Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.776.10ON65061326480.0
TPHA0M002006.10ON63460021760.0
TBLA0G011106.10ON63861021070.0
TDEL0G046106.10ON63361220750.0
SAKL0E00880g6.10ON63659920550.0
ZYRO0F00484g6.10ON64360220160.0
Kwal_56.223506.10ON65860119830.0
ACR016W6.10ON64060719700.0
NCAS0D021906.10ON64560419320.0
KLTH0C11528g6.10ON64260419300.0
KLLA0D00836g6.10ON64059919290.0
CAGL0A01067g6.10ON64160619070.0
KAFR0B065006.10ON63661317950.0
NDAI0I027506.10ON66361817580.0
KNAG0E027806.10ON65060914960.0
Skud_16.146.10ON65262514220.0
Suva_16.426.10ON65461414110.0
YPL263C (KEL3)6.10ON65162714080.0
Smik_6.4716.10ON65161313740.0
Kpol_1050.695.88ON10842091432e-08
Skud_8.2225.88ON11692131342e-07
KAFR0B043205.88ON9862071314e-07
KNAG0K005605.88ON11042161314e-07
Smik_8.2425.88ON11682131298e-07
YHR158C (KEL1)5.88ON11642121271e-06
SAKL0H02618g5.88ON10852131243e-06
NCAS0F005205.88ON10862111226e-06
ZYRO0B08228g5.88ON12932061219e-06
KLTH0C01474g5.88ON10562131191e-05
TDEL0G011205.88ON10092111191e-05
CAGL0F07997g5.88ON9362071182e-05
Suva_15.3575.88ON11722231182e-05
Skud_7.5725.88ON8832041154e-05
KLLA0E15511g5.88ON9052081137e-05
TBLA0C065305.88ON11721891138e-05
Kpol_1010.625.88ON9731821111e-04
TPHA0A051705.88ON10162171111e-04
Smik_16.685.88ON8942231111e-04
CAGL0I02090g5.88ON11362121101e-04
YGR238C (KEL2)5.88ON8822231102e-04
Kwal_14.10195.88ON9782191092e-04
Suva_7.5305.88ON8942161030.001
NDAI0D026005.88ON11671821010.002
TPHA0H010805.88ON828176970.005
ADL149W5.88ON1211212960.008
Ecym_20615.88ON1362205960.008
TBLA0A043207.9ON838100709.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.77
         (650 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...  1024   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   842   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   816   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   803   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   796   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   781   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   768   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   763   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   748   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   748   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   747   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   739   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   696   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   681   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   580   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   552   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   548   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   546   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   533   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    60   2e-08
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    56   2e-07
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    55   4e-07
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    55   4e-07
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    54   8e-07
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    54   1e-06
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    52   3e-06
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    52   6e-06
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    51   9e-06
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    50   1e-05
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    50   1e-05
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    50   2e-05
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    50   2e-05
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    49   4e-05
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    48   7e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    48   8e-05
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    47   1e-04
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    47   1e-04
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    47   1e-04
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    47   1e-04
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    47   2e-04
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    47   2e-04
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    44   0.001
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    44   0.002
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    42   0.005
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    42   0.008
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    42   0.008
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    32   9.0  

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score = 1024 bits (2648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/613 (84%), Positives = 517/613 (84%)

Query: 38  SGFEDDDDMDIEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGG 97
           SGFEDDDDMDIEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGG
Sbjct: 38  SGFEDDDDMDIEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGG 97

Query: 98  ESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSS 157
           ESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKN               GVALIHGGEFSS
Sbjct: 98  ESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSS 157

Query: 158 PKQNTFYHYSDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTT 217
           PKQNTFYHYSDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTT
Sbjct: 158 PKQNTFYHYSDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTT 217

Query: 218 YLNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKG 277
           YLNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKG
Sbjct: 218 YLNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKG 277

Query: 278 KILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEES 337
           KILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEES
Sbjct: 278 KILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEES 337

Query: 338 LDSMFYNDLFSYQIEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLN 397
           LDSMFYNDLFSYQIEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLN
Sbjct: 338 LDSMFYNDLFSYQIEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLN 397

Query: 398 XXXXXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTV 457
                         IETEL                       YKVLTQLPHPRFNATMTV
Sbjct: 398 DKDDKDQEDEDAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTV 457

Query: 458 VNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXX 517
           VNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIV      
Sbjct: 458 VNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEED 517

Query: 518 XXXXXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLR 577
                          IMDQKLVA             QVDEMEIPDPCPWLPHPKPFESLR
Sbjct: 518 DEFGDSDDEDDGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLR 577

Query: 578 VFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGE 637
           VFYVRTGATFLEWAISNNRDARGKHLKKKSFDLC          VRIEEDKMEELGGIGE
Sbjct: 578 VFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGE 637

Query: 638 VIEKDTSKSTKRR 650
           VIEKDTSKSTKRR
Sbjct: 638 VIEKDTSKSTKRR 650

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/600 (68%), Positives = 462/600 (77%), Gaps = 17/600 (2%)

Query: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110
           VLANFKKEQE FEQIN+ESV++P+RRIN CMI NPNHGK EL+LFGGE+T+++   T F+
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111

Query: 111 NDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 170
           NDLY++TP+ND W++ TS+N               G+AL+HGGEFSSPKQNTFYHYSDTW
Sbjct: 112 NDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230
           LLDC+T+EWTKVEQKNGPSARSGHRI++WKNYF+LHGGFRDLG++T+YLND WLFDIT+Y
Sbjct: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231

Query: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKA 290
           KW+QIEFPPNHP+PDARSGHS IPTQEGAVLWGGYCKVKAGKGLQKGKIL DCWYLKMKA
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291

Query: 291 DPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350
           DP+A+RWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDS+FYNDLFSYQ
Sbjct: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351

Query: 351 IEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNXXXXXXXXXXXXX 410
           IE NRW+ALQLR QRKKVVRLNNKSSK+KE ELQ++LN+ILEKANL              
Sbjct: 352 IESNRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANLKDDD---------- 401

Query: 411 XIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFIYGGVWE 470
             E                          Y V  QLPH RFNA+ TVV+DTLFIYGGVWE
Sbjct: 402 --EDANELSNGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWE 459

Query: 471 LGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXXXXXXXXXX 530
           LGEKDY+IDS YSIDLN+ DGVTV WE+L +IE AKE G +                   
Sbjct: 460 LGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAI--NSDEEDEEDEDDEDDDE 517

Query: 531 XXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEW 590
              +DQKLVA               D+MEIPDP PWLPHPK FESLR FYVRTGA+FLEW
Sbjct: 518 EETVDQKLVA---EEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEW 574

Query: 591 AISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDTSKSTKRR 650
           AISNN+  RGKHLK KSF+LC          VRIEEDK+EELGG+GEVIEKDT+KSTKRR
Sbjct: 575 AISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/610 (65%), Positives = 461/610 (75%), Gaps = 13/610 (2%)

Query: 41  EDDDDMDIEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGEST 100
           E+DDDM IE++L NFKK+QE FE+INIE+V +P++RIN CMI NP HGK+ELILFGGE+T
Sbjct: 42  EEDDDMAIEDILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT 101

Query: 101 NKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQ 160
              ++TT F+NDL++Y PENDQW++YTS+N               G+AL+HGGEFSSPKQ
Sbjct: 102 ---STTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQ 158

Query: 161 NTFYHYSDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLN 220
           NTFYHYSDTWLLDC+TKEW+KVE KNGPSARSGHR+++WKN+ +LHGGFRDLGTSTTYL 
Sbjct: 159 NTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLK 218

Query: 221 DCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKIL 280
           D WLFD+T YKW Q+EFPPNH IPDARSGHS IPTQ+GA+LWGGYCKVKAGKGLQKGKIL
Sbjct: 219 DLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKIL 278

Query: 281 TDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDS 340
           +DCWYLKMK+D + IRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV+DFEETEESLDS
Sbjct: 279 SDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDS 338

Query: 341 MFYNDLFSYQIEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNXXX 400
           +FYNDLF+YQIEINRWF+L +R QRKK +++  K++KDKEKELQD+LN IL+K NL    
Sbjct: 339 LFYNDLFTYQIEINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILNSILKKNNLT--- 395

Query: 401 XXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVND 460
                      IE EL                       Y+V+ QLPH RFNAT  VVND
Sbjct: 396 --DDDSEDPNAIEEEL--KINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVND 451

Query: 461 TLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXX 520
           TL+I+GG WELGEKDY+IDSFYSIDLN+ DGVTV WED+ EIEAAKE G           
Sbjct: 452 TLYIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELG-EQFSDEEDED 510

Query: 521 XXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFY 580
                       I+DQKLVA                 MEIPDP PWLPHPKPFE+LR FY
Sbjct: 511 DEEEDEDDGEEEIVDQKLVAEEDEEEEEIEADEDE--MEIPDPRPWLPHPKPFETLRAFY 568

Query: 581 VRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIE 640
           VRTGATFLEWAISNNRD++GKHLKKKSF+L           VRIEEDKMEELGGI  ++E
Sbjct: 569 VRTGATFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVE 628

Query: 641 KDTSKSTKRR 650
           +DT++  KRR
Sbjct: 629 RDTTQVNKRR 638

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/612 (63%), Positives = 459/612 (75%), Gaps = 18/612 (2%)

Query: 39  GFEDDDDMDIEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGE 98
           G E+DDD+DIE+VLANFKKEQE FE++ +E++ERPSRRINP MI NP HGKSELI+FGGE
Sbjct: 40  GAEEDDDLDIEQVLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGE 99

Query: 99  STNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSP 158
            T + TSTT FFNDL  ++P+N+QW+R +S+N               GVAL+HGGEFSSP
Sbjct: 100 HTIQSTSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSP 159

Query: 159 KQNTFYHYSDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTY 218
           KQNTFYHYSDTWLLDC+TKEWTK+EQKNGPSARSGHR+++WKN+ +LHGGFRDLGTSTTY
Sbjct: 160 KQNTFYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTY 219

Query: 219 LNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGK 278
           LNDCWLFDIT YKWKQ+EFP NHP+PDARSGHS I  QEGA+LWGGYCKVKAGKGLQKGK
Sbjct: 220 LNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGK 279

Query: 279 ILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESL 338
           ILTDCWYLKM ++ +AIRW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEESL
Sbjct: 280 ILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESL 339

Query: 339 DSMFYNDLFSYQIEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNX 398
           +S FYND+F+YQI +NRW++L LRPQRKK V+LNN+S+KD+EKEL+DLLN+IL  A L+ 
Sbjct: 340 ESNFYNDVFTYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDD 399

Query: 399 XXXXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVV 458
                           E                        + ++ +LPHPRFNA   VV
Sbjct: 400 QGEEEEIDAAEESTAVE------------EDSDESESLDKEHVIMNELPHPRFNAATAVV 447

Query: 459 NDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXX 518
           +DTLFI+GGVWE GEKDY+IDSFY IDLN+ DGVTV WEDL+ +E AK+           
Sbjct: 448 DDTLFIFGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEE 507

Query: 519 XXXXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRV 578
                          +DQKLVA             + +EMEIPDP PWLPHPK FESLR 
Sbjct: 508 DDDDEEDSEEEQ---VDQKLVA---EDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRS 561

Query: 579 FYVRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEV 638
           FYVRTGATFLEWAISNNR  +GKHLK KSF++C          VR+EEDK+EELGG+GE+
Sbjct: 562 FYVRTGATFLEWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEI 621

Query: 639 IEKDTSKSTKRR 650
           IE+DT+K+ KRR
Sbjct: 622 IERDTTKTKKRR 633

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/599 (64%), Positives = 448/599 (74%), Gaps = 14/599 (2%)

