Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.766.13ON48548525840.0
Kpol_1032.46.13ON46746221780.0
SAKL0E00946g6.13ON49346021120.0
TPHA0J002706.13ON49646820910.0
TDEL0G045806.13ON48448520820.0
KLTH0C11462g6.13ON49247420790.0
Kwal_56.223626.13ON49346020730.0
Ecym_30166.13ON48947720650.0
ACR013C6.13ON48846020640.0
Suva_16.436.13ON48848720560.0
KLLA0D00902g6.13ON49246020530.0
Smik_6.4706.13ON48848720490.0
Skud_16.166.13ON48848720490.0
CAGL0A01045g6.13ON48348420480.0
YPL262W (FUM1)6.13ON48848720480.0
ZYRO0C07964g6.13ON50546319960.0
KNAG0E027506.13ON49848319570.0
NCAS0D026206.13ON49348319380.0
KAFR0B065206.13ON49546019250.0
TBLA0A071306.13ON50048418760.0
TBLA0G010006.13ON46546018550.0
NDAI0I024706.13ON47546518410.0
KLLA0A08404g1.354ON4612161197e-06
Suva_15.2011.354ON4632391161e-05
NDAI0G059401.354ON4622111161e-05
Skud_8.701.354ON4632071161e-05
SAKL0D09746g1.354ON4642241152e-05
Kwal_47.180664.197ON4821811133e-05
CAGL0I08987g1.354ON4612291125e-05
CAGL0B02794g4.197ON4821811116e-05
NDAI0J019504.197ON4821831117e-05
Skud_12.4434.197ON4821811107e-05
Kpol_1042.164.197ON4821861107e-05
NCAS0J012004.197ON4821811107e-05
KLLA0B13189g4.197ON4821841108e-05
KNAG0I015601.354ON4622181108e-05
Suva_10.4594.197ON4821811109e-05
KNAG0B058404.197ON4821811099e-05
TDEL0D022201.354ON4652141091e-04
YLR359W (ADE13)4.197ON4821811091e-04
NCAS0A090101.354ON4622071091e-04
Smik_8.831.354ON4632301081e-04
SAKL0B04972g4.197ON4821811081e-04
Smik_12.4464.197ON4821811081e-04
Ecym_24524.197ON4821881081e-04
TPHA0B010404.197ON4821811053e-04
Ecym_27491.354ON4702061044e-04
AEL019W1.354ON4692181044e-04
ZYRO0G00748g1.354ON4622131035e-04
ZYRO0B07964g4.197ON4821811035e-04
YHR018C (ARG4)1.354ON4632301035e-04
TPHA0A021901.354ON4632251036e-04
TBLA0A083204.197ON4822031026e-04
Kpol_1018.1251.354ON4602081027e-04
KLTH0A03344g4.197ON4821811010.001
TDEL0E017604.197ON4821811010.001
TBLA0F034801.354ON466226990.002
KAFR0A062304.197ON482186960.003
ABL006C4.197ON482181950.005
Kwal_27.127821.354ON465230930.008
KLTH0G19338g1.354ON465279880.034
Suva_4.4946.148ON85090770.88
Skud_7.4413.492ON80742770.92
Ecym_44523.426ON122171761.1
Kpol_513.235.20ON708102732.4
KNAG0D034804.117ON116272723.4
KLLA0D10956g7.496ON55446705.6
Skud_2.3696.148ON84890697.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.76
         (485 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   999   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   843   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   818   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   810   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   806   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   805   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   803   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   800   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   799   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   796   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   795   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   793   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   793   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   793   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   793   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   773   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   758   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   751   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   746   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   727   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   719   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   713   0.0  
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    50   7e-06
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    49   1e-05
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    49   1e-05
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    49   1e-05
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    49   2e-05
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    48   3e-05
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    48   5e-05
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    47   6e-05
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    47   7e-05
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    47   7e-05
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    47   7e-05
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    47   7e-05
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    47   8e-05
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    47   8e-05
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    47   9e-05
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    47   9e-05
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    47   1e-04
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    47   1e-04
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    47   1e-04
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    46   1e-04
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    46   1e-04
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    46   1e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    46   1e-04
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    45   3e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    45   4e-04
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    45   4e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    44   5e-04
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    44   5e-04
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    44   5e-04
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    44   6e-04
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    44   6e-04
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    44   7e-04
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    44   0.001
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    44   0.001
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    43   0.002
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    42   0.003
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    41   0.005
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    40   0.008
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    39   0.034
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    34   0.88 
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    34   0.92 
Ecym_4452 Chr4 complement(923429..927094) [3666 bp, 1221 aa] {ON...    34   1.1  
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...    33   2.4  
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    32   3.4  
KLLA0D10956g Chr4 complement(934074..935738) [1665 bp, 554 aa] {...    32   5.6  
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...    31   7.7  

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/485 (100%), Positives = 485/485 (100%)

Query: 1   MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60
           MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE
Sbjct: 1   MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60

Query: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120
           RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS
Sbjct: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120

Query: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180
           GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH
Sbjct: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ
Sbjct: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240

Query: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300
           QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG
Sbjct: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300

Query: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360
           ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360

Query: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420
           VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS
Sbjct: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420

Query: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480
           ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM
Sbjct: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480

Query: 481 LGPSS 485
           LGPSS
Sbjct: 481 LGPSS 485

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/462 (87%), Positives = 433/462 (93%)

Query: 23  GFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNT 82
           GFR+ETDGFGEIKVPA+KYWGAQT+RS+ENFKIGG RERMPE VV+AFGVLKK AAIVN 
Sbjct: 6   GFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNE 65

Query: 83  ELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 142
           E G LD   SKLIQQAADEV  GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIELKGG
Sbjct: 66  EFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 125

Query: 143 VLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHI 202
           ++GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVT+I+ HL+P++T L+DALA KS EFEHI
Sbjct: 126 IMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHI 185

Query: 203 VKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNG 262
           VKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE +  NL+FLAQGGTAVGTGLNTK G
Sbjct: 186 VKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIG 245

Query: 263 WAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSG 322
           +AERIA ++SKETG+ FKTAPNKFEALAAHDAIVE+SGALNTVACSLFKIAQDIRYLGSG
Sbjct: 246 FAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSG 305

Query: 323 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVF 382
           PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVF
Sbjct: 306 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 365

Query: 383 KPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAA 442
           KPV+ISNLLSS++LLGDA  SF +HCVEGI+ANE KI++LLH SLMLVTALNPKIGYD+A
Sbjct: 366 KPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSA 425

