVGKQNFV 121

Query: 217 SVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLA--------------------------- 249
           S S D  +K+   +    ++  +      +T+A                           
Sbjct: 122 SSSWDGAVKIWSPQRKESLLTVVPRPMDVSTMACAGPQVPMSNQKGHADIAKNKNCIYQA 181

Query: 250 -FSKHSANLFAAAGLDTNIYLYDRRQTTKPLH--VMAGHE--DAITCLQFHPKEDGILVS 304
            FS H  NL      ++ + L+D RQ   P +      H   +A+TC  F+      LV+
Sbjct: 182 LFSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTC-DFNKYRPHSLVT 240

Query: 305 GGADRRVILWDLAEIGAEQQPDEAD--DGSPEILM--IHAGHRSAINDFTLHPTIPWLSA 360
           GG D  + +WDL  +G    P  A   + SP +    I  GH  A+   +  P    +  
Sbjct: 241 GGVDNCIRIWDLRMVG----PSAASRANASPAVCTNEIVGGHELAVRKVSWSPHHSNILL 296

Query: 361 SVEEDNVVQVWK 372
           S   D    +W+
Sbjct: 297 STSYDMTCCIWQ 308

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 110 INRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNE 168
           I +A + P D N++   +G   V+++D R        ++ L +         FN    + 
Sbjct: 178 IYQALFSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFNKYRPHS 237

Query: 169 LISGSDDFTIALWDI--------DSGSKSPKSVWDNI---HSDIVNDCSWHHFDENLFGS 217
           L++G  D  I +WD+           + SP    + I   H   V   SW     N+  S
Sbjct: 238 LVTGGVDNCIRIWDLRMVGPSAASRANASPAVCTNEIVGGHELAVRKVSWSPHHSNILLS 297

Query: 218 VSEDST------LKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAA 260
            S D T      L    +RST +  N++  +    +  F++H+  +++A
Sbjct: 298 TSYDMTCCIWQDLGFDGRRSTGRT-NSVDPRRGCRS-RFAQHTEFVYSA 344

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 83/213 (38%), Gaps = 44/213 (20%)

Query: 118 KDSNIIATINGEGNVSIYDRSKSRS--DGLRTTLKYHKENGYGLSFNPNVSNELISGSDD 175
           K +N IA  N    +SIYD +K+ +  + L T+   H        FN   ++ LISG  D
Sbjct: 194 KYNNYIAVCNNSTIISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQD 253

Query: 176 FTIALWDIDSGSKSPKSVWD---NIHSDIVNDCSW------HHFDENLFGSVSEDSTLKL 226
             I +WD+ S S S  +  D   N  SD + D  W        F+++  G  + +S  K 
Sbjct: 254 GQIKIWDLRSNSLSGSNKPDLNINAASDSIRDVKWMPGYNFSSFNQSYDGKQTGNSEYKF 313

Query: 227 HDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHE 286
                                   S H + L            +D RQ  +    +  H 
Sbjct: 314 A-----------------------SIHDSGLLLK---------FDIRQPNQVEKKINAHT 341

Query: 287 DAITCLQFHPKEDGILVSGGADRRVILWDLAEI 319
               CL +HP +D I  +GG D +  +W + ++
Sbjct: 342 GPGLCLNWHPNQDYI-ATGGRDGKCCIWYIGDV 373

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 208 HHFDENLFGSVSEDSTLK--LHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDT 265
           H F +      S+ ++L   L+ +R   K+      K+ F      +   N  A     T
Sbjct: 153 HEFTQGFSSGSSQLNSLNPNLNKRRRQIKLSTIADVKSGF------QKYNNYIAVCNNST 206

Query: 266 NIYLYDRRQTTK---PLHV-MAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLA--EI 319
            I +YD  +      PL    + H  A+    F+  +  +L+SGG D ++ +WDL    +
Sbjct: 207 IISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDLRSNSL 266

Query: 320 GAEQQPD 326
               +PD
Sbjct: 267 SGSNKPD 273

>KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 aa]
           {ON} weakly similar to uniprot|Q12206 YOR229W
           Saccharomyces cerevisiae WTM2 WD repeat containing
           transcriptional modulator 2
          Length = 449