Query: 52  LANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFN 111
           LANFK+EQE FE++ + +V+RP+RRIN  M+ NP HGK EL+LFGGE+TN   STT F+N
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 112 DLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWL 171
           DL++Y+ + DQWR+ +S+N               GV LIHGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 172 LDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYK 231
           LDC+TKEWTK+EQKNGP+ARSGHR+++WKNYF+LHGGFRDLGT TTYL+DCWLFDIT YK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 232 WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKAD 291
           WKQ++FPPNHPIPDARSGHS +PT +GAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK+D
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 292 PTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQI 351
             AIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV+DFEETEESL+SMFYNDLF++QI
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 352 EINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNXXXXXXXXXXXXXX 411
           E NRW++  LRPQR K  +  +K++++K+KEL+D+LNQILEKANLN              
Sbjct: 352 ETNRWYSASLRPQR-KAAKATSKNNRNKDKELEDILNQILEKANLNDDENEK-------- 402

Query: 412 IETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFIYGGVWEL 471
            ET                         Y +  QLPHPRFNA+  VV+DTLFI+GGVWE+
Sbjct: 403 -ETIGDVLKELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEI 461

Query: 472 GEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXXXXXXXXXXX 531
           GEKDY+IDSFY+IDLNR DG+ + WEDL +IE AKE G                      
Sbjct: 462 GEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELG-DEEEDFEDNEEDDEEDDDDEE 520

Query: 532 XIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEWA 591
            I DQKLVA                E EIPDP PWLPHPKPFE+LR FYVRTGA FLEWA
Sbjct: 521 EITDQKLVA---EDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWA 577

Query: 592 ISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDTSKSTKRR 650
           IS+NRDARGKHLKKKSFDLC          VRIEEDK+EELGGIGEV+EKDTSKS KRR
Sbjct: 578 ISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/602 (62%), Positives = 449/602 (74%), Gaps = 13/602 (2%)

Query: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110
           VLA+FKKEQE FE++ +ESV++PS RINPC++ NP HGK ELILFGGE TN+  STT F+
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFY 112

Query: 111 NDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 170
           N+L+++TP+NDQWR+ +S+N               G+AL+HGGEFSSPKQNTFYHYSDTW
Sbjct: 113 NELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 172

Query: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230
           LLDC+TKEWTK++QKNGP++RSGHR+++WKN+F+++GGFRDLGTSTTYLNDCWLFDIT +
Sbjct: 173 LLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTH 232

Query: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKA 290
           KW Q+EFP NH IPDARSGHSFIP QEGA+LWGGYCKVKAGKGLQKGKILTDCWYLKM +
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNS 292

Query: 291 DPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350
            P+AIRWERRKKQGFQPSPRVGCSMV HKGRG+LFGGVYDFEETEESLDS FYNDLF++Q
Sbjct: 293 TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQ 352

Query: 351 IEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANL-NXXXXXXXXXXXX 409
           I+ NRW++L LRPQRKK V+++  S+KD+EKELQD LN+IL++A L +            
Sbjct: 353 IKTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIR 412

Query: 410 XXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFIYGGVW 469
              E E                        + + TQLPHPRFN ++ VVNDTLFIYGG+W
Sbjct: 413 EQFEDE---------NQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLW 463

Query: 470 ELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKE-AGIVXXXXXXXXXXXXXXXXX 528
           ELG+KDY IDSFY IDLN+ DGVTV WE+L+EIE AK+ A                    
Sbjct: 464 ELGDKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDD 523

Query: 529 XXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFL 588
               + DQ  V              + +EMEIPDP PWLPHPK FESLR FYVR G  FL
Sbjct: 524 DEEEVRDQ--VLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFL 581

Query: 589 EWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDTSKSTK 648
           EWAISNNRDARGKHLK+KSFDLC          VRIEEDKMEELGG+G+++E++ ++ TK
Sbjct: 582 EWAISNNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTK 641

Query: 649 RR 650
           RR
Sbjct: 642 RR 643

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/601 (62%), Positives = 450/601 (74%), Gaps = 18/601 (2%)

Query: 50  EVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQF 109
           EVLANFKKEQELF+++ +  VERPS+RIN CM+ NP HGK EL++FGGE TN   S T F
Sbjct: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135

Query: 110 FNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDT 169
           +N+L++Y+ ++DQWR+ TS+N               GVALIHGGEFSSPKQNTFYHYSDT
Sbjct: 136 YNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDT 195

Query: 170 WLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITN 229
           WLLDC+TKEWTK+EQKNGPSARSGHR++IWKN+F+LHGGFRDLGTSTTYLND W+FDIT 
Sbjct: 196 WLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITT 255

Query: 230 YKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           YKWKQ+EFPPNHPIPDARSGHS IPTQ+GAVLWGGYCKVKAGKGLQKGK LTDCWYLKMK
Sbjct: 256 YKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMK 315

Query: 290 ADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSY 349
           +D +AIRWERRKKQGFQPSPRVGCSMVHHKGRG+LFGGVYDFEETEE L S F+NDLFSY
Sbjct: 316 SDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSY 375

Query: 350 QIEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNXXXXXXXXXXXX 409
           Q+E NRW+++++RPQ+KK V + ++++++K++EL+++LN IL++ANL             
Sbjct: 376 QVEANRWYSVKMRPQKKKTVAI-SRNNRNKDEELENILNDILQQANL-----ADDTDDDD 429

Query: 410 XXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFIYGGVW 469
             I+ EL                       Y+V+ QLPHPRFNAT  VV+D LFI+GGVW
Sbjct: 430 NEIKREL--------QRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVW 481

Query: 470 ELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXXXXXXXXX 529
           E GE+D++IDSFYSIDLN+ DGV V WE+LSE+E AK  G                    
Sbjct: 482 EFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGED--DEEEFDDDEDDDDDDE 539

Query: 530 XXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLE 589
                DQKLVA             + DE EIPD  PWLPHPKPFE+LR FY+RTGA FL+
Sbjct: 540 EEETADQKLVA--EDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLK 597

Query: 590 WAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDTSKSTKR 649
           WAISNNRDA+GKHLKK+SFDLC          +RIEEDK+EELGG+  V+E+D +++ KR
Sbjct: 598 WAISNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKR 657

Query: 650 R 650
           R
Sbjct: 658 R 658

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/607 (61%), Positives = 435/607 (71%), Gaps = 18/607 (2%)

Query: 48  IEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTT 107
           IEEVLANFK++Q  FE +N+E+VERP +R +  ++ NP H K ELILFGGE TN+ T  T
Sbjct: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107

Query: 108 QFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYS 167
            F+NDL+ Y+ + DQW++YTS+N               GV LIHGGEFSSPKQNTFYHYS
Sbjct: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167

Query: 168 DTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDI 227
           DTWL DC+T EWTK+EQKNGPS+RSGHR+++WKNY +LHGGFRDLGTSTTYLNDCWLFDI
Sbjct: 168 DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI 227

Query: 228 TNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLK 287
           T YKW+Q++FP NHPIPDARSGHS +PT EGA+LWGGYCKVKAGKGLQKGKILTDCWYLK
Sbjct: 228 TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 287

Query: 288 MKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLF 347
           MK+D TAIRWERRKKQGFQPS R GCSMVHHKGRGILFGGVYD+EETEE LDS+FYNDLF
Sbjct: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347

Query: 348 SYQIEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNXXXXXXXXXX 407
           +Y IE NRW+++ LR QR   V+   KS++DK+KEL+D+LN IL+KANL+          
Sbjct: 348 TYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDGKT 407

Query: 408 XXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFIYGG 467
               IE EL                       Y ++ +LPHPRFNA+  +V+DTLFI+GG
Sbjct: 408 ----IEEELNKLENDGITETEETKKS------YPIVMKLPHPRFNASTAIVDDTLFIFGG 457

Query: 468 VWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXXXXXXX 527
           VWE GEKDY IDSFYSID+N+ DGV V WED++ +E AKE G                  
Sbjct: 458 VWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDD 517

Query: 528 XXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATF 587
                  D+KLVA                  EIPDP PWLPHPK FESLR FYVRTGA+F
Sbjct: 518 DEEEH-SDRKLVAEEEEEEEEEDNEILP---EIPDPRPWLPHPKAFESLRAFYVRTGASF 573

Query: 588 LEWAISNNR----DARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDT 643
           LEWAI+N      DA+GKHLKK SFDLC          VRIEEDK+EELGG+GEVIEKD 
Sbjct: 574 LEWAITNKHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDF 633

Query: 644 SKSTKRR 650
           +K TKRR
Sbjct: 634 TKPTKRR 640

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/604 (61%), Positives = 429/604 (71%), Gaps = 13/604 (2%)

Query: 50  EVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQF 109
           +VLANFK +QE FE +N+ES+ +P++R+N CMI  PNH K EL++FGGE TN +TS T F
Sbjct: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110

Query: 110 FNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDT 169
           +N+L +Y+P+N QWR+ TS+N               G+AL+HGGEFSSPKQNTFYHYSDT
Sbjct: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170

Query: 170 WLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITN 229
           WLLD  TKEWTK++   GP  RSGHRI+IWKNYF+L GGF+DLG ST+Y NDCW FDIT 
Sbjct: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230

Query: 230 YKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           YKWKQIEFPPNHPIPDARSGHS+IPT+EG +LWGGYCKVKAGKGLQKGKIL DCWYLKMK
Sbjct: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290

Query: 290 ADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSY 349
           +D + +RWERRKKQGFQPSPRVGCSM +HKGRGILFGGVYDFEETEESL+S+FYNDLFSY
Sbjct: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350

Query: 350 QIEINRWFALQLRPQR--KKVVR-LNNKSSKDKEKELQDLLNQILEKANLNXXXXXXXXX 406
            +E NRWF+L LR  +  KKV +  NNKSSK+KEKELQDLLNQILEK NL          
Sbjct: 351 NVESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLK-------DD 403

Query: 407 XXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFIYG 466
                I T                           V++QLPHPRFNA  TVV+D+LFIYG
Sbjct: 404 DDDDEISTGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYG 463

Query: 467 GVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXXXXXX 526
           G+WE+GEKDY IDS YSIDLN+ DGV+  WEDL EIE AKE G                 
Sbjct: 464 GIWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDD 523

Query: 527 XXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGAT 586
                   D+KLVA                EMEIPD  PWLPHPKPFESLR FY+R GA 
Sbjct: 524 DEEEI--EDKKLVAEEDDEEEEEEEEEFE-EMEIPDLRPWLPHPKPFESLRAFYIREGAA 580

Query: 587 FLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDTSKS 646
           FLEWAISNN+  RGKHLKKKSFDLC          VRIEEDK+EELG +G VIEKDTS  
Sbjct: 581 FLEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVP 640

Query: 647 TKRR 650
           T +R
Sbjct: 641 TSKR 644

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/604 (59%), Positives = 433/604 (71%), Gaps = 22/604 (3%)

Query: 54  NFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFNDL 113
           NF+KEQELF+++ +  V+RPS R N CM+ NP+HGK EL++FGGE TN+ +STT F+N+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 114 YSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWLLD 173
           ++Y+ + DQW++ TS+N               GV LIHGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 174 CSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYKWK 233
           CS+KEWTK++QKNGPSARSGHR+++WKN+F++HGGFRDLGTSTTYLNDCWLFDIT YKWK
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 234 QIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKADPT 293
           Q+EFPPNHP+PDARSGHS IPTQEGA++WGGYCK+KA KGLQKGKILTDCWYL+MK+D T
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 294 AIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEI 353
            IRWERRKKQGFQPSPRVGCSM HHKGRGILFGGVYD+EETEE L S F+NDL SYQ+E 
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 354 NRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNXXXXXXXXXXXXXXIE 413
           NRW+++++RPQ+KK+V   +KS+K K+ EL  +LN IL+KANL               IE
Sbjct: 354 NRWYSIKMRPQKKKIV-AASKSAKSKDDELVGILNDILQKANL--ADEENEENESDSEIE 410