Query: 443 TKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 484
           TKVAKNAHKKGITLKESALELGVLTE EFDEWVVPEKMLGPS
Sbjct: 426 TKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/460 (84%), Positives = 423/460 (91%)

Query: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83
           +R+ETD FGEIKVPA+KYWGAQT+RSFENFKIGG+RERMPEAVVRAFGVLKK AAIVN  
Sbjct: 32  YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 91

Query: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143
           LG LDP  SK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 92  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 151

Query: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203
            GSK++HPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT LRD+   KS EF  IV
Sbjct: 152 KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 211

Query: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263
           KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E++  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 271

Query: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323
           AE+IA ++SKETG+ FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443
           PV+ISNLLSSV+LL DAS SFRVHCV+GIKANE +IS+LLH SLMLVTALNPKIGYDAA+
Sbjct: 392 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 451

Query: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
           KVAKNAHKKGITLKESAL+LGVL EKEFDEWV+PEKM+GP
Sbjct: 452 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 491

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/468 (81%), Positives = 426/468 (91%)

Query: 16  RYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKK 75
           R +S+  GFR+ETDGFGEIKVPANKYWGAQTERSFENF+IGG RERMP+ VV+AFGVLKK
Sbjct: 28  RCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKK 87

Query: 76  CAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 135
            AAIVN   G LDP  SK+IQ+AADEV  GKLNDHFPLVVFQTGSGTQSNMNANEVISNR
Sbjct: 88  SAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 147

Query: 136 AIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAK 195
           AIEL GG LGSK++HPNNH N AQSSND+FPTVMHIAAVT+I+ HL+PE+ +LRDAL +K
Sbjct: 148 AIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESK 207

Query: 196 SAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGT 255
           S +F HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI RIE +  NL+FLAQGGTAVGT
Sbjct: 208 SKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGT 267

Query: 256 GLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQD 315
           GLNT+ G+AE+IA +ISKETG+AFKTAPNKFEALAAHDAIVEASGA+ TVA SLFKIAQD
Sbjct: 268 GLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQD 327

Query: 316 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASG 375
           IRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  + FAG  G
Sbjct: 328 IRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQG 387

Query: 376 QFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNP 435
           QFELNVFKPV+ISNLLSS++LLGD S+SFR+HCVEGIKANE +I++L+++SLMLVTALNP
Sbjct: 388 QFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNP 447

Query: 436 KIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
           KIGYD ATKVAKNAHKKGITLKESA++LG LTE EFDEWVVPEKM+GP
Sbjct: 448 KIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/485 (80%), Positives = 432/485 (89%), Gaps = 5/485 (1%)

Query: 1   MLRSAI--RPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGS 58
           MLR+ +  RP +V    +  +    FRVETD FGEIKV A++YWGAQT+RS ENF+IGG 
Sbjct: 1   MLRTGLLSRPLSV---VKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGP 57

Query: 59  RERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQT 118
           RERMPE +VRAFGVLKK AA+VN  LG LDP  ++ I+QAADEVA GKL  HFPLVVFQT
Sbjct: 58  RERMPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQT 117

Query: 119 GSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQIS 178
           GSGTQSNMNANEVISNRAIEL GG LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+
Sbjct: 118 GSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEIT 177

Query: 179 QHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIER 238
           +HLLPEL HLRD+L AKS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI+R+E 
Sbjct: 178 RHLLPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEG 237

Query: 239 AQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEA 298
           +   L++LAQGGTAVGTGLNTK G+AE+IA ++SKETGL FKTAPNKFEALAAHDA+VEA
Sbjct: 238 SLHRLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEA 297

Query: 299 SGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC 358
           SGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVC
Sbjct: 298 SGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVC 357

Query: 359 VQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAK 418
           VQVMGNNAA+TFAGASGQFELNVFKPV+ISNLLSSV+LL DAS SFRVHCV+GI AN  +
Sbjct: 358 VQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDR 417

Query: 419 ISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPE 478
           I +L+H SLMLVTALNPKIGYDAA+KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPE
Sbjct: 418 IGKLMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPE 477

Query: 479 KMLGP 483
            M+GP
Sbjct: 478 NMIGP 482

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/474 (81%), Positives = 422/474 (89%), Gaps = 4/474 (0%)

Query: 14  QTRYISNLKGF----RVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRA 69
           +TR IS         RVETD FGEI VPA+KYWGAQT+RS ENFKIGG+RERMPE VVRA
Sbjct: 18  KTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRA 77

Query: 70  FGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNAN 129
           FG+LKK AAIVN  LG LDP  SK IQQAADEV +GKL DHFPLVVFQTGSGTQSNMNAN
Sbjct: 78  FGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNAN 137

Query: 130 EVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLR 189
           EVISNRAIE+ GG +G+K IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT LR
Sbjct: 138 EVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALR 197

Query: 190 DALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQG 249
           D+ A KS EFE IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E++  +L+FLAQG
Sbjct: 198 DSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQG 257

Query: 250 GTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSL 309
           GTAVGTGLNTK G+ E+IA ++SKETG+ FKTAPNKFEALAAHDAIVE SGALNT+ACSL
Sbjct: 258 GTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSL 317

Query: 310 FKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVT 369
           FKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+T
Sbjct: 318 FKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAIT 377

Query: 370 FAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLML 429
           FAGASGQFELNVFKPV+ISNLLSSV+LLGDA  SFRVHCV+GI+AN  KI++LLH SLML
Sbjct: 378 FAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLML 437

Query: 430 VTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
           VTALNPKIGYDAA+KVAKNAHKKGITLKESALEL VLT  EFD+WVVPE M+GP
Sbjct: 438 VTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/460 (82%), Positives = 416/460 (90%)

Query: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83
           +RVETD FGEIKVP +K WGAQT+RS ENFKIGG RERMPE +V+AFG+LKK AAIVN  
Sbjct: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91

Query: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143
           LG LDP  SK IQ AADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNRAI+L GG 
Sbjct: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151

Query: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203
           +GSK IHPNNHCN AQSSNDTFP+VMHIAAVT+++  LLPEL  LRDA A K+ EF+ IV
Sbjct: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211

Query: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263
           KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E +  NL+FLAQGGTAVGTGLNTK G+
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271

Query: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323
           AE+IA ++SKETG+ FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443
           PV+ISNLLSS++LLGDA  SFRVHCVEGI+ANE KI++LLH SLMLVTALNPKIGYDAA+
Sbjct: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451