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 52/118 (44%), Gaps = 6/118 (5%)

Query: 216 GSVSEDSTLKLHD-KRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQ 274
           G   E S LK+ D  +S   +I TI       T +   H  N+F+    D  I  YD R 
Sbjct: 205 GPGEEHSLLKIVDNSQSPGNLIRTISIPGVSVTQSIKFHDNNMFSTCSDDNGIRFYDIRG 264

Query: 275 TTKPL-HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGA----EQQPDE 327
             KPL  V   H+  +TC    P  + + ++G     + LWDL  + A    +++P E
Sbjct: 265 DGKPLWTVFEPHDGKLTCYDVSPTLETLFITGSDTGVLKLWDLRSVIACEIEQKEPTE 322

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 15/102 (14%)

Query: 96  SNIKIVKKFEHDGEINRARYMP----------KDSNIIATINGEGNVSIYDRSKSRSDG- 144
           S +KIV   +  G + R   +P           D+N+ +T + +  +  YD    R DG 
Sbjct: 211 SLLKIVDNSQSPGNLIRTISIPGVSVTQSIKFHDNNMFSTCSDDNGIRFYD---IRGDGK 267

Query: 145 -LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDS 185
            L T  + H         +P +    I+GSD   + LWD+ S
Sbjct: 268 PLWTVFEPHDGKLTCYDVSPTLETLFITGSDTGVLKLWDLRS 309

>KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 80/197 (40%), Gaps = 34/197 (17%)

Query: 210 FDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAF--SKHSANLFAAAGLDTNI 267
           FD   FGS S+D+T++  D R+  K I ++         AF  S+ +  LF        I
Sbjct: 241 FDNYTFGSCSDDNTIRFWDIRTADKPIFSLSEPKNGKLTAFDASQITNELFVTGTSTGVI 300

Query: 268 YLYDRRQ----TTKPLHVMAGHE--------------DAITCLQFHPKEDGILVSGGADR 309
            L+D R     TT   H   GH+              D++  +QF P       + G   
Sbjct: 301 KLWDIRSVEFATTDLTHRQNGHDPIQTELVNLYHSGGDSVADVQFSPTSSSEFATVGGSG 360

Query: 310 RVILWDLAEIGAEQQPDEADDG----SPEIL------MIHAGH----RSAINDFTLHPTI 355
            V  WD+    ++   D+A       +PE L        H G+    R+  N    HPTI
Sbjct: 361 NVYHWDMEFFFSQNDDDDAGATAKLPAPEELQGQCLKFFHIGNNQQKRNVKNSVAWHPTI 420

Query: 356 PWLSASVEEDNVVQVWK 372
             L  +V++ +++ V+K
Sbjct: 421 DDLVCTVDDTSLISVYK 437

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 99/229 (43%), Gaps = 41/229 (17%)

Query: 148 TLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSW 207
           T + H +    LS +P+    L+SGS D TI  WD+ SG K  +++          D S+
Sbjct: 495 TFEAHTDEVTALSLDPSF---LVSGSQDRTIRQWDLRSG-KCMQTI----------DLSF 540

Query: 208 HHFDENLFGSVSED-STLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
            +    L  + + D S   L  +RS    I  +Q+  A              A    D  
Sbjct: 541 ANV---LTAATNVDLSKSTLLTQRSERPSIGALQSFDA------------ALATGTKDGI 585

Query: 267 IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWD-----LAEIGA 321
           + L+D R + K +  + GH DAIT L+F  +    LV+G  DR V +WD     L++  A
Sbjct: 586 VRLWDLR-SGKVIRTLKGHTDAITSLKFGSE---CLVTGSYDRTVRVWDLRTGLLSKFHA 641

Query: 322 EQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQV 370
             +P  + D   E   +   + +A+  +  +    W  + VE+ N V V
Sbjct: 642 YSEPILSLDLCQENAAVIVANETAVQIYDSNKDESW--SCVEQGNEVNV 688

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 276 TKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
           TK   + + H+D ITCL F      +  +G  D  V +WDL++
Sbjct: 386 TKMGSINSTHDDFITCLDFDAPFGTLCTAGYLDHTVKIWDLSK 428

>TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {ON}
           Anc_5.429 YDR364C
          Length = 447