Query: 414 TELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFIYGGVWELGE 473
            EL                       Y V+ QLPH RFNA  TVV+DTLFI+GG WE GE
Sbjct: 411 KELHRLDEEELLGHQQKQ--------YPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGE 462

Query: 474 KDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXXXXXXXXXX--- 530
           +D++IDSFYSIDLNRTDGV V WEDL EIE AK+ G+                       
Sbjct: 463 RDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLD 522

Query: 531 ----XXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGAT 586
                 + D K                     EIPDP PWLPHPK FE+LR FY+RTGA 
Sbjct: 523 EELIAEMEDDKQEEEEQEEEEEEEEAGP----EIPDPRPWLPHPKAFETLRAFYIRTGAE 578

Query: 587 FLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDTSKS 646
           FL+WAISNNR A+GKHLKK+SFDL           VRIEEDK+EE+GG+  +IE+D+S S
Sbjct: 579 FLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHS 638

Query: 647 TKRR 650
           TKRR
Sbjct: 639 TKRR 642

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/599 (61%), Positives = 437/599 (72%), Gaps = 9/599 (1%)

Query: 52  LANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFN 111
           LANFK+EQE FE+IN+E+V+RP +RINPCM  NP HGK EL++FGGEST ++T TT F+N
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 112 DLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTWL 171
           DL+ Y+ + D W+RYTS+N               GVALIHGGEFSSPKQNTFYHYSD+WL
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 172 LDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYK 231
            DCS+KEWTKVEQKNGPSARSGHR++IWKN+ +LHGGFRDLGTSTTYLND W+FDITNYK
Sbjct: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230

Query: 232 WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKAD 291
           WKQ+E P NHPIPDARSGHS I T EGAVL+GGY KVKAGKGLQKGKIL+DCWYLKMK+D
Sbjct: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290

Query: 292 PTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQI 351
             +IRWERRKKQG QPSPRVGCSMVHHKGRG+LFGGVYDFEETEESL S+FYN+L++YQI
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350

Query: 352 EINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNXXXXXXXXXXXXXX 411
           E NRW+A+ LRPQRKK   + +KS+++K+KEL+D+LNQIL+KANL               
Sbjct: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLR----DAEDDDESKV 406

Query: 412 IETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFIYGGVWEL 471
           IE +L                       Y+ ++ LPH RFNA   VV+DTLFI+GG  E+
Sbjct: 407 IEEQL--NQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEI 464

Query: 472 GEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXXXXXXXXXXX 531
           GEKDY IDSFYSID+N+ DGV V WE+L E+E A++ G                      
Sbjct: 465 GEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLG-EQDSDDEFGDEDDDDEDDGEE 523

Query: 532 XIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEWA 591
            I+D KL A             +    EIPD  PWLPHPK FE+LR FYVRTG TFLE A
Sbjct: 524 EIVDSKLEAEDEEEEEEEEEVEEE--YEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELA 581

Query: 592 ISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDTSKSTKRR 650
           IS+NRD++GKHLK KSF+LC          VRIEEDK+EELGG+ +VIEKDTSK+ +RR
Sbjct: 582 ISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/606 (59%), Positives = 440/606 (72%), Gaps = 19/606 (3%)

Query: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPN--HGKSELILFGGESTNKDTSTTQ 108
           VLANFKKEQE FE++ ++SV++ ++R+NPCM+ NP+    K ELI+FGGE TN  TSTT 
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 109 FFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSD 168
           F+NDL+++TPEN+QW+RYTS+N               G+AL+HGGEFSSPKQNTFYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 169 TWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDIT 228
           TW+LDC+TKEW KV+ K GPSARSGHRI++WKN+F+LHGGFRDLGTSTTYL+DCWLFDIT
Sbjct: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228

Query: 229 NYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAG-KGLQKGKILTDCWYLK 287
            YKWKQ+EFP NH +PDARSGHSFIPT EGA+LWGGYCKVKA  KG QKGKIL+DCWYLK
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288

Query: 288 MKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLF 347
           MK+D + IRWERR+KQGFQPSPRVGCSM +HKGRGILFGGVYDFEETEESL+S F+NDLF
Sbjct: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348

Query: 348 SYQIEINRWFALQLRPQRKK---VVRLNNKSSKDKEKELQDLLNQILEKANLNXXXXXXX 404
           SY IE NRW++L +R ++     V + + K+SK++EKEL+ LL+ ILEKANL        
Sbjct: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQ---DKSD 405

Query: 405 XXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTLFI 464
                  I T L                       + +LTQLPHPRFNAT TV++DTLFI
Sbjct: 406 DDEDDEEINTAL-------AKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFI 458

Query: 465 YGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXXXX 524
           +GG+WELG+K++ IDS YSIDLN+ DGVT+ WEDL EIE AKE G+              
Sbjct: 459 FGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDD 518

Query: 525 XXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVRTG 584
                     D +                  +E+E PDP PWLPHPKPFE+LR FY+R G
Sbjct: 519 EDDDEE---DDNEKDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREG 575

Query: 585 ATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKDTS 644
           A FLEWAISNN++A+GKHLKK SFDLC          +RIEEDK+EE+GG+G++IE+D S
Sbjct: 576 AAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKS 635

Query: 645 KSTKRR 650
            S+KRR
Sbjct: 636 ASSKRR 641

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/613 (57%), Positives = 426/613 (69%), Gaps = 21/613 (3%)

Query: 41  EDDDDMDIEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGEST 100
           +D+DD +IEE+L NFKKEQE +E+INIESVE+PS R N  +I +    K EL+LFGGE T
Sbjct: 41  DDEDDGNIEEILENFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHT 98

Query: 101 NKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQ 160
           +K+  TT+F+NDLY+++P+N+QW+R TS+N               G+AL++GGEFSSPKQ
Sbjct: 99  SKELQTTKFYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQ 158

Query: 161 NTFYHYSDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLN 220
           +TFYHYSDTW+LD +TKEWTK+E K  P  RSGHRI+ WKNYF+L GGF+DLG STTY N
Sbjct: 159 STFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYN 218

Query: 221 DCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKIL 280
           D WLFDIT YKWKQ+EFP NH +PDARSGHS IPT EG +++GGYCK+KA KGLQKGK+L
Sbjct: 219 DVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLL 278

Query: 281 TDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDS 340
           + CW LKMKAD  AIRWERR+KQGFQPSPRVGCSM +HKGRGILFGGVYDF+ETEESL+S
Sbjct: 279 SGCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 338

Query: 341 MFYNDLFSYQIEINRWFALQLRPQR---KKVVRLNNKSSKDKEKELQDLLNQILEKANLN 397
           +FYNDLF+Y IE NRWF + L+ +    K +    NKSSK+KE+ELQDLLNQILEK NL 
Sbjct: 339 IFYNDLFTYNIESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLK 398

Query: 398 XXXXXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTV 457
                          + E                         K +TQLPHPRFNAT TV
Sbjct: 399 PDDEEEEESSDIFGSDDE--------------DDEEQKNKIDIKTVTQLPHPRFNATTTV 444

Query: 458 VNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXX 517
           ++D L+IYGG WE GE DY+IDSFYSIDLN+ DGV V WEDL+EIE AKE G        
Sbjct: 445 IDDMLYIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELG-EQGSEDE 503

Query: 518 XXXXXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLR 577
                          + D KL+A                EMEIPDP PWLPHPK FESLR
Sbjct: 504 DEDDFEEDEEDGEEEVEDTKLIAEDVEDEKEEEEEEYP-EMEIPDPRPWLPHPKAFESLR 562

Query: 578 VFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGE 637
            FY+R G  FLEWAISNNR  RGK LK+KSF+LC          + IEEDK+EE+G +G+
Sbjct: 563 AFYLREGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGD 622

Query: 638 VIEKDTSKSTKRR 650
           V+E+DTSK+  +R
Sbjct: 623 VVERDTSKAVSKR 635

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/618 (57%), Positives = 409/618 (66%), Gaps = 20/618 (3%)

Query: 48  IEEVLANFKKEQELFEQINIESVERP-----SRRINPCMIENP---NHGKSELILFGGES 99
           IE VLANFK EQE FE+IN+E + +      S R N  MI      N    EL++FGGE 
Sbjct: 50  IETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEY 109

Query: 100 TNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPK 159
           T+ +T  T F+NDL SYTP+  QWR+ TS+N               G+A++HGGEFSSPK
Sbjct: 110 TSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPK 169

Query: 160 QNTFYHYSDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTS-TTY 218
           QNTFYHYSDTW+LD STKEWTKV+ K  P ARSGHRI  WKNYF+L GGF+D+G + T Y
Sbjct: 170 QNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229

Query: 219 LNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAG--KGLQK 276
            ND W FDI NYKW Q+EFP NHP+PD RSGHS+IP +EG +LWGGY KVK+    G QK
Sbjct: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQK 289

Query: 277 GKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEE 336
           GKIL DCWYLKMK+D ++IRWERRKK GFQPSPRVGCSM +HKGRGILFGGVYDF+ETEE
Sbjct: 290 GKILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 349

Query: 337 SLDSMFYNDLFSYQIEINRWFALQLRPQR---KKVVRLNNKSSKDKEKELQDLLNQILEK 393
           SL+S+FYNDLFSY +E NRWFAL LR  +   K + R NNK+SK+KEKELQDLLNQILEK
Sbjct: 350 SLESLFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEK 409

Query: 394 ANLNXXXXXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNA 453
            NL                 +                           ++ QLPHPR+N 
Sbjct: 410 NNLKDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVT--IMNQLPHPRYNV 467

Query: 454 TMTVVNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIV-X 512
            MTVV+D LFIYGG WELGEKDY I+SFYSIDLNR DGVT  WEDL EIE AKE G    
Sbjct: 468 AMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDS 527

Query: 513 XXXXXXXXXXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKP 572
                               I DQKLVA              V EMEIPD  PWLPHPKP
Sbjct: 528 DEEDDEDDEEDDDEDDDEEEIKDQKLVA---DDEDEEEEEEDVQEMEIPDLRPWLPHPKP 584

Query: 573 FESLRVFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEEL 632
           FESLR FY+R G  FLEWAISNN+  RGKHLKKKSF+LC          +RIEEDK+EEL
Sbjct: 585 FESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEEL 644

Query: 633 GGIGEVIEKDTSKSTKRR 650
           G +G+VIEKDTSK   +R
Sbjct: 645 GVVGDVIEKDTSKGASKR 662

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/609 (50%), Positives = 384/609 (63%), Gaps = 21/609 (3%)

Query: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110
           +L NFK EQE FE++ +E V  P+ R N C++ N    K EL+LFGGE TN +T+ T+F+
Sbjct: 53  ILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFY 110

Query: 111 NDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 170
           NDL+ Y P+N+QW+++TS+N               GV ++ GGEFSSPKQNTFYHY+DTW
Sbjct: 111 NDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTW 170

Query: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230
           LLD +T+EW+K++ KNGPSARSGHRI+ WKNYF+L GGF+DL   T+Y ND WLF++ ++
Sbjct: 171 LLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDF 230

Query: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKA--GKGLQKGKILTDCWYLKM 288
           KW + E   N   PD RSGHS+I + EG +++GGYCKVKA   K L KGK LTDCW LKM
Sbjct: 231 KWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289