Query: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
           KVAKNAHKKGITLKESALELGVL+  EFDEWVVPE M+GP
Sbjct: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/477 (79%), Positives = 422/477 (88%), Gaps = 4/477 (0%)

Query: 12  RVQTRYISNLKG----FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVV 67
           R+  R +S   G    FR+ETD FGEIKVPANKYWGAQT+RS ENFKIGG RERMPE ++
Sbjct: 12  RIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPII 71

Query: 68  RAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMN 127
           +AFG+LKK AAIVN  LG LDP  SK IQQAADEV  GKL DHFPLVVFQTGSGTQSNMN
Sbjct: 72  KAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMN 131

Query: 128 ANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTH 187
           ANEVISNRAIEL GG LG+K+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT 
Sbjct: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191

Query: 188 LRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLA 247
           LRD+   K+ EF HIVKIGRTHLQDATPLTLGQEF GY QQ+TNGI R+E++  +L+FLA
Sbjct: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251

Query: 248 QGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVAC 307
           QGGTAVGTGLNTK G+AE+IA ++SKET + FKTAPNKFEALAAHDA+VE SGALNTVAC
Sbjct: 252 QGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVAC 311

Query: 308 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 367
           SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ 
Sbjct: 312 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNST 371

Query: 368 VTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSL 427
           +TFAGASGQFELNVFKPV+ISNLL+S++LL DAS SFRVHCV+GIKANE KI+++LH SL
Sbjct: 372 ITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESL 431

Query: 428 MLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 484
           MLVTALNPKIGYD+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPEKM+GP+
Sbjct: 432 MLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPT 488

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/460 (81%), Positives = 422/460 (91%)

Query: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83
           FRVETD FGEI+VPA+KYWGAQT+RS ENF+IGG+RERMPE VVRAFGVLKK AA+VN +
Sbjct: 27  FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86

Query: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143
           LG L+P  +K IQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 87  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146

Query: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203
           LGSK++HPNNHCN AQSSNDTFP+VMHIAAVT+I++ LLPEL  LR +   K+ EF HIV
Sbjct: 147 LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206

Query: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263
           KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+E AQ++LRFLAQGGTAVGTGLNT+ G+
Sbjct: 207 KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266

Query: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323
           AE+IAA++S+ETGL F+TAPNKFEALAAHDA+VEASGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 267 AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326

Query: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383
           RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 327 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386

Query: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443
           PV+I+NLLSSV+LL DA+RSFRVHCV+GI+ NE +I++LLH SLMLVTALNPKIGYDAA+
Sbjct: 387 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446

Query: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
            VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPEKM+GP
Sbjct: 447 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGP 486

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/487 (78%), Positives = 426/487 (87%), Gaps = 4/487 (0%)

Query: 1   MLRSAIRPNTVRVQTRYISNLK----GFRVETDGFGEIKVPANKYWGAQTERSFENFKIG 56
           MLR +       +Q+ Y  N++     FR ETD FGEI VPA+KYWGAQT+RSF+NFKIG
Sbjct: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 57  GSRERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVF 116
           G+RERMP  +V AFGVLKK AAIVN  LGGLDP  SK IQQAADEVA GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120

Query: 117 QTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQ 176
           QTGSGTQSNMNANEVISNRAIE+ GG +GSK++HPNN CN +QSSNDTFPTVMHIAA  Q
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQ 180

Query: 177 ISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI 236
           I + L+PELT+L++AL AKS EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 237 ERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIV 296
               + L FLAQGGTAVGTGLNTK G+  +IA +ISKETGL F+TAPNKFEALAAHDAIV
Sbjct: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 297 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 356
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 357 VCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANE 416
           VCVQVMGNNAA+TF G+ GQFELNVFKPV+I+NLL+S++L+ DASRSFR+HCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420

Query: 417 AKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 476
            +I ELL +SLMLVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 477 PEKMLGP 483
           PE MLGP
Sbjct: 481 PENMLGP 487

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/460 (81%), Positives = 422/460 (91%)

Query: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83
           +RVETD FGEI+VP++KYWGAQT+RS +NFKIGG RERMPE +V+AFGVLKK AA+VN  
Sbjct: 31  YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90

Query: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143
           LG LDP  +K I+QAADEVA GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 91  LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150

Query: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203
           LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+ HLLPEL  L+ AL  KS EF+HIV
Sbjct: 151 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210

Query: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++++  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 211 KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270

Query: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323
           AE IA ++SKETG+ FKTAPNKFEALAAHDA+VEASGALNT+A SLFKIA DIRYLGSGP
Sbjct: 271 AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330

Query: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AA+TFAGASGQFELNVFK
Sbjct: 331 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390

Query: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443
           PV+ISNLLSS++LLGDAS SFR+HCVEGIKANE +I++LLH SLMLVTALNPKIGYDAA+
Sbjct: 391 PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450

Query: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
           KVAKNAHKKGITLKESALEL VL+ +EFD+WV+PEKM+GP
Sbjct: 451 KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/487 (78%), Positives = 426/487 (87%), Gaps = 4/487 (0%)

Query: 1   MLRSAIRPNTVRVQTRYISNLK----GFRVETDGFGEIKVPANKYWGAQTERSFENFKIG 56
           MLR         VQ+ Y  N++     FR ETD FGEI VPA+KYWGAQT+RSF+NFKIG
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 57  GSRERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVF 116
           G+RERMP  +V AFGVLKK AAIVN  LGGLDP  SK IQ+AADEVA+GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVF 120

Query: 117 QTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQ 176
           QTGSGTQSNMNANEVISNRAIE+ GG +GSKE+HPNNHCN +QSSNDTFPTVMHIAA  Q
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 177 ISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI 236
           I   L+PEL +L++AL AKS EF+HIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 181 IQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 237 ERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIV 296
             + + L FLAQGGTAVGTGLNTK G+  +IA +ISKETGL F+TAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 297 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 356
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 357 VCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANE 416
           VCVQVMGNNAA+TFAG+ GQFELNVFKPV+I+NLL+S++L+ DA+ SFRVHCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 417 AKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 476
            +I ELL +SLMLVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 477 PEKMLGP 483
           PE MLGP
Sbjct: 481 PENMLGP 487

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/487 (78%), Positives = 427/487 (87%), Gaps = 4/487 (0%)

Query: 1   MLRSAIRPNTVRVQTRYISNLK----GFRVETDGFGEIKVPANKYWGAQTERSFENFKIG 56
           MLR +       +Q+ Y  NL+     FR+ETD FGEI VPA+KYWGAQT+RSF+NFKIG
Sbjct: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 57  GSRERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVF 116
           G+RERMP  +V AFGVLKK AA+VN  LGGLDP  SK IQQAADEV +GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120