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 79/173 (45%), Gaps = 7/173 (4%)

Query: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204
           ++   K H+     LSF P   +  +SG +D T+ LWD+    K  +      H+  +  
Sbjct: 146 IKYKFKGHENGTTALSFFPKSGHMFLSGGNDNTLRLWDVYHERKCLRDYLG--HTRALKS 203

Query: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLD 264
            S++  D + F S S D T+K+ D   T K+I  ++  +  N L F   + + +     +
Sbjct: 204 FSFND-DGSKFLSSSYDQTVKMWDTE-TGKIITKLKLHSIPNDLTFRPLNPDEYIVGLSN 261

Query: 265 TNIYLYDRRQTTKP--LHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
           + I  +D R ++K   +     H  +I  LQ+ P +    +S   D+ V +W+
Sbjct: 262 STIKHFDNRVSSKQGLVQTYDHHLSSILKLQYFP-DGSKFISSSEDKTVKIWE 313

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 71/169 (42%), Gaps = 29/169 (17%)

Query: 211 DENLFGSVSEDSTLKLHDKRS-TSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYL 269
           D NL   + +D+ L+L D    TSK++ T    + F   +   +    F    +DT+I  
Sbjct: 78  DSNL--DLKDDNELELMDNEEFTSKIVET----SNFYGQSTKDYQGRSFLYPPIDTDIDF 131

Query: 270 YDRRQTTKPL------HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQ 323
              + + K        +   GHE+  T L F PK   + +SGG D  + LWD+       
Sbjct: 132 QKPKLSFKCFIPKTIKYKFKGHENGTTALSFFPKSGHMFLSGGNDNTLRLWDVYH----- 186

Query: 324 QPDEADDGSPEILMIHAGHRSAINDFTLH-PTIPWLSASVEEDNVVQVW 371
                     + L  + GH  A+  F+ +     +LS+S   D  V++W
Sbjct: 187 --------ERKCLRDYLGHTRALKSFSFNDDGSKFLSSSY--DQTVKMW 225

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 261 AGLDTNIYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEI 319
           +G+D  I++YD R   KP+ ++   H D +T ++FHP +  +L+SG  D    ++DL ++
Sbjct: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183

Query: 320 GAE 322
             E
Sbjct: 184 EEE 186

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 2/110 (1%)

Query: 216 GSVSEDSTLKLHD-KRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQ 274
           G+  E S LK+ D  +S  ++I +I       T     H  ++F+    D  I  YD R 
Sbjct: 137 GTGEEHSLLKIVDNSQSPGRLIRSICIPGTTVTHTIKFHDNHMFSTCSDDNKIRFYDTRG 196

Query: 275 TTKPL-HVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQ 323
             KPL  V   H+  +TC    P  + + V+G     + LWDL  + A Q
Sbjct: 197 DGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDLRSVIAAQ 246

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 103/211 (48%), Gaps = 36/211 (17%)

Query: 149 LKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKS-PKSVWDNIHSDIVNDCSW 207
           LK H+++ Y L + P+   +L+SGS D +I +WD+ +G  S   S+ D + +  V+    
Sbjct: 379 LKGHEQDIYSLDYFPD-GQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPN-- 435

Query: 208 HHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQA--------KAAFNTLAFSKHSANLFA 259
              +  L  + S D ++++ D  ST  ++  + +        + +  ++AF+K   ++ +
Sbjct: 436 ---EGKLIAAGSLDRSVRIWDS-STGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVS 491

Query: 260 AAGLDTNIYLYD----RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWD 315
            + LD  + L++    +  T K      GH+D +  +     +D  + SG  DR VI+WD
Sbjct: 492 GS-LDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATS-NDDKYIFSGSKDRGVIIWD 549

Query: 316 LAEIGAEQQPDEADDGSPEILMIHAGHRSAI 346
                        D G+P ILM+  GHR+++
Sbjct: 550 ------------KDSGNP-ILMLQ-GHRNSV 566

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 68/144 (47%), Gaps = 15/144 (10%)