Query: 289 KADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSMFYNDLF 347
             +   I+WERR K+G QPSPRVGCSM +H   RGILFGGVYD EETEE L S++YNDL+
Sbjct: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349

Query: 348 SYQIEINRWFALQLR--PQRKKVVR---LNNKSSKDKEKELQDLLNQILEKANLNXXXXX 402
           SY IE NRW+ L+LR   Q     R    NN  SK++EKELQDLLN+ILE+ +L      
Sbjct: 350 SYNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETN 409

Query: 403 XXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVVNDTL 462
                     ET                            L QLPH RFNA  TV+NDT 
Sbjct: 410 SYSGSNTPHEET-------TTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTF 462

Query: 463 FIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXXXXXX 522
           +IYGG+WE  + DYTIDSFYSIDLN+ DG+T  +E+L EIE  K  G V           
Sbjct: 463 YIYGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDD 522

Query: 523 XXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRVFYVR 582
                         + +               +DEMEIPDP PWLPHPK FESLR FY+R
Sbjct: 523 DDEDDGEAEPT--NERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIR 580

Query: 583 TGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEVIEKD 642
            G  FLEWAISNN+ A+GKHLK+KSF+LC          ++IEEDK++ELG  G++IE+D
Sbjct: 581 EGPKFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERD 640

Query: 643 T-SKSTKRR 650
             S  T RR
Sbjct: 641 AQSPPTARR 649

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/625 (47%), Positives = 384/625 (61%), Gaps = 31/625 (4%)

Query: 41  EDDDDMDIEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGEST 100
           ED+ D D++E+L++F K+Q   E ++I +VER S R +P M  NP H K EL +FGGE T
Sbjct: 44  EDESDQDLDEILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFT 103

Query: 101 NKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQ 160
           + +T  T F+NDLYSY+ +N+ W++Y SKN               G+AL+HGGEFSSPKQ
Sbjct: 104 DPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQ 163

Query: 161 NTFYHYSDTWLLDCSTKEWTKVE---QKNGPSARSGHRISIWKNYFMLHGGFRDLGT-ST 216
           + FYHYSDTWL DC+ +++TK+E   + + PSARSGHRI  WKNYF+L GGFRDLG   T
Sbjct: 164 SKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQT 223

Query: 217 TYLNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKV--KAGKGL 274
           +YLND W FDI+NYKW ++E    +  P+ARSGH FIPT   A+L GGYCK+  K  K L
Sbjct: 224 SYLNDLWCFDISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNL 280

Query: 275 QKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEE 333
            KGKIL D W L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +E
Sbjct: 281 MKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQE 340

Query: 334 TEESLDSMFYNDLFSYQIEINRWFALQLRPQRK-----KVVRLNNKSSKDKEKELQDLLN 388
           TEESL+S+FYNDL+ + +E+N+W  L+++PQR+       +    KS+KD+EKELQDLLN
Sbjct: 341 TEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLN 400

Query: 389 QILEKANLNXXXXXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPH 448
            IL K+NLN              I+ +                          +  QLPH
Sbjct: 401 SILAKSNLNDDDDDDNTTTGSNSIDGDDEGEDDDSDLDNPENIT---------ISNQLPH 451

Query: 449 PRFNATMTVVNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEA 508
           PRFNA   VV+D+LFIY GVWELGEKDY I+SFYSIDLN+ DGV V WEDLS IE AK  
Sbjct: 452 PRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRL 511

Query: 509 G--IVXXXXXXXXXXXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPW 566
           G                           D  L+              Q  +MEIPD   W
Sbjct: 512 GDRDSDEDDFEYEDDDDDDGEDNDEEEQDVALLEGDEDEEGENEDNGQA-QMEIPDERSW 570

Query: 567 LPHPKPFESLRVFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEE 626
           LPHPKPFE+LR FY+R GA FL W+ISNN+D +GKHLK KSF++C          V +EE
Sbjct: 571 LPHPKPFETLRAFYLREGANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEE 630

Query: 627 DKMEELGGIGEVIEKD-TSKSTKRR 650
           +++E+ GGI   IE+D T+K +KRR
Sbjct: 631 ERLEDTGGI---IERDTTTKISKRR 652

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/614 (47%), Positives = 370/614 (60%), Gaps = 25/614 (4%)

Query: 50  EVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQF 109
           E+L++F K+Q   E ++I +VERPS R++P M  NP H K EL +FGGE T+ +T  T F
Sbjct: 53  EILSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHF 112

Query: 110 FNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDT 169
           +NDLYSY+ +N+ W++Y S+N               G+AL+HGGEFSSPKQ+ FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 170 WLLDCSTKEWTKVE---QKNGPSARSGHRISIWKNYFMLHGGFRDLGTS-TTYLNDCWLF 225
           WL DC  K++TK+E   + + PSARSGHRI  WKNYF+L GGFRDLG+  T+YLND W F
Sbjct: 173 WLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCF 232

Query: 226 DITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCK--VKAGKGLQKGKILTDC 283
           DI+NYKW ++E    +  PDARSGH F+PT   A+L GGYCK   K  K L KGKIL D 
Sbjct: 233 DISNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDS 289

Query: 284 WYLKMKADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSMF 342
           W L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESLDS+F
Sbjct: 290 WKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIF 349

Query: 343 YNDLFSYQIEINRWFALQLRPQRKKVVR-----LNNKSSKDKEKELQDLLNQILEKANLN 397
           YNDL+ + +E+N+W  L+++PQR    R        KS+KD+EKELQDLLN IL K+NLN
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 398 XXXXXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTV 457
                                                       +  QLPHPRFNA   V
Sbjct: 410 DEEDDNDDSTATT------TGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCV 463

Query: 458 VNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXX 517
           V+D+LFIY GVWELGEKDY I+SFYSIDLN+ DGV V WEDLS +E AK  G        
Sbjct: 464 VDDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEE 523

Query: 518 XXXXXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLR 577
                                +                 +MEIPD   WLPHPKPFE+LR
Sbjct: 524 FEYEDEDDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLR 583

Query: 578 VFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGE 637
            FY+R GA FL W+ISNNR+ +GK LK KSF+LC          V +EE+++E+ GGI  
Sbjct: 584 AFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGI-- 641

Query: 638 VIEKD-TSKSTKRR 650
            IE+D T+K +KRR
Sbjct: 642 -IERDATAKPSKRR 654

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/627 (47%), Positives = 380/627 (60%), Gaps = 29/627 (4%)

Query: 38  SGFEDDD-DMDIEEVLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFG 96
           +G EDD+ D D++E+L++F K+Q   E ++I SVE+PS R +P M  NP H K EL +FG
Sbjct: 40  NGEEDDESDQDLDEILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFG 99

Query: 97  GESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFS 156
           GE T+ +T  T F+NDLYSY+ +N+ W++Y S+N               G+AL+HGGEFS
Sbjct: 100 GEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFS 159

Query: 157 SPKQNTFYHYSDTWLLDCSTKEWTKVE---QKNGPSARSGHRISIWKNYFMLHGGFRDLG 213
           SPKQ+ FYHYSDTWL DC  +++TK+E   + + PSARSGHRI  WKNYF+L GGFRDLG
Sbjct: 160 SPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLG 219

Query: 214 TS-TTYLNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKV--KA 270
              T+YLND W FDI+ YKW ++E    +  PDARSGH FIPT   A+L GGYCK+  K 
Sbjct: 220 NGQTSYLNDLWCFDISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKN 276

Query: 271 GKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVY 329
            K L KGKIL D W L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVY
Sbjct: 277 NKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVY 336

Query: 330 DFEETEESLDSMFYNDLFSYQIEINRWFALQLRPQRKKVVR-----LNNKSSKDKEKELQ 384
           D +ETEESL+S+FYNDL+ + +E+N+W  L+++PQR+   +        KS+KD+EKELQ
Sbjct: 337 DLQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQ 396

Query: 385 DLLNQILEKANLNXXXXXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLT 444
           DLLN IL K+NL                +                            +  
Sbjct: 397 DLLNSILAKSNL--------NDDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISN 448

Query: 445 QLPHPRFNATMTVVNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEA 504
           QLPHPRFNA   VV D+LFIY GVWELGEKDY I+SFYSIDLN+ DGV V WEDLS IE 
Sbjct: 449 QLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEE 508

Query: 505 AKEAGIVXXXXXXXXXXXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPC 564
           AK  G                         D   +              Q  +MEIPD  
Sbjct: 509 AKRLGDRDSDEDEFEYEDDEEDEDDGEEEQDAGPLEGDEDEESESDDDKQA-QMEIPDER 567

Query: 565 PWLPHPKPFESLRVFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRI 624
            WLPHPKPFE+LR FY+R GA FL W+ISNNR+ +GK LK KSF+LC          V +
Sbjct: 568 SWLPHPKPFETLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTL 627

Query: 625 EEDKMEELGGIGEVIEKD-TSKSTKRR 650
           EE+++E+ GGI   IE+D T+K +KRR
Sbjct: 628 EEERLEDTGGI---IERDTTTKPSKRR 651

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/613 (47%), Positives = 368/613 (60%), Gaps = 28/613 (4%)

Query: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110
           +L++F K+Q   E ++I +VERPS R +P M  NP H K EL +FGGE T+ +T  T F+
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFY 113

Query: 111 NDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGGEFSSPKQNTFYHYSDTW 170
           NDLYSY+ +N+ W++Y S+N               G+AL+HGGEFSSPKQ+ FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 171 LLDCSTKEWTKVE---QKNGPSARSGHRISIWKNYFMLHGGFRDLGTS-TTYLNDCWLFD 226
           L DC  +++ K+E   + + PSARSGHRI  WKNYF+L GGFRDLG   T+YLND W FD
Sbjct: 174 LFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 227 ITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCK--VKAGKGLQKGKILTDCW 284
           I+NYKW +IE    +  PDARSGH FIPT   A+L GGYCK   K  K L KGKIL D W
Sbjct: 234 ISNYKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAW 290

Query: 285 YLKMKADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSMFY 343
            L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FY
Sbjct: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350

Query: 344 NDLFSYQIEINRWFALQLRPQRKKVVR-----LNNKSSKDKEKELQDLLNQILEKANLNX 398
           NDL+ + +E+N+W  L+++ QR+   R        KS+KD+EKELQDLLN IL K+NLN 
Sbjct: 351 NDLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 399 XXXXXXXXXXXXXIETELXXXXXXXXXXXXXXXXXXXXXXXYKVLTQLPHPRFNATMTVV 458
                                                      +  QLPHPRFNA   VV
Sbjct: 411 DDDENDDYTA--------TGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVV 462

Query: 459 NDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVXXXXXXX 518
            D+LFIY GVWELGEKDY I+SFYSIDLN+ DGV V WE+LS IE AK  G         
Sbjct: 463 GDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEF 522

Query: 519 XXXXXXXXXXXXXXIMDQKLVAXXXXXXXXXXXXXQVDEMEIPDPCPWLPHPKPFESLRV 578
                           D  L+              Q  +MEIPD   WLPHPKPFE+LR 
Sbjct: 523 EYEDEEDDEDQSEEEQDAGLLESDEDEESDDEDDGQA-QMEIPDERSWLPHPKPFETLRA 581

Query: 579 FYVRTGATFLEWAISNNRDARGKHLKKKSFDLCXXXXXXXXXXVRIEEDKMEELGGIGEV 638
           FY+R GA FL W+ISNNR+ +GK LK KSF+LC          V +EE+++E+ GGI   
Sbjct: 582 FYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGI--- 638