Query: 117 QTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQ 176
           QTGSGTQSNMNANEVISNRAIE+ GG +GSKE+HPNNHCN +QSSNDTFPTVMHIAA  Q
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 177 ISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI 236
           I   L+PELT+L++AL AKS EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 237 ERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIV 296
             + + L FLAQGGTAVGTGLNTK G+  +IA +IS ETGL F+TAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300

Query: 297 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 356
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 357 VCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANE 416
           VCVQVMGNNAA+TFAG+ GQFELNVFKPV+I+NLL+S++L+ D++ SFRVHCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420

Query: 417 AKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 476
            +I ELL +SLMLVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 477 PEKMLGP 483
           PE MLGP
Sbjct: 481 PENMLGP 487

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/484 (79%), Positives = 425/484 (87%), Gaps = 2/484 (0%)

Query: 1   MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60
           MLR++ R  T  +   Y + +  +RVETD FGEIKVPA+KYWGAQT+RSF+NFKIGG+RE
Sbjct: 1   MLRASSRAKTSLIG--YSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARE 58

Query: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120
           RMPE +VRAFGVLKK AAIVN +LG LD   +  IQQAADEVA GKLNDHFPLVVFQTGS
Sbjct: 59  RMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGS 118

Query: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180
           GTQSNMNANEVISNRAIEL GG LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  
Sbjct: 119 GTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNS 178

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           LLPE+T L+DAL  K+ EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE   
Sbjct: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238

Query: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300
            +L++LAQGGTAVGTGLNTK G+ + IA +ISKETG+ FKTAPNKFEALAAHDAIVEASG
Sbjct: 239 PHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASG 298

Query: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360
           ALNTVACSLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 299 ALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 358

Query: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420
           VMGNNAAVTFAGA+GQFELNVFKPV+ISNLLSS++LL DA  SFRVHCVEGI+AN  KI+
Sbjct: 359 VMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKIN 418

Query: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480
             LH SLMLVTALNPKIGYDAA+K+AKNA KK ITLKESALEL  LT +EFDEWV+PE M
Sbjct: 419 HNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENM 478

Query: 481 LGPS 484
           +GP+
Sbjct: 479 VGPT 482

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/487 (78%), Positives = 427/487 (87%), Gaps = 4/487 (0%)

Query: 1   MLRSAIRPNTVRVQTRYISNLK----GFRVETDGFGEIKVPANKYWGAQTERSFENFKIG 56
           MLR         V++ Y  N++     FR ETD FGEI VPA+KYWGAQT+RSF+NFKIG
Sbjct: 1   MLRFTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIG 60

Query: 57  GSRERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVF 116
           G+RERMP  +V AFGVLKK AAIVN  LGGLDP  SK IQQAADEVA+GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVF 120

Query: 117 QTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQ 176
           QTGSGTQSNMNANEVISNRAIE+ GG +GSK++HPNNHCN +QSSNDTFPTVMHIAA  Q
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 177 ISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI 236
           I   L+PELT+L++AL AKS EF+HIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 181 IQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 237 ERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIV 296
             + + L FLAQGGTAVGTGLNTK G+  +IA +ISKETGL F+TAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 297 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 356
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 357 VCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANE 416
           VCVQVMGNNAA+TFAG+ GQFELNVFKPV+I+NLL+S++L+ DA+ SFRVHCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 417 AKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 476
            +I ELL +SLMLVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 477 PEKMLGP 483
           PE MLGP
Sbjct: 481 PEHMLGP 487

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/463 (79%), Positives = 409/463 (88%)

Query: 21  LKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIV 80
           L+  RVETD FGEIKVPA+KYWGAQT+RSFENF+IGG RERMPEAVV AFG+LKK  A V
Sbjct: 41  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 100

Query: 81  NTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELK 140
           N   G LDP  +  I+QAADEVA+GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEL 
Sbjct: 101 NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 160

Query: 141 GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 200
           GG LGSK +HPNNH NM+QSSNDTFPTVMHIAAV  I++ LLP LT L+D+L  KS EF 
Sbjct: 161 GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 220

Query: 201 HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTK 260
            IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+E    +L+ LAQGGTAVGTGLNTK
Sbjct: 221 DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 280

Query: 261 NGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 320
            GWAE +AAE++KETG+ F+TAPNKFEALAAHDA+VEASGALNT+A SLFKIAQDIRYLG
Sbjct: 281 IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 340

Query: 321 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELN 380
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++A+TFAGASGQFELN
Sbjct: 341 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 400

Query: 381 VFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYD 440
           VFKPV+ISNLLSS+ LL DAS SFRVHCV+GI+AN   I++LLH SLMLVTALNPKIGYD
Sbjct: 401 VFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 460

Query: 441 AATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
           AA+KVAKNAHK GITLKESAL+L +LT +EFD WVVPE M+GP
Sbjct: 461 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/483 (75%), Positives = 418/483 (86%), Gaps = 4/483 (0%)

Query: 1   MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60
           +LR+ +R N   +    I+N + FRVETD FGEI VPA++YWGAQT+RSF+NFKIGG RE
Sbjct: 18  LLRNNLRRN---MSASAITN-QEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDRE 73

Query: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120
           ++PE VVRAFG+LKK AA VN  LG LD + +  I+ AADEVA GKL+DHFPLVVFQTGS
Sbjct: 74  KIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGS 133

Query: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180
           GTQSNMNANEVISNRAIEL GG LGSK++HPNNH N +QSSNDTFPTVMHIAA T+I+  
Sbjct: 134 GTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANK 193

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           L+PEL +L+DAL  K  EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R++ + 
Sbjct: 194 LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253

Query: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300
            +L FLAQGGTAVGTGLNTK G+ + +A E+SKETGL F+TAPNKFEALAAHDAIVEASG
Sbjct: 254 YHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASG 313

Query: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360
           ALNT+ACSLFKIAQDIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 314 ALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQ 373

Query: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420
           VMGNN+ +TFAG+ GQFELNV+KP++ISNLLSS++LL DAS+SFR+HC+  +KAN+ KI 
Sbjct: 374 VMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKID 433

Query: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480
           E L++SLMLVTALNPKIGYDAA KVAKNAH K ITLKESALELGVLTEKEFDEWV+PE M
Sbjct: 434 ENLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENM 493