Query: 178 IALWDIDSGSKSPKSVW--DNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRS---T 232
           I LWDI+         W  DNI +       ++  + +L  S   D+++ L+D R+   T
Sbjct: 197 IELWDINRRKPLSNLSWGIDNITA-----VKFNQNEADLLLSSGSDNSVVLYDLRTNSPT 251

Query: 233 SKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCL 292
            K++ T++     N++ ++      F  A  D N Y YD R  ++ LHV   H  AI  +
Sbjct: 252 QKIVQTMKT----NSMCWNPMEPFNFVTANEDQNAYYYDMRNMSRALHVFKDHVSAIMDV 307

Query: 293 QFHPKEDGILVSGGADRRVILWDL 316
              P  + I V+G  D+ + ++++
Sbjct: 308 DISPTGEEI-VTGSYDKTIRIFNI 330

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 84/188 (44%), Gaps = 31/188 (16%)

Query: 152 HKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSK----------------SPKSVWD 195
           H++  Y ++ N NV N L S S D  +  W+I +  +                SP+ + +
Sbjct: 66  HRDGCYVIAKNYNVLNRLASASADGVVKYWNISTREELCSFKAHYGLVTGLCVSPQHIGN 125

Query: 196 NIHSDIVNDCS-------WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTL 248
              S +++ C        W   D   F +V +D+ + LH       +I T   + AF  +
Sbjct: 126 QSDSYMLS-CGDDKMVKMWS-VDSGDFNNVKDDTKV-LHPSDGNG-LIKTFYGEHAFQGI 181

Query: 249 AFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGAD 308
              K + + F   G    ++  +RR   KPL  ++   D IT ++F+  E  +L+S G+D
Sbjct: 182 DHHKENTS-FVTGGAQIELWDINRR---KPLSNLSWGIDNITAVKFNQNEADLLLSSGSD 237

Query: 309 RRVILWDL 316
             V+L+DL
Sbjct: 238 NSVVLYDL 245

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 115/278 (41%), Gaps = 40/278 (14%)

Query: 128 GEGNVSIYD-RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSG 186
           G GN+ I D   + R   + + +   ++  Y +++N    N+++    D ++ L+D  S 
Sbjct: 37  GNGNLFILDIDPQGRIHSMNSFMT--QDCLYDVAWNELHENQVLVAQGDGSLRLFDT-SL 93

Query: 187 SKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL-----HDKRSTSKVINTIQA 241
            K P +++   HS  V  C+W+  ++  F S S D T+K+      +   T +V   +Q+
Sbjct: 94  QKFPIAIFKE-HSKEVLSCNWNLINKQTFVSSSWDGTVKIWTPNRKESLRTLQVQPVMQS 152

Query: 242 KAAFNTLA--------------------FSKHSANLFAAAGLDTNIYLYDRRQ---TTKP 278
           +   NT+A                    FS H  NL      ++ + L+D RQ     K 
Sbjct: 153 QLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQ 212

Query: 279 LHVMAGH-EDAITCLQFHPKEDGILVSGGADRRVILWD---LAEIGAEQQPDEADDGSPE 334
              +A +  + +TC  F+     ++ + G D  + +WD   L  +G + Q    +  +  
Sbjct: 213 QRFLAHNGSETLTC-DFNKYRPTVVATSGVDSSIRIWDIRMLVNLGPQSQ--HINSSAAC 269

Query: 335 ILMIHAGHRSAINDFTLHPTIPWLSASVEEDNVVQVWK 372
           I  I   H  A+      P  P +  S   D    VW+
Sbjct: 270 INEITRAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQ 307

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 78/196 (39%), Gaps = 32/196 (16%)

Query: 110 INRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGLRTTLKYHKENGYGLSFNPNVSNE 168
           I +A++ P D N++   +G   V+++D R  + ++  +  L ++        FN      
Sbjct: 176 IYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTV 235

Query: 169 LISGSDDFTIALWDIDS-GSKSPKSVWDNIHSDIVND-----------CSWHHFDENLFG 216
           + +   D +I +WDI    +  P+S   N  +  +N+            +W     N+  
Sbjct: 236 VATSGVDSSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHPNVLL 295

Query: 217 SVSEDSTLKL-----HDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAA----------- 260
           S S D T  +     +D    +   N+I +   F    F+ HS  +F A           
Sbjct: 296 SASYDMTCSVWQDLSYDGSRFTMKTNSIDSSKGF-IKRFTGHSEFVFGADWSLWGQPGFI 354