Query: 639 IEKD-TSKSTKRR 650
           IE+D T+K +KRR
Sbjct: 639 IERDVTTKPSKRR 651

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 87/209 (41%), Gaps = 36/209 (17%)

Query: 166 YSDTWLLDCSTKEWTKVEQK------NGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTY 218
           Y DTW++ C+  + T+   K      N P  R GH  ++  N F++ GG    +      
Sbjct: 178 YGDTWIISCN-PDATQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLM 236

Query: 219 LNDCWLFDITNYKWKQIEFP-PNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKG 277
            +D +LF+I +YKW     P P  P P  R GH         +L     K K       G
Sbjct: 237 DDDIYLFNINSYKWT---IPNPIGPRPLGRYGHKI------CILATSTVKTKL---YLFG 284

Query: 278 KILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDF 331
               D ++  +   D ++ R     WE  K +GF P P    +MV +     ++GG    
Sbjct: 285 GQFDDTYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG---- 340

Query: 332 EETEESLDSMFYNDLFSYQIEINRWFALQ 360
            +T++ L     ND+F +    N W  ++
Sbjct: 341 -DTQQGL----INDIFKFSPNTNTWTKVE 364

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 72/179 (40%), Gaps = 15/179 (8%)

Query: 89  KSELILFGGESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVA 148
           K++L LFGG+  +   +    F DL S+  ++  W    SK                   
Sbjct: 277 KTKLYLFGGQFDDTYFNDLAVF-DLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDL 335

Query: 149 LIHGGEFSSPKQNTFYHYSDTWLLDCSTKEWTKVEQK-NGPSARSGHRISIWKNYFMLHG 207
            I+GG+      N  + +S       +T  WTKVE     P     H   ++KN   + G
Sbjct: 336 WIYGGDTQQGLINDIFKFS------PNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVG 389

Query: 208 GFRDLGTSTTYLNDCWLFDITNYKWKQIEFPP-NHPIPDARSGHSF-IPTQEGAVLWGG 264
           G  +   +  YLN  +LF+  + KW    FP     I   RSGHS  +   +  ++ GG
Sbjct: 390 GKDE---NDMYLNSVYLFNFDSSKW--YTFPDFKSGIIQGRSGHSVTLLNNDKLLIMGG 443

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 90/213 (42%), Gaps = 44/213 (20%)

Query: 166 YSDTWLL---DCSTK-EWTKVE-QKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW+L   D +TK   T ++  +  P  R GH   +  N F++ GG    +       
Sbjct: 152 YGDTWILTALDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGKG 273
           +D +L +I +YKW     P P  P P  R GH  S I T +      ++GG         
Sbjct: 212 DDIYLLNINSYKWT---VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQ-------- 260

Query: 274 LQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
                   D ++  +   D ++ R     WE  K + F P P    +M+ +  +  +FGG
Sbjct: 261 ------FDDTYFNDLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG 314

Query: 328 VYDFEETEESLDSMFYNDLFSYQIEINRWFALQ 360
                   ++L  +  ND+F Y   IN WF ++
Sbjct: 315 --------DTLQGLI-NDVFMYDPAINDWFIIE 338

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 52/126 (41%), Gaps = 16/126 (12%)

Query: 167 SDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFD 226
           +D ++ D +  +W  +E             S+  N  M   G +D      YLN  +  +
Sbjct: 322 NDVFMYDPAINDWFIIETTGEKPPPVQEHASVVYNDLMCVVGGKD--EHDAYLNSVYFLN 379

Query: 227 ITNYKWKQIEFPP-NHPIPDARSGHSFIPTQEGAVLWGG-----YCKVK------AGKGL 274
           + ++KW   + P     IP  RSGHS    ++  +L  G     Y +V+      +   L
Sbjct: 380 LKSHKW--FKLPVFTAGIPQGRSGHSLTLLKDDKILIMGGDKFDYARVEEFDLHTSDIDL 437

Query: 275 QKGKIL 280
           Q+G I+
Sbjct: 438 QRGTIV 443

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 82/207 (39%), Gaps = 32/207 (15%)

Query: 166 YSDTWLLDCSTKEWTKVEQK-----NGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW+L         + Q      N P  R GH  ++  N F++ GG    +       
Sbjct: 173 YGDTWILTSENNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMD 232

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGKG 273
           +D +LF+I ++KW     P P  P P  R GH  S I T        L+GG         
Sbjct: 233 DDLYLFNINSHKWT---IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQFDDAYFND 289

Query: 274 LQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEE 333
           L    ++ D    +        RWE  K + F P P    +MV +  +  +FGG      
Sbjct: 290 L----VVFDLSSFRRPDS----RWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG------ 335

Query: 334 TEESLDSMFYNDLFSYQIEINRWFALQ 360
             ++L  +  N +F Y   IN W  ++
Sbjct: 336 --DTLQGL-TNRVFMYDPMINDWTTIE 359

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 90/216 (41%), Gaps = 44/216 (20%)

Query: 166 YSDTWL---LDCSTK-EWTKVE-QKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           + D W+   L+  TK   T ++  +N P  R GH  ++  N F++ GG    +       
Sbjct: 236 FGDVWIIKSLENGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMD 295

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH-----SFIPTQEGAVLWGGYCKVKAGKG 273
           +D +LF+I +YKW     P P  P P  R GH     +  P +    L+GG         
Sbjct: 296 DDLYLFNINSYKWT---IPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQ-------- 344

Query: 274 LQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
                   D ++  +   D +  R     WE  K + F P P    +MV ++ +  +FGG
Sbjct: 345 ------FDDTYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG 398

Query: 328 VYDFEETEESLDSMFYNDLFSYQIEINRWFALQLRP 363
                   ++L  +  N +F Y  E+N W  ++  P
Sbjct: 399 --------DTLQGLI-NKIFMYDPEVNDWTVVETFP 425

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 90/213 (42%), Gaps = 44/213 (20%)

Query: 166 YSDTWLL---DCSTK-EWTKVE-QKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW+L   D +TK   T ++  +  P  R GH   +  N F++ GG    +       
Sbjct: 152 YGDTWILTAFDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGKG 273
           +D +L +I +YKW     P P  P P  R GH  S I T +      ++GG         
Sbjct: 212 DDIYLLNINSYKWT---VPAPVGPRPLGRYGHKISIIATNQMKTKLYVFGGQ-------- 260

Query: 274 LQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
                   D ++  +   D ++ R     WE  K + F P P    +M+ +  +  +FGG
Sbjct: 261 ------FDDTYFNDLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG 314

Query: 328 VYDFEETEESLDSMFYNDLFSYQIEINRWFALQ 360
                   ++L  +  ND+F Y   +N WF ++
Sbjct: 315 --------DTLQGLV-NDVFMYDPALNDWFIIE 338

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 89/212 (41%), Gaps = 44/212 (20%)

Query: 166 YSDTWLL---DCSTK-EWTKVE-QKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW+L   D +T+   T ++  +  P  R GH   +  N F++ GG    +       
Sbjct: 152 YGDTWILTAFDNATRFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGKG 273
           +D +L +I +YKW     P P  P P  R GH  S I T +      ++GG         
Sbjct: 212 DDIYLLNINSYKWT---VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQ-------- 260

Query: 274 LQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
                   D ++  +   D ++ R     WE  K + F P P    +M+ +  +  +FGG
Sbjct: 261 ------FDDTYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG 314

Query: 328 VYDFEETEESLDSMFYNDLFSYQIEINRWFAL 359
                   ++L  +  ND+F Y   IN WF +
Sbjct: 315 --------DTLQGLV-NDVFMYDPAINDWFII 337

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 85/213 (39%), Gaps = 44/213 (20%)

Query: 166 YSDTWLLDCSTKEWTKVEQKN------GPSARSGHRISIWKNYFMLHGG-FRDLGTSTTY 218
           Y DTW+L       T+   K        P  R GH  ++  N F++ GG    +      
Sbjct: 112 YGDTWILTAHANN-TRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLM 170

Query: 219 LNDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGK 272
            +D +LF+I +YKW     P P  P P  R GH  S I T +      ++GG        
Sbjct: 171 DDDVYLFNINSYKWT---IPHPVGPRPLGRYGHKISVIATSQMKTKLYVFGGQFDDTYFN 227

Query: 273 GLQKGKILTDCWYLKMKADPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
            L        C Y     D ++ R     WE  K Q F P P    +MV +  +  +FGG
Sbjct: 228 DL--------CVY-----DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG 274

Query: 328 VYDFEETEESLDSMFYNDLFSYQIEINRWFALQ 360
                +T + L     N++F Y   +N W  ++
Sbjct: 275 -----DTAQGL----INEVFMYDPTVNDWTVVE 298

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 167 SDTWLLDCSTKEWTKVEQKNG-PSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLF 225
           ++ ++ D +  +WT VE     P A   H   ++K+   + GG  +     +Y ND +  
Sbjct: 282 NEVFMYDPTVNDWTVVETTGSKPPAIQEHAAVVYKDLMCVTGGKDE---QDSYSNDVYFL 338

Query: 226 DITNYKWKQIEFPPNHPIPDARSGH 250
           ++ ++KW ++ F  N  +P  RSGH
Sbjct: 339 NLKSFKWFKLPFFKNG-VPQGRSGH 362

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 85/211 (40%), Gaps = 38/211 (18%)

Query: 166 YSDTWLLDCSTKEWTKVEQ-------KNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTY 218
           Y DTW+L C   + + +         +  P  R GH  ++  N F++ GG          
Sbjct: 170 YGDTWVLTCEDPQTSTMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGE 229

Query: 219 LND-CWLFDITNYKWKQIEFPPNHPI---PDARSGH--SFIP---TQEGAVLWGGYCKVK 269
           ++D  +LF+I +YKW     P  HPI   P  R GH  S I     Q    L+GG     
Sbjct: 230 MDDDIYLFNINSYKWT---IP--HPIGPRPKGRYGHKISIIARKQMQTKLYLFGGQFDDN 284

Query: 270 AGKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVY 329
               L    ++ D    +         WE  K + F P P    +MV +  +  +FGG  
Sbjct: 285 YFNDL----VVFDLSSFRRDDS----HWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG-- 334

Query: 330 DFEETEESLDSMFYNDLFSYQIEINRWFALQ 360
                 ++L+ +  N +F Y   +N W  ++
Sbjct: 335 ------DTLEGLL-NQVFMYDPAVNDWCVVE 358

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 43/107 (40%), Gaps = 21/107 (19%)

Query: 170 WLLDCSTKEWTKVEQ-------KNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDC 222
           ++ D +  +W  VE        +N P     H   I+K    + GG  +      YLND 
Sbjct: 345 FMYDPAVNDWCVVETTCQDDDLENMPPPMQEHATLIYKGLMCIVGGKDE---QDHYLNDV 401

Query: 223 WLFDITNYKWKQIEFPPNHP-----IPDARSGHSFIPTQEGAVLWGG 264
           +  ++ + KW ++      P     IP  RSGHS    +   +L  G
Sbjct: 402 YFLNLKSLKWFRL------PRFMDGIPQGRSGHSVTLLKNDKLLIMG 442

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 85/206 (41%), Gaps = 38/206 (18%)

Query: 166 YSDTWLL---DCSTKEWTKVEQ--KNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW++   D  T+  +K  +  +  P  R GH  ++  N F+L GG    + +     
Sbjct: 180 YGDTWIISTNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMD 239

Query: 220 NDCWLFDITNYKWKQIEFPPNHPI---PDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQK 276
           +D +LF++ +YKW     P  HPI   P  R GH        +++     K K       
Sbjct: 240 DDLYLFNVNSYKWT---IP--HPIGPRPLGRYGHKI------SIMAANQMKTKL---YLF 285