Query: 481 LGP 483
           + P
Sbjct: 494 ISP 496

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/483 (73%), Positives = 414/483 (85%), Gaps = 7/483 (1%)

Query: 8   PNTVRVQTRYIS-------NLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60
           P  +R+Q   +S       + + +R+ETD FGEIKVPA+KYWGAQT+RSF+NFKIGGSRE
Sbjct: 9   PTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRE 68

Query: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120
           R+P+ ++ AFG+LKK AAIVN  LG LDP  +  I++AADEV  GKL DHFPLVVFQTGS
Sbjct: 69  RIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGS 128

Query: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180
           GTQ+NMN NEVISNRAIEL GG LGSK+IHPNNHCN +QSSNDTFP+VMHIAAV +I+  
Sbjct: 129 GTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNS 188

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           L+PELT L+DAL  K+ EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE + 
Sbjct: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248

Query: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300
            +L+FLAQGGTAVGTGLNTK G+ + IA E+SKETG+ FKTAPNKFEALAAHDAIV ASG
Sbjct: 249 YHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASG 308

Query: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360
           ALNTVA SLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 309 ALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 368

Query: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420
           +MGNN  ++ AG+ GQFELNV+KP++I+NLL+S++L+ DA +SFR+HC++ +KAN+ KI+
Sbjct: 369 IMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKIN 428

Query: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480
           E L++SLMLVTALNPKIGYDAA+K+AKNAH K ITLKESALEL  LT +EFDEWVVPE M
Sbjct: 429 ENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENM 488

Query: 481 LGP 483
           +GP
Sbjct: 489 IGP 491

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/460 (76%), Positives = 403/460 (87%)

Query: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83
           FR ETD FGEI VP +KYWGAQT+RS +NFKIGG RE++P  ++ AFG+LKK AAIVN  
Sbjct: 34  FRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNER 93

Query: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143
           LG LD   +K I  AADEV+ GKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 94  LGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGK 153

Query: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203
           LGSK +HPNNH N +QSSNDTFPTVMHIAA+ +I++ LLPEL  L+++L  KS EF  IV
Sbjct: 154 LGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIV 213

Query: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263
           KIGRTHLQDATPLTLGQEFSGYVQQ+TNGI RIE A  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 214 KIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGF 273

Query: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323
            + IA +IS+ETG+ F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 274 DKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGP 333

Query: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ +TFAG+ GQFELNV+K
Sbjct: 334 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYK 393

Query: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443
           P+LISNLLSS++LL DAS SFRVHC++G+KAN   I+E L++SLMLVTALNP IGYD A+
Sbjct: 394 PLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNAS 453

Query: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
           K+AKNAH K ITLKESALELG+LTE++F EWV+PEKM+GP
Sbjct: 454 KIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/484 (70%), Positives = 403/484 (83%)

Query: 1   MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60
           + R+  R  ++   +  I++L+G R ETD FGEI+VPANKYWGAQT+RSF NFKIGG RE
Sbjct: 17  IFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERE 76

Query: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120
           RMPE ++RAFG  KK AAIVN  LG LD      I QAA+EV+ G LN+HFPLVVFQTGS
Sbjct: 77  RMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGS 136

Query: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180
           GTQSNMNANEVISNRAIEL GG LGSK++HPNNH N +QSSNDTFPTVMHIAA+T+I+  
Sbjct: 137 GTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNT 196

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           LLP L  LR+ L +K+ EFE I+KIGRTHLQDATPLTLGQEFSGY QQLTN I+RIE+  
Sbjct: 197 LLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNL 256

Query: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300
             L+++AQGGTAVGTGLNTK G+AE+ A ++S +T L+F T+PNKFE+LAAHDAIV    
Sbjct: 257 PELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHA 316

Query: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360
           +LNT+ACSLFKI+QDIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQ
Sbjct: 317 SLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQ 376

Query: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420
           VMGNN+ ++FAGASGQFELN +KP++I+NLLSS +LL DA  SF +HC  GI+AN+ KI 
Sbjct: 377 VMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKID 436

Query: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480
            LLH SLMLVT+LNPKIGYDAA+KVAKNAH KGITLK+SALEL +L+ K+FDEWV PE M
Sbjct: 437 RLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENM 496

Query: 481 LGPS 484
           LGP+
Sbjct: 497 LGPN 500

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/460 (72%), Positives = 395/460 (85%)

Query: 25  RVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTEL 84
           R+E DGFGE++VPANKYWGAQT+R+  NF IGG RERMPE ++ A+G+LKK  AIVN  L
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 85  GGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGVL 144
           G LDP  SK IQ+AADEVA G LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE+ GG L
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 145 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVK 204
           GSK +HPNNH N +QS+ND+FPT MHI+AV ++   LLPEL  LRDAL  KS EF  IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 205 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWA 264
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ +  NL+F+AQGGTAVGTG+NTK  + 
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 265 ERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPR 324
             +A +IS ETG+ FKTAPNKFEALA+HDAIVE SGALNT+ACSLFKI+QDIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 325 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFKP 384
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+A+TFAGASGQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 385 VLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAATK 444
           ++ISNLL+S++LL D+  SFR+HC+ GI+ANE KI++LL+ SLMLVTALNPKIGYDAAT 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 445 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 484
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE M+ PS
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPS 464

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/465 (73%), Positives = 407/465 (87%)

Query: 19  SNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAA 78
           SN   FRVETD FGEIKVP+NKYWGAQT+RSF+NFKIGG RE++P  +++AFG+LKK AA
Sbjct: 9   SNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAA 68

Query: 79  IVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 138
           IVN  LG LDP+ +  I +A+DEV  GKLNDHFPLVVFQTGSGTQ+NMNANEVISNRA E
Sbjct: 69  IVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANE 128

Query: 139 LKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAE 198
           L G  LGSK+IHPNNH N +QSSNDTFP+VMHIAAV +++ +L+P+LT L+++L  K+ E
Sbjct: 129 LIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKE 188

Query: 199 FEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLN 258
           + +IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI+ +  +L+FLAQGGTAVGTGLN
Sbjct: 189 YANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLN 248

Query: 259 TKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRY 318
           TK G+ + IA E+SKETG+ F+TAPNKFEALAAHDAIV AS A+ TVA SLFKIAQDIRY
Sbjct: 249 TKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRY 308

Query: 319 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFE 378
           LGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  +  AG+ GQFE
Sbjct: 309 LGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368