Query: 261 --AGLDTNIYLYDRRQ 274
              G D N++L++  Q
Sbjct: 355 ATTGWDGNVFLWNGLQ 370

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/216 (19%), Positives = 89/216 (41%), Gaps = 36/216 (16%)

Query: 134 IYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDI---DSGSKSP 190
           + D + ++++G R T+  +K   Y   F+P+  N ++  S +  + L+D+   +S +K  
Sbjct: 154 LVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQ 213

Query: 191 KSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR-------------STSKVIN 237
           + +  N    +   C ++ +   +  +   DS++++ D R             S++  IN
Sbjct: 214 RFLAHNGSETLT--CDFNKYRPTVVATSGVDSSIRIWDIRMLVNLGPQSQHINSSAACIN 271

Query: 238 TIQA--KAAFNTLAFSKHSANLFAAAGLDTNIYL-----YDRRQTTKPLHVMAGHEDAIT 290
            I    + A   +A+S H  N+  +A  D    +     YD  + T   + +   +  I 
Sbjct: 272 EITRAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQDLSYDGSRFTMKTNSIDSSKGFIK 331

Query: 291 CLQFHPK-----------EDGILVSGGADRRVILWD 315
               H +           + G + + G D  V LW+
Sbjct: 332 RFTGHSEFVFGADWSLWGQPGFIATTGWDGNVFLWN 367

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 126/290 (43%), Gaps = 53/290 (18%)

Query: 112 RARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELIS 171
           R+     D   +AT   +  + I+D +K +   +   L+ H+++ Y L + P+  ++L+S
Sbjct: 379 RSVCFSPDGKFLATGAEDRLIRIWDIAKKQ---IVMVLQGHEQDIYSLDYFPS-GDKLVS 434

Query: 172 GSDDFTIALWDIDSGSKS-PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230
           GS D T+ +WD+ +G  S   S+ D + +  V+       D     + S D  +++ D  
Sbjct: 435 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPG-----DGKFIAAGSLDRAVRVWDSE 489

Query: 231 STSKVINTIQAKAAFNT--------LAFSKHSANLFAAAGLDTNIYLYDRR------QTT 276
            T  ++  + ++    T        + F++   N   +  LD ++ L++ R       + 
Sbjct: 490 -TGFLVERLDSENELGTGHKDSVYSVVFTR-DGNGVVSGSLDRSVKLWNLRGDKNNSSSG 547

Query: 277 KPLH-----VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDG 331
           KP          GH+D +  +    + D  ++SG  DR V+ WD               G
Sbjct: 548 KPTPGTCEVTYTGHKDFVLSVATT-QNDQYILSGSKDRGVLFWD------------TQSG 594

Query: 332 SPEILMIHAGHRSAI------NDFTLHPTIPWLSASVEEDNVVQVWKCSK 375
           +P  L++  GHR+++      N F L P    + A+   D   ++WK +K
Sbjct: 595 NP--LLMLQGHRNSVISVAVANGFPLGPQY-GVFATGSGDCKARIWKYTK 641

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 76/170 (44%), Gaps = 34/170 (20%)

Query: 148 TLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSW 207
           T + H +    LS +PN    L+SGS D TI  WD+ SG K  +++          D S+
Sbjct: 491 TFEAHIDEVTALSLDPNF---LVSGSQDRTIRQWDLCSG-KCMQTI----------DLSF 536

Query: 208 HHFDENLFGSVSED-STLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
            +    L  + + D S   L  +RS    I  +Q+  A              A    D  
Sbjct: 537 ANV---LTTATNVDLSKSTLLTQRSERPTIGALQSFDA------------ALATGTKDGI 581

Query: 267 IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           + L+D R + K +  + GH DAIT L+F   +   LV+G  DR V +WDL
Sbjct: 582 VRLWDLR-SGKVIRTLEGHTDAITSLKF---DSACLVTGSYDRTVRVWDL 627

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 57/136 (41%), Gaps = 17/136 (12%)