Query: 277 GKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYD 330
           G    D ++  +   D ++ R     WE  K   F P P    +M+ +     +FGG   
Sbjct: 286 GGQFDDTYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG--- 342

Query: 331 FEETEESLDSMFYNDLFSYQIEINRW 356
                ++L  +  N +F Y +  N W
Sbjct: 343 -----DTLQGLI-NQVFKYDVANNDW 362

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 89/213 (41%), Gaps = 44/213 (20%)

Query: 166 YSDTWLL---DCSTKEWTKVEQ--KNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW++   D  +K  +K        P  R GH  ++  N F++ GG    + +     
Sbjct: 117 YGDTWIISAHDNGSKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMD 176

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGKG 273
           +D +LF+I +YKW     P P  P P  R GH  S I T +      ++GG         
Sbjct: 177 DDVYLFNINSYKWT---IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQ-------- 225

Query: 274 LQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
                   D ++  +   D ++ R     W+  K   F P P    +M+ +  +  +FGG
Sbjct: 226 ------FDDTYFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG 279

Query: 328 VYDFEETEESLDSMFYNDLFSYQIEINRWFALQ 360
                +T + L     ND+F +  +IN W  +Q
Sbjct: 280 -----DTPQGL----INDVFMFDPQINDWKVMQ 303

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 88/205 (42%), Gaps = 42/205 (20%)

Query: 168 DTWLLDCSTKEWTKVEQKNGPS--ARSGHRISIWKN------YFMLHGGFRDLGTSTTYL 219
           D +L + ++ +WT + +  GP    R GH+ISI          ++  G F D     TY 
Sbjct: 178 DVYLFNINSYKWT-IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQFDD-----TYF 231

Query: 220 NDCWLFDITNYK-----WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGL 274
           ND  +FD+++++     W+ I+  PN   P   + H+ I       ++GG       +GL
Sbjct: 232 NDLTVFDLSSFRRPDSHWQFIK--PNTFTPPPLTNHTMISYDYKLWVFGG----DTPQGL 285

Query: 275 QKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEET 334
                + D +      DP    W+  +  G +P P    + V +     + GG    +E 
Sbjct: 286 -----INDVFMF----DPQINDWKVMQTTGDKPPPLQEHAAVLYGDLMCVVGGK---DEQ 333

Query: 335 EESLDSMFYNDLFSYQIEINRWFAL 359
           +   +S+F+ +L S      +WF L
Sbjct: 334 DVYSNSVFFLNLISL-----KWFKL 353

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 86/211 (40%), Gaps = 48/211 (22%)

Query: 166 YSDTWLL---DCSTKEWTKVEQKN--GPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW++   D  T+  +K    +   P  R GH  ++  N F++ GG    + +     
Sbjct: 133 YGDTWIINVDDSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMD 192

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGKG 273
           +D +LF+I ++KW     P P  P P  R GH  S I T +      L+GG         
Sbjct: 193 DDLYLFNINSFKWT---IPHPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQ-------- 241

Query: 274 LQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
                   D ++  +   D ++ R     WE  K + F P P    +MV +  +  +FGG
Sbjct: 242 ------FDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG 295

Query: 328 VYDFEETEESLDSM--FYNDLFSYQIEINRW 356
                      D+M    N +F Y I  N W
Sbjct: 296 -----------DTMQGLINKVFVYDIMSNDW 315

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 81/207 (39%), Gaps = 32/207 (15%)

Query: 166 YSDTWLLDCSTKEWTKVEQK-----NGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW+L  ++       Q      N P  R GH  ++  N  ++ GG    L +     
Sbjct: 201 YGDTWMLTANSDSTNFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLD 260

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH-----SFIPTQEGAVLWGGYCKVKAGKG 273
           +D +LF++ +++W     P P    P  R GH     +  P +    L+GG         
Sbjct: 261 DDLYLFNVDSHRWT---IPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQLDDNYFND 317

Query: 274 LQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEE 333
           L         + L    +P + RW+  K + F P P    +MV +  +  +FGG    E 
Sbjct: 318 LA-------MYDLSDFRNPHS-RWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGGSSRGE- 368

Query: 334 TEESLDSMFYNDLFSYQIEINRWFALQ 360
                     N L+ Y  ++N W  L+
Sbjct: 369 --------LQNQLYVYIPDLNEWRCLE 387

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 59/141 (41%), Gaps = 17/141 (12%)

Query: 91  ELILFGGESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALI 150
           +L +FGG      +S  +  N LY Y P+ ++WR   ++                 +  +
Sbjct: 357 KLWVFGG------SSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEHSATIYKNLMCV 410

Query: 151 HGGEFSSPK-QNTFYHYSDTWLLDCSTKEWTKVEQK--NGPSARSGHRISIWKN--YFML 205
            GG+    + QNT Y       L+  T +W +++    N P  RSG  +S+ +N    ++
Sbjct: 411 FGGKNKDDEYQNTMY------FLNLQTLKWYRLDTSHCNEPLPRSGQSMSLMQNDKILIM 464

Query: 206 HGGFRDLGTSTTYLNDCWLFD 226
            G   D   +   LND   +D
Sbjct: 465 GGDKNDYCVNGANLNDIDEYD 485

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 80/203 (39%), Gaps = 38/203 (18%)

Query: 168 DTWLLDCSTKEWT-KVEQKNGPSARSGHRISIW-----KNYFMLHGGFRDLGTSTTYLND 221
           D +L +  +  WT        P  R GH++S+      K    L GG  D      Y ND
Sbjct: 262 DLYLFNVDSHRWTIPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQLD----DNYFND 317

Query: 222 CWLFDITNYK-----WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQK 276
             ++D+++++     W+ ++     P P   + H+ +       ++GG  + +       
Sbjct: 318 LAMYDLSDFRNPHSRWQFLKSKAFTPPP--LTNHTMVAYDYKLWVFGGSSRGE------- 368

Query: 277 GKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEE 336
              L +  Y+ +   P    W   + +G +P P    S   +K    +FGG        +
Sbjct: 369 ---LQNQLYVYI---PDLNEWRCLETEGDKPQPIQEHSATIYKNLMCVFGG--------K 414

Query: 337 SLDSMFYNDLFSYQIEINRWFAL 359
           + D  + N ++   ++  +W+ L
Sbjct: 415 NKDDEYQNTMYFLNLQTLKWYRL 437

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 90/223 (40%), Gaps = 44/223 (19%)

Query: 166 YSDTWLL----DCSTKEWTKVE-QKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW+L    D +    T ++  +  P  R GH   +  N F++ GG    +       
Sbjct: 152 YGDTWILSAFDDATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMD 211

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGKG 273
           +D +L ++ +YKW     P P  P P  R GH  S I T +      ++GG         
Sbjct: 212 DDIYLLNVNSYKWT---VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQ-------- 260

Query: 274 LQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
                   D ++  +   D ++ R     W+  K   F P P    +M+ +  +  +FGG
Sbjct: 261 ------FDDTYFNDLAVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG 314

Query: 328 VYDFEETEESLDSMFYNDLFSYQIEINRWFALQLRPQRKKVVR 370
                   ++L  +  ND+F Y    N WF ++   ++   V+
Sbjct: 315 --------DTLQGLI-NDVFMYDPAKNDWFTIETSGEKPPPVQ 348

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 86/204 (42%), Gaps = 40/204 (19%)

Query: 168 DTWLLDCSTKEWTKVEQKNG--PSARSGHRISI-----WKNYFMLHGGFRDLGTSTTYLN 220
           D +L + ++ +WT + Q  G  P  R GH+ISI      +    L GG  D     TY N
Sbjct: 171 DIYLFNVNSYKWT-IPQPIGSRPLGRYGHKISIIAYNPMQTKLYLFGGQLD----KTYFN 225

Query: 221 DCWLFDITNYK-----WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQ 275
           D  +FD+++++     W+ +E  P   +P   + H+        V +G    V  G+  +
Sbjct: 226 DLAMFDLSSFRRRNSHWEFLE--PATTVPPPLANHTM-------VTYGNKLWVFGGETPK 276

Query: 276 KGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETE 335
                T C+      DP    W + +  G  P P    + V +K    +FGG Y      
Sbjct: 277 TVSNETYCY------DPIQNDWSKIETTGEIPPPVQEHASVVYKHIMCVFGGKYTHNAYS 330

Query: 336 ESLDSMFYNDLFSYQIEINRWFAL 359
              + +++ DL S+     +W+ L
Sbjct: 331 ---NDVYFLDLLSF-----KWYKL 346

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 72/181 (39%), Gaps = 13/181 (7%)

Query: 86  NHGKSELILFGGESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXX 145
           N  +++L LFGG+      +    F DL S+   N  W                      
Sbjct: 206 NPMQTKLYLFGGQLDKTYFNDLAMF-DLSSFRRRNSHWEFLEPATTVPPPLANHTMVTYG 264

Query: 146 GVALIHGGEFSSPKQNTFYHYSDTWLLDCSTKEWTKVEQKNG-PSARSGHRISIWKNYFM 204
               + GGE  +PK  +    ++T+  D    +W+K+E     P     H   ++K+   
Sbjct: 265 NKLWVFGGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPVQEHASVVYKHIMC 318

Query: 205 LHGGFRDLGTSTTYLNDCWLFDITNYKWKQIEFPPNHPIPDARSGHSF-IPTQEGAVLWG 263
           + GG     T   Y ND +  D+ ++KW ++       IP  RSGHS  +   E  ++ G
Sbjct: 319 VFGGKY---THNAYSNDVYFLDLLSFKWYKLPH-IKEGIPRERSGHSLTLMKNEKILIMG 374

Query: 264 G 264
           G
Sbjct: 375 G 375

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 71/177 (40%), Gaps = 29/177 (16%)

Query: 166 YSDTWLLDCS------TKEWTKVEQKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTY 218
           Y D W +  +      T +  +++ +N P  R GH  ++  N +++ GG    L      
Sbjct: 110 YGDVWQITANADGTSFTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLL 168

Query: 219 LNDCWLFDITNYKWKQIEFPPNHPI---PDARSGH-----SFIPTQEGAVLWGGYCKVKA 270
            +D +LF++ +YKW     P   PI   P  R GH     ++ P Q    L+GG    + 
Sbjct: 169 DDDIYLFNVNSYKWT---IP--QPIGSRPLGRYGHKISIIAYNPMQTKLYLFGG----QL 219

Query: 271 GKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGG 327
            K       + D    + +       WE  +     P P    +MV +  +  +FGG
Sbjct: 220 DKTYFNDLAMFDLSSFRRRNS----HWEFLEPATTVPPPLANHTMVTYGNKLWVFGG 272

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 84/208 (40%), Gaps = 34/208 (16%)

Query: 166 YSDTWL---LDCST--KEWTKVEQKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW+   LD +T  K  T       P  R GH  ++  N F++ GG    +  +    
Sbjct: 132 YGDTWIIKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMD 191

Query: 220 NDCWLFDITNYKWKQIEFP-PNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGK 278
           +D +LF+I ++KW     P P  P P  R GH        +++     K K       G 
Sbjct: 192 DDIYLFNINSHKWT---IPTPQGPRPLGRYGHKI------SIIAANQMKTKL---YVFGG 239

Query: 279 ILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFE 332
              D ++  +   D ++ R     WE  K   F P P    +M+    +  +FGG     
Sbjct: 240 QFDDTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG----- 294

Query: 333 ETEESLDSMFYNDLFSYQIEINRWFALQ 360
           +T + L     N++F +    N W  +Q
Sbjct: 295 DTPQGL----TNEVFMFDPAANDWCVVQ 318