Query: 379 LNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIG 438
           LNV+KP++I+NLL+S++L+ DA  SF++HCV+G+KAN  KI+E LH+SLMLVTALNPKIG
Sbjct: 369 LNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIG 428

Query: 439 YDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483
           YDAA+K+AKNAH K ITLKESALELG+LTE+EFD+WV+PE M+GP
Sbjct: 429 YDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 90/216 (41%), Gaps = 17/216 (7%)

Query: 155 CNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDAT 214
            +  +S ND   T M I     ++  +LP L+ L   +  ++ E   ++  G THLQ A 
Sbjct: 107 VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQ 166

Query: 215 PLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVG---TGLNTKNGWAERIAAEI 271
           P+      S Y    T   +R+++  + L     G  A+     G++      E +AA  
Sbjct: 167 PIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALAGHPYGIDR-----EFLAA-- 219

Query: 272 SKETGLAFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGEL 330
               GL F     N   A+A  D +VE     +     + + A+D+  + S    G+ +L
Sbjct: 220 ----GLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQL 274

Query: 331 SLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 366
           S      GSS+MP K NP   E +     +V G  A
Sbjct: 275 S-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLA 309

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 93/239 (38%), Gaps = 13/239 (5%)

Query: 127 NANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELT 186
           +AN+   + A E + G L  ++I    H    +S ND   T + I     ++  L P + 
Sbjct: 82  HANDEDIHTANERRLGELIGRDIAGKVHT--GRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 187 HLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFL 246
            L D L  ++     I+  G THLQ A P+      S Y    T   E  +R  Q L  L
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFT---EDYKRLVQILHRL 196

Query: 247 AQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTA-PNKFEALAAHDAIVEASGALNTV 305
            Q     G       G      AE     GL F +   N   A++  D IVE        
Sbjct: 197 NQSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 306 ACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 364
              + + A+D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 84/211 (39%), Gaps = 11/211 (5%)

Query: 158 AQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLT 217
            +S ND   T + I     +++ L P +T L + L  ++ E   I+  G THLQ A P+ 
Sbjct: 111 GRSRNDQCVTDLRIYCRDVLNEKLFPGMTSLIEVLIKRAEEEIDILMPGYTHLQRAQPIR 170

Query: 218 LGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGL 277
                S Y    T   E ++R +Q L    +     G       G      AE     GL
Sbjct: 171 WSHWLSSYATYFT---EDLKRLKQILERFNKSPLGAGALAGHPYGIDREFLAE-----GL 222

Query: 278 AFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENE 336
            F     N   A++  D +VE           + + A+D+  + S    G+ +LS     
Sbjct: 223 GFDGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-VIYSTAEFGFIKLS-DAYS 280

Query: 337 PGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 367
            GSS+MP K N    E +     +V G+ A 
Sbjct: 281 TGSSLMPQKKNADSLELLRGKSGRVFGDLAG 311

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 82/207 (39%), Gaps = 11/207 (5%)

Query: 159 QSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTL 218
           +S ND   T + I     ++ +L P L  L D L  ++    +I+  G THLQ A P+  
Sbjct: 112 RSRNDQVVTDLRIYCRDVVNDNLFPALKGLVDVLIKRAKGEINILMPGYTHLQRAQPIRW 171

Query: 219 GQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLA 278
               S Y    T   +R++   Q L  L Q     G       G      AE     GL 
Sbjct: 172 SHWLSSYATYFTEDYKRLD---QILHRLNQSPLGAGALAGHPYGIDREFLAE-----GLG 223

Query: 279 FKTA-PNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEP 337
           F +   N   A++  D IVE           + + A+D+  +      G+ +LS      
Sbjct: 224 FNSVIGNSMVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYST 281

Query: 338 GSSIMPGKVNPTQNEAMTQVCVQVMGN 364
           GSS+MP K N    E +     +V G+
Sbjct: 282 GSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 90/224 (40%), Gaps = 14/224 (6%)

Query: 141 GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 200
           G ++G +EI    H    +S ND   T M I     +++ LLP L      L  ++ E  
Sbjct: 98  GEIIG-REISGKVHT--GRSRNDQVATDMRIYCRDILNEVLLPALQAFIKVLTTRAKEEI 154

Query: 201 HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTK 260
            ++  G THLQ A P+      S Y    T    R+++  + L     G  A+       
Sbjct: 155 DVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALA------ 208

Query: 261 NGWAERIAAEISKETGLAFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYL 319
            G    I  E     GL F+    N   A++  D +VE           + + ++D+  +
Sbjct: 209 -GHPYGIDREFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL-II 265

Query: 320 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 363
            S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 266 YSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           L+P+L ++ D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT    G+ L   +   +++ A   + T  L F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 93/229 (40%), Gaps = 13/229 (5%)

Query: 136 AIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAK 195
           A E + G L  ++I    H    +S ND   T M I     +++ + P +  L + L  +
Sbjct: 92  ANERRLGELIGRDIAGKVHT--GRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNR 149

Query: 196 SAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGT 255
           + +   I+  G THLQ A P+      S Y    T  ++R+E+  + L     G  A+  
Sbjct: 150 AEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA- 208

Query: 256 GLNTKNGWAERIAAEISKETGLAFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQ 314
                 G   +  AE     GL F     N   A++  D +VE           + + ++
Sbjct: 209 --GHPYGIDRQFLAE-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSE 261

Query: 315 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 363
           D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 262 DL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++     + T  L F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 86/183 (46%), Gaps = 13/183 (7%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNEAMT 355
               L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E   
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE--- 299

Query: 356 QVC 358
           +VC
Sbjct: 300 RVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 85/181 (46%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A  ++ T  L F           +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 84/186 (45%), Gaps = 19/186 (10%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ D LA  ++E++ +  +G TH Q A   T+G+  + ++Q+L   +    RA+
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--------AVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAH 292
            ++      GT        A+  G + K    ++   E+     L F T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVEL-----LGFDTVYPVTGQTYSR 242

Query: 293 DAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 352
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 353 AMTQVC 358
              +VC
Sbjct: 300 ---RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 83/181 (45%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L + A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 86/184 (46%), Gaps = 15/184 (8%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           L+P+L ++ + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG--LAFKTAPNKFEALAAHDAIV 296
            ++      GT     + L   +G  +++ A + K     L F T         +    +
Sbjct: 188 NDIGLRGVKGTTGTQASFLTLFHGDHDKVEA-LDKRVAELLGFSTVYPVTGQTYSRKIDI 246