Query: 248 LAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGA 307
           L F      L  A  LD  + ++D  +  K +  +AGH   I C+Q   ++ G LV+GG 
Sbjct: 398 LDFDGPFGTLCTAGYLDHTVKIWDLSKR-KKIGELAGHLATINCMQID-RDYGTLVTGGR 455

Query: 308 DRRVILWDLAEIGAEQQPDEADD--------GSPEILMIHAGHRSAINDFTLHPTIPWLS 359
           D  + LW+L    AEQ   E  +         SP +    A H   +   +L P      
Sbjct: 456 DAALKLWNLNL--AEQLYQETQNLTCPASQIDSPCVFTFEA-HIDEVTALSLDPN---FL 509

Query: 360 ASVEEDNVVQVWK-CS 374
            S  +D  ++ W  CS
Sbjct: 510 VSGSQDRTIRQWDLCS 525

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 276 TKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318
           TK   + + H+D ITCL F      +  +G  D  V +WDL++
Sbjct: 382 TKIGSIESAHDDFITCLDFDGPFGTLCTAGYLDHTVKIWDLSK 424

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 81/165 (49%), Gaps = 16/165 (9%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +I+G+ D T  +WD +  +++P S     H + V   SW   D  L  + S
Sbjct: 150 AFAPHTSSRMITGAGDNTARIWDCN--TQTPMSTLKG-HFNWVLCVSWSP-DGELIATGS 205

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANL--------FAAAGLDTNIYLYD 271
            D+T++L +      V + ++    + T + S    +L         A+A  D  I ++D
Sbjct: 206 MDNTIRLWEGNKGQPVGDALRGHGKWIT-SLSWEPIHLVKPGQKPRLASASKDGTIKIWD 264

Query: 272 RRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
             +    L  ++GH  +++C+++  +  G+L SG  D+ +  WD+
Sbjct: 265 TTRRV-CLITLSGHTSSVSCIKWGGQ--GVLYSGSHDKTIRAWDM 306

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 92/211 (43%), Gaps = 37/211 (17%)

Query: 117 PKDSNIIATINGEGNVSIYDRSKSRS----DGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           P     +A+ + +G + I+D ++        G  +++   K  G G+         L SG
Sbjct: 245 PGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGV---------LYSG 295

Query: 173 SDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH-HFDENLFGSVSEDSTLKLHDKRS 231
           S D TI  WD++ G K             +N    H H+  +L  S+S D  L++     
Sbjct: 296 SHDKTIRAWDMNLGGK------------CINILKSHAHWVNHL--SLSTDYALRIGAFDH 341

Query: 232 TSKVINT---IQAKAAFNTLAFSKHSAN---LFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
           TS+  +T    Q +A  N    +K +     L   A  D  +YL++  ++TKP+  M GH
Sbjct: 342 TSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGH 401

Query: 286 EDAITCLQFHPKEDGI-LVSGGADRRVILWD 315
           +  +  + F P  DG  +VS   D  + LW+
Sbjct: 402 QKLVNHVAFSP--DGRHIVSASFDNSIKLWN 430

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  +  T+    +AGH   I C  F P     +++G  D    +WD 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDC 173

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 85/168 (50%), Gaps = 14/168 (8%)

Query: 160 SFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVS 219
           +F P+ S+ +++G+ D T  +WD D  +++P       H + V   +W   D  +  + S
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCD--TQTPMHTLKG-HFNWVLCVAWSP-DGEVIATGS 205

Query: 220 EDSTLKLHDKRSTSKVINTIQAKAAFNT-LAF------SKHSANLFAAAGLDTNIYLYDR 272
            D+T++L D ++   + + ++  + + T L++         S    A++  D  I ++D 
Sbjct: 206 MDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDT 265

Query: 273 RQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIG 320
                  + M+GH ++++C+++  +  G+L SG  DR V +WD+   G
Sbjct: 266 VSRVCQ-YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDMNSQG 310

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 89/211 (42%), Gaps = 37/211 (17%)

Query: 117 PKDSNIIATINGEGNVSIYDR----SKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172
           P     +A+ + +G + I+D      +    G   ++   K  G GL         L SG
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL---------LYSG 295