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 167 SDTWLLDCSTKEWTKVEQK-NGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLF 225
           ++ ++ D +  +W  V+   N P     H   I+++   + GG +D      Y N  +  
Sbjct: 302 NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIYRDLMCVFGG-KD--AQDNYSNAVYFL 358

Query: 226 DITNYKWKQIEFPP-NHPIPDARSGHSFIPTQEGAVLWGG 264
           +  + KW   + P  N+ IP ARSGHS        +L  G
Sbjct: 359 NFRSLKW--FKLPTFNNMIPRARSGHSLTLLSNNKLLIMG 396

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 76/189 (40%), Gaps = 25/189 (13%)

Query: 188 PSARSGHRISIWKNYFMLHGGFRDLGTSTTYLND-CWLFDITNYKWKQIEFPPNHPIPDA 246
           P  R GH  ++  N F++ GG          ++D  +LF+I +YKW   +  P  P P  
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQ--PVGPRPLG 197

Query: 247 RSGH--SFIPTQEGAV---LWGGYCKVKAGKGLQKGKILTDCWYLKMKADPTAIRWERRK 301
           R GH  S I T +      ++GG         L        C Y           WE  K
Sbjct: 198 RYGHKISIIATSQMKTKLYVFGGQFDDSYFNDL--------CVYDLSSFRKPESHWEFLK 249

Query: 302 KQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEINRWFALQL 361
            + F P P    +MV +  +  +FGG     +T++ L     N LF +   IN W  ++ 
Sbjct: 250 PKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDPVINDWRVVET 300

Query: 362 RPQRKKVVR 370
             ++   V+
Sbjct: 301 TGEKPPPVQ 309

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 75/182 (41%), Gaps = 31/182 (17%)

Query: 188 PSARSGHRISIWKNYFMLHGG-FRDLGTSTTYLNDCWLFDITNYKWKQIEFPPNHPI--- 243
           P  R GH  +I  N  +L GG    +       +D +LF++ +YKW   E     PI   
Sbjct: 102 PPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIPE-----PIGLR 156

Query: 244 PDARSGH--SFI---PTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKADPTAIRWE 298
           P  R GH  S I   PT+    L+GG         L         + L     P A +WE
Sbjct: 157 PLGRYGHKISIIATQPTKTKLFLFGGQFDDTYFNDLS-------MFDLSTFRKPDA-QWE 208

Query: 299 RRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEINRWFA 358
             K + F P P    +M+ +  +  +FGG        E+L  +  N++F Y   +N W  
Sbjct: 209 FIKPKSFFPPPVSNHTMISYDNKLWVFGG--------ETLQGLI-NEVFVYDPIVNDWSV 259

Query: 359 LQ 360
           ++
Sbjct: 260 IE 261

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 88/217 (40%), Gaps = 48/217 (22%)

Query: 166 YSDTWLLDCSTKEWTKVEQKN------GPSARSGHRISIWKNYFMLHGG-FRDLGTSTTY 218
           Y DTW +  ST   T+   K        P  R GH  ++  N F++ GG    +      
Sbjct: 181 YGDTWSI-TSTNNGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLM 239

Query: 219 LNDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAGK 272
            +D +LF+I ++KW     P P  P P  R GH  S I T        L+GG        
Sbjct: 240 DDDIYLFNINSHKWT---IPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ------- 289

Query: 273 GLQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFG 326
                    D ++  +   D ++ R     WE  K +G  P P    +MV +  +  +FG
Sbjct: 290 -------FDDTYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFG 342

Query: 327 GVYDFEETEESLDSMFYNDLFSYQI--EINRWFALQL 361
           G     +T++ L     ND++++     IN W  + +
Sbjct: 343 G-----DTKDGL----INDIYAFDPADSINTWTKIDV 370

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 95/223 (42%), Gaps = 41/223 (18%)

Query: 149 LIHGGEFSSPKQNTFYHYSDTWLLDCSTKEWTKVEQKNG--PSARSGHRISIWKNYFM-- 204
           ++ GG+     +N      D +L + ++ +WT +    G  P  R GH+ISI  +  M  
Sbjct: 155 VVFGGDTHKLNKNRLLD-DDLYLFNINSYKWT-IPHPIGSRPLGRYGHKISIIASKQMHT 212

Query: 205 ---LHGGFRDLGTSTTYLNDCWLFDITNYK-----WKQIEFPPNHPIPDARSGHSFIPTQ 256
              L GG  D     TY ND  +FD+++++     W+ +E  P   +P   + H+ +   
Sbjct: 213 ELYLFGGQID----ETYFNDLAVFDLSSFRRPNSHWEFLE--PISALPPPLTNHTMVTFD 266

Query: 257 EGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMV 316
               ++GG          +  K +++  Y     DP    W + +  G +P P    + V
Sbjct: 267 NKLWVFGG----------ETPKTISNDTYC---YDPIQNAWSKVETTGEKPPPVQEHASV 313

Query: 317 HHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEINRWFAL 359
            +K    +FGG        + + + + ND++   +   +WF L
Sbjct: 314 VYKHLMCVFGG--------KDIHNTYSNDVYFLNLLSLKWFKL 348

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 53/127 (41%), Gaps = 13/127 (10%)

Query: 230 YKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           Y W +I+   + P P  R   SFI T +  +   G        GL    +  D W +   
Sbjct: 71  YIWNRIKLK-DSPFPRYRHSSSFITTNDNRIFVTG--------GLYDQSVYGDVWEITAN 121

Query: 290 ADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSY 349
           A+ T+   +R +     P PRVG +        ++FGG    +  + + + +  +DL+ +
Sbjct: 122 ANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGG----DTHKLNKNRLLDDDLYLF 177

Query: 350 QIEINRW 356
            I   +W
Sbjct: 178 NINSYKW 184

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 82/209 (39%), Gaps = 36/209 (17%)

Query: 166 YSDTWLLDCSTKEWTKVEQK-----NGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y D W +  +    +   ++     N P  R GH  ++  N +++ GG    L  +    
Sbjct: 112 YGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLD 171

Query: 220 NDCWLFDITNYKWKQIEFPPNHPI---PDARSGH--SFIPTQEGAV---LWGGYCKVKAG 271
           +D +LF+I +YKW     P  HPI   P  R GH  S I +++      L+GG       
Sbjct: 172 DDLYLFNINSYKWT---IP--HPIGSRPLGRYGHKISIIASKQMHTELYLFGGQIDETYF 226

Query: 272 KGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDF 331
             L         + L     P +  WE  +     P P    +MV    +  +FGG    
Sbjct: 227 NDLA-------VFDLSSFRRPNS-HWEFLEPISALPPPLTNHTMVTFDNKLWVFGG---- 274

Query: 332 EETEESLDSMFYNDLFSYQIEINRWFALQ 360
            ET +++     ND + Y    N W  ++
Sbjct: 275 -ETPKTIS----NDTYCYDPIQNAWSKVE 298

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 81/212 (38%), Gaps = 46/212 (21%)

Query: 166 YSDTWLLDCST----------KEWTKVEQKNGPSARSGHRISIWKNYFMLHGG-FRDLGT 214
           Y DTW+L  S           K  T    ++ P  R GH  ++  N F++ GG    + +
Sbjct: 186 YGDTWILTASDIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNS 245

Query: 215 STTYLNDCWLFDITNYKWKQIEFP-PNHPIPDARSGHSFI---PTQEGAVLWGGYCKVKA 270
                +D +L +I +YKW     P P    P  R GH  +     Q    L+GG      
Sbjct: 246 DGLMDDDLYLLNINSYKWT---IPKPVGQRPLGRYGHKIVTISAEQTKLYLFGGQ----- 297

Query: 271 GKGLQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGIL 324
                      D ++  +   D ++ R     W   K  GF P P    +MV ++ +  +
Sbjct: 298 ---------FDDTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWV 348

Query: 325 FGGVYDFEETEESLDSMFYNDLFSYQIEINRW 356
           FGG        ++L+    N ++ Y    N W
Sbjct: 349 FGG--------DTLEEGLINRVYLYSPTNNSW 372

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 170 WLLDCSTKEWTKVEQKNG-PSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDIT 228
           +L   +   W  VE     P     H   ++K+   + GG +D      YLN  +  ++ 
Sbjct: 363 YLYSPTNNSWEIVETTGDIPPPMQEHAAIVYKDLMCVVGG-KD--AEDNYLNTLYFLNLQ 419

Query: 229 NYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGG 264
           + KW ++ F  N+ IP  RSGHS    +   +L  G
Sbjct: 420 SLKWFKLPFYKNN-IPQGRSGHSVTLLKNDQILIMG 454

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 16/128 (12%)

Query: 94  LFGGESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVALIHGG 153
           +FGG     DT      N +Y Y+P N+ W    +                  +  + GG
Sbjct: 348 VFGG-----DTLEEGLINRVYLYSPTNNSWEIVETTGDIPPPMQEHAAIVYKDLMCVVGG 402

Query: 154 EFSSPKQ-NTFYHYSDTWLLDCSTKEWTKVE--QKNGPSARSGHRISIWKN-YFMLHGGF 209
           + +     NT Y       L+  + +W K+   + N P  RSGH +++ KN   ++ GG 
Sbjct: 403 KDAEDNYLNTLY------FLNLQSLKWFKLPFYKNNIPQGRSGHSVTLLKNDQILIMGGD 456

Query: 210 R-DLGTST 216
           + D  +ST
Sbjct: 457 KYDYSSST 464

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 95/223 (42%), Gaps = 41/223 (18%)

Query: 149 LIHGGEFSSPKQNTFYHYSDTWLLDCSTKEWTKVEQKNG--PSARSGHRISIWKNYFM-- 204
           ++ GG+     +N      D +L + ++ +WT + Q  G  P  R GH+ISI  +  M  
Sbjct: 155 VVFGGDTHKLNKNGLLD-DDLYLFNINSYKWT-IPQPIGRRPLGRYGHKISIIASNPMQT 212

Query: 205 ---LHGGFRDLGTSTTYLNDCWLFDITNYK-----WKQIEFPPNHPIPDARSGHSFIPTQ 256
              L GG  D     TY ND  +FD+++++     W+ +E  P   +P   + H+ +   
Sbjct: 213 KLYLFGGQVD----ETYFNDLVVFDLSSFRRPNSHWEFLE--PVGDLPPPLTNHTMVAYD 266

Query: 257 EGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMV 316
               ++GG          +  K +++  Y   + DP    W + K  G +P P    + V
Sbjct: 267 NKLWVFGG----------ETPKTISNDTY---RYDPAQSEWSKVKTTGEKPPPIQEHASV 313

Query: 317 HHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEINRWFAL 359
            +K    + GG        +   + + ND++   +   +W+ L
Sbjct: 314 VYKHLMCVLGG--------KDTHNAYSNDVYFLNLLSLKWYKL 348

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 52/127 (40%), Gaps = 13/127 (10%)

Query: 230 YKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           Y W +++   N P P  R   SFI T +  +   G        GL    +  D W +   
Sbjct: 71  YIWNRVKLK-NSPFPRYRHSSSFIVTNDNRIFVTG--------GLHDQSVYGDVWQIAAN 121

Query: 290 ADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSY 349
           AD T+   +R       P PRVG +        ++FGG    +  + + + +  +DL+ +
Sbjct: 122 ADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGG----DTHKLNKNGLLDDDLYLF 177

Query: 350 QIEINRW 356
            I   +W
Sbjct: 178 NINSYKW 184

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 84/206 (40%), Gaps = 38/206 (18%)

Query: 166 YSDTWLLDCS------TKEWTKVEQKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTY 218
           Y D W +  +      T +   ++Q N P  R GH  +I  N +++ GG    L  +   
Sbjct: 112 YGDVWQIAANADGTSFTSKRIDIDQ-NTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLL 170