Query: 173 SDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWH-HFDENLFGSVSEDSTLKLHDKRS 231
           S D T+ +WD++S  +             +N    H H+  +L  S+S D  L++     
Sbjct: 296 SHDRTVRVWDMNSQGR------------CINILKSHAHWVNHL--SLSTDYALRVGAFDH 341

Query: 232 TSKVINT---IQAKAAFNTLAFSKHSAN---LFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285
           T +   +    Q KA  N     K + N   +   A  D  I+L++  ++TKP+  M GH
Sbjct: 342 TGQKPTSPEDAQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGH 401

Query: 286 EDAITCLQFHPKEDG-ILVSGGADRRVILWD 315
           +  +  + F P  DG  +VS   D  + LWD
Sbjct: 402 QKLVNHVAFSP--DGRYIVSASFDNSIKLWD 430

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 269 LYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
           ++  +  T+    +AGH   I C  F P     +V+G  D    +WD 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDC 173

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 95  KSNIKIVKKFEHDGEINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKE 154
           KS   I +   H   +N   + P D   I + + + ++ ++D    R     +T + H  
Sbjct: 390 KSTKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWD---GRDGKFISTFRGHVA 445

Query: 155 NGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKS 189
           + Y ++++ +    L+S S D T+ +WD+ +G  S
Sbjct: 446 SVYQVAWSSDC-RLLVSCSKDTTLKVWDVRTGKLS 479

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 70/171 (40%), Gaps = 22/171 (12%)

Query: 166 SNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLK 225
           +N +IS S D T  +WD+ S       +    H   V D  +      LF S   D +++
Sbjct: 256 TNLIISSSIDTTCIVWDLQSSHYVKTQLI--AHDSEVFDVRFLTKSTQLFASCGGDGSVR 313

Query: 226 LHDKRSTS-------------------KVINTIQAKAAFNTLAFSKHSANLFAAAGLDTN 266
           + D RS +                       +++   A   L  S +  N+ A    D+N
Sbjct: 314 VFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSN 373

Query: 267 -IYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDL 316
            I + D R    P+  + GH  ++  +++HP +  +L+S   D + + WDL
Sbjct: 374 KIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 80/198 (40%), Gaps = 35/198 (17%)

Query: 207 WHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK-AAFNTLAFSKHSANLFAAAGLDT 265
           W+  D NL  S S D+T  + D +S+  V   + A  +    + F   S  LFA+ G D 
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 266 NIYLYDRRQTT-------KPLHVMAGH-----------EDAITCLQFHPKEDGILVSGGA 307
           ++ ++D R           P    +G             DA+  L+  P +  +L +  A
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAA 370

Query: 308 D-RRVILWDLAEIGAEQQPDEADDGSPEILMIHA-GHRSAINDFTLHPTIPWLSASVEED 365
           D  ++I+ D+               +PE  +++  GH  ++N+   HPT   +  S  +D
Sbjct: 371 DSNKIIILDMR--------------NPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDD 416

Query: 366 NVVQVWKCSKNLSRVGGT 383
                W  + +   + G+
Sbjct: 417 CQALYWDLNNSFMEINGS 434

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 67/158 (42%), Gaps = 25/158 (15%)

Query: 106 HDGEINRARYMPKDSNIIATINGEGNVSIYD-RSKSRSDGLRTTLKYHKENGYGLSFNPN 164
           HD E+   R++ K + + A+  G+G+V ++D RS + S     T+ Y   +      N  
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHS-----TIIYEPPSSPASGPNAG 340

Query: 165 VSNELISGSDDF-----------TIALWDIDSGS------KSPKSVWDNI--HSDIVNDC 205
            +   + GSD              +A +  DS        ++P+S   N+  H+  VN+ 
Sbjct: 341 ATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEI 400

Query: 206 SWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKA 243
            WH    N+  S S+D      D  ++   IN   +K+
Sbjct: 401 KWHPTKRNVLLSCSDDCQALYWDLNNSFMEINGSDSKS 438

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,334,439
Number of extensions: 2075316
Number of successful extensions: 9695
Number of sequences better than 10.0: 1072
Number of HSP's gapped: 8018
Number of HSP's successfully gapped: 1890
Length of query: 392
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 280
Effective length of database: 40,638,807
Effective search space: 11378865960
Effective search space used: 11378865960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)