Query: 219 LNDCWLFDITNYKWKQIEFPPNHPI---PDARSGH--SFI---PTQEGAVLWGGYCKVKA 270
            +D +LF+I +YKW     P   PI   P  R GH  S I   P Q    L+GG      
Sbjct: 171 DDDLYLFNINSYKWT---IP--QPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVDETY 225

Query: 271 GKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYD 330
              L    ++ D    +    P +  WE  +  G  P P    +MV +  +  +FGG   
Sbjct: 226 FNDL----VVFDLSSFRR---PNS-HWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG--- 274

Query: 331 FEETEESLDSMFYNDLFSYQIEINRW 356
             ET +++     ND + Y    + W
Sbjct: 275 --ETPKTIS----NDTYRYDPAQSEW 294

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 73/185 (39%), Gaps = 35/185 (18%)

Query: 179 WTKVEQKNGPSARSGHRISIW---KNYFMLHGGFRDLGTSTTYLNDCWLF----DITNYK 231
           W +V+ KN P  R  H  S      N   + GG  D     +   D W      D T++ 
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHD----QSVYGDVWQIAANADGTSFT 128

Query: 232 WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKAD 291
            K+I+   N P P  R GH+        V++GG         L K  +L D  YL    +
Sbjct: 129 SKRIDIDQNTPPP--RVGHASTICGNAYVVFGGDT-----HKLNKNGLLDDDLYL---FN 178

Query: 292 PTAIRWERRKKQGFQPSPRVG--CSMVHH---KGRGILFGGVYDFEETEESLDSMFYNDL 346
             + +W   +  G +P  R G   S++     + +  LFGG          +D  ++NDL
Sbjct: 179 INSYKWTIPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGG---------QVDETYFNDL 229

Query: 347 FSYQI 351
             + +
Sbjct: 230 VVFDL 234

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 58/141 (41%), Gaps = 25/141 (17%)

Query: 90  SELILFGGESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKNXXXXXXXXXXXXXXXGVAL 149
           ++L +FGGE+           ND Y Y P   +W +  +                  +  
Sbjct: 267 NKLWVFGGETPK------TISNDTYRYDPAQSEWSKVKTTGEKPPPIQEHASVVYKHLMC 320

Query: 150 IHGGEFSSPKQNTFYHYS-DTWLLDCSTKEWTKVEQ-KNG-PSARSGHRISIWKN-YFML 205
           + GG      ++T   YS D + L+  + +W K+ + K G P  RSGH +++ KN   ++
Sbjct: 321 VLGG------KDTHNAYSNDVYFLNLLSLKWYKLPRMKEGIPQERSGHSLTLMKNEKLLI 374

Query: 206 HGG---------FRDLGTSTT 217
            GG           DL TS T
Sbjct: 375 MGGDKTDYASPNIHDLQTSET 395

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 88/219 (40%), Gaps = 46/219 (21%)

Query: 166 YSDTWLLDCSTKEWTKVEQKN------GPSARSGHRISIWKNYFMLHGG-FRDLGTSTTY 218
           Y DTW++  S +   +   K        P  R GH  ++  N F++ GG    + +    
Sbjct: 115 YGDTWIV-TSHENGARFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLM 173

Query: 219 LNDCWLFDITNYKWKQIEFP-PNHPIPDARSGH-----SFIPTQEGAVLWGGYCKVKAGK 272
            +D +LF+I +YKW     P P  P P  R GH     +  P +    ++GG        
Sbjct: 174 DDDVYLFNINSYKWT---IPNPVGPRPLGRYGHKISIIAMSPMKTKLYVFGGQ------- 223

Query: 273 GLQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFG 326
                    D ++  +   D ++ R     W+      F P P    +M+ +  +  +FG
Sbjct: 224 -------FDDTYFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFG 276

Query: 327 GVYDFEETEESLDSMFYNDLFSYQIEINRWFALQLRPQR 365
           G     +T + L     +D+F +  ++N W  +Q   Q+
Sbjct: 277 G-----DTPQGL----IDDVFVFDPQVNDWKFIQTTGQK 306

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 83/216 (38%), Gaps = 30/216 (13%)

Query: 166 YSDTWLLDCSTKEWTKVEQ-----KNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTTYL 219
           Y DTW +  +    + V +     +N P  R GH  +I  N +++ GG    L  +    
Sbjct: 112 YGDTWQITGNLDGTSFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLD 171

Query: 220 NDCWLFDITNYKWKQIEFPPNHPIPDARSGH--SFI---PTQEGAVLWGGYCKVKAGKGL 274
           +D +LF+I +YKW   +  P    P  R GH  S I   P Q    L+GG         L
Sbjct: 172 DDLYLFNINSYKWTIPQ--PVGTRPLGRYGHKISIIANNPMQTKLFLFGGQIDETYFNDL 229

Query: 275 QKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEET 334
                    + L     P +  W   K     P P    +MV    +  +FGG     +T
Sbjct: 230 A-------MFDLSSFRRPNS-HWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG-----KT 276

Query: 335 EESLDSMFYNDLFSYQIEINRWFALQLRPQRKKVVR 370
             +L     N+ F Y    N W  +Q   +R   V+
Sbjct: 277 PNTLS----NETFCYDPVQNDWSKIQTTGERPPAVQ 308

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 72/185 (38%), Gaps = 35/185 (18%)

Query: 179 WTKVEQKNGPSARSGHR---ISIWKNYFMLHGGFRDLGTSTTYLNDCWL----FDITNYK 231
           W +++ KN P  R  H    I    N   + GG  D         D W      D T++ 
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGGLHD----HLVYGDTWQITGNLDGTSFV 128

Query: 232 WKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKAD 291
            K I+   N P P  R GH+        V++GG         L   ++L D  YL    +
Sbjct: 129 SKTIQIGQNTPPP--RVGHASTICGNAYVVFGGDT-----HKLNMNRLLDDDLYL---FN 178

Query: 292 PTAIRWERRKKQGFQPSPRVG--CSMVHH---KGRGILFGGVYDFEETEESLDSMFYNDL 346
             + +W   +  G +P  R G   S++ +   + +  LFGG          +D  ++NDL
Sbjct: 179 INSYKWTIPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGG---------QIDETYFNDL 229

Query: 347 FSYQI 351
             + +
Sbjct: 230 AMFDL 234

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 74/182 (40%), Gaps = 37/182 (20%)

Query: 166 YSDTWLLD-----CSTKEWTKVE--QKNGPSARSGHRISIWKNYFMLHGG-FRDLGTSTT 217
           Y DTW+L       ST   +K     +N P  R GH  ++  N F++ GG    +    +
Sbjct: 199 YGDTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGS 258

Query: 218 YLNDCWLFDITNYKWKQIEFP-PNHPIPDARSGH--SFIPTQEGAV---LWGGYCKVKAG 271
             +D +LF+I +YKW     P P    P  R GH  S I T +      L+GG       
Sbjct: 259 MDDDIYLFNINSYKWT---IPKPVGQRPLGRYGHKISIIATSQMKTKLYLFGGQ------ 309

Query: 272 KGLQKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILF 325
                     D ++  +   D ++ R     WE  + + F P P    +M  +  +  +F
Sbjct: 310 --------FDDTYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVF 361

Query: 326 GG 327
           GG
Sbjct: 362 GG 363

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 42/102 (41%), Gaps = 11/102 (10%)

Query: 170 WLLDCSTKEWTKVEQ-------KNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDC 222
           ++ D    +W  VE         N P     H   ++K+   + GG  +   S  YLND 
Sbjct: 374 FMYDPVDNDWCVVETFANNNDVSNIPPPIQEHAAVLYKDLMCVIGGKDE---SDNYLNDV 430

Query: 223 WLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGG 264
           +  ++   KW ++ F     +P  RSGHS    +   +L  G
Sbjct: 431 YFLNLKTLKWFKLPF-YKEGVPQGRSGHSVTLLKNDKILIMG 471

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 68/176 (38%), Gaps = 23/176 (13%)

Query: 188 PSARSGHRISIWKNYFMLHGG-FRDLGTSTTYLND-CWLFDITNYKWKQIEFP-PNHPIP 244
           P  R GH  ++  N  ++ GG    +  S   ++D  +  ++   KW     P P    P
Sbjct: 95  PPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYFLNLDTTKWT---IPSPKGIRP 151

Query: 245 DARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKADPTAIRWERRKKQG 304
             R GH          L+GG         L K  +L          D  + +WE  K +G
Sbjct: 152 LGRYGHKISVINSNLYLFGGQFDETYFNDLVKFDLLN-------FKDANS-QWEFIKPKG 203

Query: 305 FQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEINRWFALQ 360
           F P P    SM   + +  +FGG     +T + L     N+ F Y  E+N W  L+
Sbjct: 204 FIPPPLSNFSMCTFENKLYVFGG-----DTYQVLT----NETFVYDPELNEWSILE 250

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 83/212 (39%), Gaps = 42/212 (19%)

Query: 166 YSDTWLL---------DCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTST 216
           Y DTW+L            T E T+      P  R GH  ++  N F++ GG      + 
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETT----PPPRVGHAATLCGNAFVIFGGDTHKTNNE 146

Query: 217 TYL-NDCWLFDITNYKWKQIEFP-PNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGL 274
             + +D +L ++ ++KW     P P  P P  R GH        +++     K K     
Sbjct: 147 GLMDDDVYLLNVNSHKWT---IPHPVGPRPLGRYGHKI------SIIATSQMKTKL---Y 194

Query: 275 QKGKILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGV 328
             G    D ++  +   D ++ R     W   K   F P P    +MV +  +  +FGG 
Sbjct: 195 VFGGQFDDTYFNDLAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG- 253

Query: 329 YDFEETEESLDSMFYNDLFSYQIEINRWFALQ 360
               +T + L     N+LF Y   +N W  ++
Sbjct: 254 ----DTPQGL----INELFVYDPVVNDWSVVE 277

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 82/205 (40%), Gaps = 36/205 (17%)

Query: 166 YSDTWLLDCS------TKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYL 219
           Y DTW++         T +  ++ +   P  R GH  ++  N F++ GG      +   +
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETT-PPPRVGHASTLCGNAFVIFGGDTHKTNAEGLM 255

Query: 220 -NDCWLFDITNYKWKQIEFP-PNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKG 277
            +D +L +I ++KW     P P  P P  R GH        +++     K K       G
Sbjct: 256 DDDVYLLNINSHKWT---IPRPVGPRPLGRYGHKI------SIIATSQMKTKL---YVFG 303

Query: 278 KILTDCWYLKMKA-DPTAIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDF 331
               D ++  +   D ++ R     W+  K   F P P    +MV +  +  +FGG    
Sbjct: 304 GQFDDTYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG---- 359

Query: 332 EETEESLDSMFYNDLFSYQIEINRW 356
            +T + L     N+LF Y    N W
Sbjct: 360 -DTPQGL----INELFMYDPTTNDW 379

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 38/100 (38%), Gaps = 10/100 (10%)

Query: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230
           L    + + TK    +GP  +     +   +  ++HGG      +T   +D W FD    
Sbjct: 627 LFPIGSPKSTKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETE 682

Query: 231 KWKQIEFPPNH------PIPDARSGHSFIPTQEGAVLWGG 264
            W QIE           PI  A +GHS       ++  GG
Sbjct: 683 SWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,505,989
Number of extensions: 2511545
Number of successful extensions: 7722
Number of sequences better than 10.0: 52
Number of HSP's gapped: 7599
Number of HSP's successfully gapped: 97
Length of query: 650
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 534
Effective length of database: 40,180,143
Effective search space: 21456196362
Effective search space used: 21456196362
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)