Query: 297 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNEAM 354
           +    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E  
Sbjct: 247 DVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 355 TQVC 358
            +VC
Sbjct: 300 -RVC 302

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 85/218 (38%), Gaps = 11/218 (5%)

Query: 150 HPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTH 209
           H     +  +S ND   T M I     +++ LLP +  L   L  ++      +  G TH
Sbjct: 103 HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTH 162

Query: 210 LQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAA 269
           LQ A P+      S Y    T   +R+++  + L     G  A+        G    I  
Sbjct: 163 LQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA-------GHPYGIDR 215

Query: 270 EISKETGLAF-KTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYG 328
           E   E GL F     N   A++  D +VE           + + A+D+  + S    G+ 
Sbjct: 216 EFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFV 273

Query: 329 ELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 366
           +LS      GSS+MP K N    E +     +V G+ A
Sbjct: 274 KLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F           +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ D L+  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 85/214 (39%), Gaps = 17/214 (7%)

Query: 158 AQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLT 217
            +S ND   T + I     ++  L P+L  L D +  +  E   ++  G THLQ A P+ 
Sbjct: 111 GRSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEIDVLMPGYTHLQRAQPIR 170

Query: 218 LGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVG---TGLNTKNGWAERIAAEISKE 274
                S Y    T   +R+ +    +     G  A+     G++      E +AA     
Sbjct: 171 WSHWLSSYATYFTEDFKRLRQIMDRINQSPLGAGALAGHPYGIDR-----EFLAA----- 220

Query: 275 TGLAFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP 333
            GL F     N   A++  D IVE           + + A+D+  + S    G+ +L+  
Sbjct: 221 -GLGFDGVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-D 277

Query: 334 ENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 367
               GSS+MP K N    E +     +V G+ A 
Sbjct: 278 AYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAG 311

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F           +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 86/207 (41%), Gaps = 11/207 (5%)

Query: 159 QSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTL 218
           +S ND   T + I     +++ L P LT L   L  +  E   I+  G THLQ A P+  
Sbjct: 112 RSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVLIKRGEEEIDILMPGYTHLQRAQPIRW 171

Query: 219 GQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLA 278
               S Y    T  + R++  Q  +RF     + +G G    + +   I  E   E GL 
Sbjct: 172 SHWLSSYATYFTEDLNRLK--QILVRF---NKSPLGAGALAGHPYG--IDREFLAE-GLE 223

Query: 279 FK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEP 337
           F     N   A++  D +VE           + + A+D+  + S    G+ +L+      
Sbjct: 224 FNGVIGNSLVAVSDRDFVVELMFWSTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYST 281

Query: 338 GSSIMPGKVNPTQNEAMTQVCVQVMGN 364
           GSS+MP K N    E +     +V G+
Sbjct: 282 GSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 88/230 (38%), Gaps = 13/230 (5%)

Query: 136 AIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAK 195
           A E + G L  ++I    H    +S ND   T + I     ++  L P L  L D L  +
Sbjct: 91  ANERRLGELIGRDIAGKVHT--GRSRNDQVVTDLRIYCRDVVNGTLFPALKGLVDVLIKR 148

Query: 196 SAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGT 255
           +     I+  G THLQ A P+      S Y    T   E  +R  Q L  L Q     G 
Sbjct: 149 AEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFT---EDYKRLGQILHRLNQSPLGAGA 205

Query: 256 GLNTKNGWAERIAAEISKETGLAFKTA-PNKFEALAAHDAIVEASGALNTVACSLFKIAQ 314
                 G      AE     GL F +   N   A++  D IVE           + + A+
Sbjct: 206 LAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAE 260

Query: 315 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 364
           D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 261 DL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           L+P+L ++ + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 83/181 (45%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F           +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A +  K+A DIR L +       E    + + GSS M  K NP + E   +V
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 86/188 (45%), Gaps = 23/188 (12%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           L+P+L ++ + L+  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--------AVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAH 292
            ++ F    GT        A+  G + K    ++  AE+S      F           + 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAELS-----GFDIIYPVTGQTYSR 242

Query: 293 DAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQ 350
              ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  K NP +
Sbjct: 243 KVDIDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYKRNPMR 297

Query: 351 NEAMTQVC 358
            E   +VC
Sbjct: 298 CE---RVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 82/181 (45%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            +L      GT     + L   +G  +++     + T  L F T         +    ++
Sbjct: 188 NDLGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L + A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 82/206 (39%), Gaps = 11/206 (5%)

Query: 159 QSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTL 218
           +S ND   T M I     +++ +LP ++     L  ++ E   ++  G THLQ A P+  
Sbjct: 112 RSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREEVDVLMPGYTHLQRAQPIRW 171

Query: 219 GQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLA 278
               S Y    T   E   R +Q +  L Q     G       G   +  AE     G+ 
Sbjct: 172 SHWLSCYATYFT---EDYNRLRQVVERLNQSPLGAGALAGHPYGIDRKYLAEQLGFNGI- 227

Query: 279 FKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPE-NEP 337
                N   A++  D ++E     +     + + A+D+    +     +G ++L +    
Sbjct: 228 ---IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLIIYSTAE---FGFINLADAYST 281

Query: 338 GSSIMPGKVNPTQNEAMTQVCVQVMG 363
           GSS+MP K NP   E +     +V G
Sbjct: 282 GSSLMPQKKNPDSLELLRGKSGRVFG 307

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 88/218 (40%), Gaps = 11/218 (5%)

Query: 150 HPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTH 209
           H +   +  +S ND   T M +     +   + P L  L   L  ++ E   ++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 210 LQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWA-ERIA 268
           LQ A P+      S Y    T  +E  +R ++ +  L Q     G       G   E +A
Sbjct: 163 LQRAQPIRWSHWLSCYA---TYFVEDFKRLKEVIARLNQSPLGAGALAGHPYGIDREYLA 219

Query: 269 AEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYG 328
            E+  +  +      N   A++  D +VE     +     + ++A+D+  + S    G+ 
Sbjct: 220 CELGFDGVIG-----NSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFV 273

Query: 329 ELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 366
           +L+      GSS+MP K NP   E +     +V G  A
Sbjct: 274 KLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLA 310

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 83/213 (38%), Gaps = 11/213 (5%)

Query: 155 CNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDAT 214
            +  +S ND   T M I     +++ LLP L  L   +  ++ +    +  G THLQ A 
Sbjct: 108 VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIGYLMPGYTHLQRAQ 167

Query: 215 PLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKE 274
           P+      S Y    T   E ++R +Q L    Q     G       G      AE    
Sbjct: 168 PIRWSHWLSSYATYFT---EDLKRLRQLLERFNQSPLGAGALAGHPYGIDREFLAE---- 220

Query: 275 TGLAFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP 333
             L F+    N   A++  D +VE           + + A+D+  + S    G+ +L+  
Sbjct: 221 -ELGFQGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-D 277

Query: 334 ENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 366
               GSS+MP K N    E +     +V G+ A
Sbjct: 278 AYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 81/181 (44%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ D L+  +  ++ +  +G TH Q A   TLG+  + ++Q L   +   +RA+
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++     + T  L F+T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L + A +  K+A DIR L +       E    + + GSS M  K NP + E   +V
Sbjct: 248 VLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 88/230 (38%), Gaps = 13/230 (5%)

Query: 136 AIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAK 195
           A E + G L  ++I    H    +S ND   T + I     ++  L P L  L + L  +
Sbjct: 91  ANERRLGELIGRDIAGKVHT--GRSRNDQVVTDLRIYCRDIVNDTLFPALKGLVEVLIKR 148

Query: 196 SAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGT 255
           +     ++  G THLQ A P+      S Y    T   E  +R  Q L  L Q     G 
Sbjct: 149 AEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFT---EDYKRLGQILHRLNQSPLGAGA 205

Query: 256 GLNTKNGWAERIAAEISKETGLAFKTA-PNKFEALAAHDAIVEASGALNTVACSLFKIAQ 314
                 G      AE     GL F +   N   A++  D IVE           + + A+
Sbjct: 206 LAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAE 260

Query: 315 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 364
           D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 261 DL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 89/225 (39%), Gaps = 14/225 (6%)

Query: 141 GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 200
           G ++G+K    +   +  +S ND   T + I     +S  LL  L  L + L  ++ E  
Sbjct: 97  GEIIGTK---ISGKVHTGRSRNDQCVTDLRIYCREYLSDKLLKNLETLINVLINRAEEEI 153

Query: 201 HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTK 260
             +  G THLQ A P+      S Y        +R+ + ++ L     G  A+       
Sbjct: 154 EFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSPLGAGALA------ 207

Query: 261 NGWAERIAAEISKETGLAFKTAP-NKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYL 319
            G    I  E   E  L F +   N   A++  D +VE           + + A+D+  +
Sbjct: 208 -GHPYGIDREYLAEK-LGFDSVIGNSLVAVSDRDFVVEILFWSTLFMNHISRFAEDL-II 264

Query: 320 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 364
            S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 265 YSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 94/203 (46%), Gaps = 13/203 (6%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG--LAFKTAPNKFEALAAHDAIV 296
            ++      GT     + L   +G  +++  E+ +     L F T         +    +
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV-EELDERVVELLGFDTVYPVTGQTYSRKIDI 246

Query: 297 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 356
           +    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E   +
Sbjct: 247 DVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---R 300

Query: 357 VC--VQVMGNNAAVTFAGASGQF 377
           VC   + +G+  + T   AS Q+
Sbjct: 301 VCSLARHLGSLLSDTVQTASVQW 323

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 77/208 (37%), Gaps = 11/208 (5%)

Query: 158 AQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLT 217
            +S ND   T + I     I   LLP L  L   L  +      I+  G THLQ A P+ 
Sbjct: 109 GRSRNDQCVTDLRIYCRDIIQDKLLPSLKSLIQVLVKRGEGEIGILMPGYTHLQRAQPIR 168

Query: 218 LGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGL 277
                S Y    T   +R+++    L     G  A+        G    I  E     GL
Sbjct: 169 WSHWLSSYATYFTEDYKRLKQLLDRLNVSPLGAGALA-------GHPYGIDREFLA-NGL 220

Query: 278 AFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENE 336
            F     N   A++  D +VE           + + A+D+  + S    G+  LS     
Sbjct: 221 GFNGVIGNSLVAVSDRDFVVELLFWGTLFMNHISRFAEDL-IIYSTAEFGFITLS-DAYS 278

Query: 337 PGSSIMPGKVNPTQNEAMTQVCVQVMGN 364
            GSS+MP K N    E +     +V GN
Sbjct: 279 TGSSLMPQKKNSDSLELLRGKSGRVFGN 306

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 83/181 (45%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           L+P+L ++ + L+  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L + A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 84/181 (46%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ + L+  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
               L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248 VLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 89/226 (39%), Gaps = 18/226 (7%)

Query: 141 GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 200
           G ++G+   H     +  +S ND   T + I     + + LLP +  L   +  ++    
Sbjct: 97  GEIIGT---HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEI 153

Query: 201 HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVG---TGL 257
            I+  G THLQ A P+      S Y    T   +R+++  + L     G  A+     G+
Sbjct: 154 DILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIAGHPYGI 213

Query: 258 NTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIR 317
           + +          +S E G       N   A++  D IV+           + + ++D+ 
Sbjct: 214 DRQY---------LSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL- 262

Query: 318 YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 363
            + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 263 IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 83/186 (44%), Gaps = 19/186 (10%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           L+P+L ++ + L   +   + +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 241 QNLRFLAQGGT--------AVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAH 292
            ++      GT        A+  G + K    E++   + +  G  F T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNK---VEKLDERVVELLG--FDTVYPVTGQTYSR 242

Query: 293 DAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 352
              ++A   L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 353 AMTQVC 358
              +VC
Sbjct: 300 ---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 82/181 (45%), Gaps = 9/181 (4%)

Query: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240
           ++P+L ++ + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 241 QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 297
            ++      GT     + L   +G  +R+ A   + T  L F           +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKIDID 247

Query: 298 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 357
             G+ ++   +  K+A DIR L +       E    + + GSS M  K NP + E   +V
Sbjct: 248 ILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE---RV 301

Query: 358 C 358
           C
Sbjct: 302 C 302

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 93/230 (40%), Gaps = 26/230 (11%)

Query: 150 HPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTH 209
           H     +  +S ND   T M I     +  +L   L  L  A+  +S +    +  G TH
Sbjct: 105 HIAGKVHTGRSRNDQVATDMRIYCREALD-NLAKILEDLIGAILQRSEQEIDALMPGYTH 163

Query: 210 LQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVG---TGLNTKNGWAER 266
           LQ A P+      + Y    T   +R+++ ++ L     G  A+     G++ +   AER
Sbjct: 164 LQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGID-REFLAER 222

Query: 267 IAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLF-----KIAQDIRYLGS 321
           +    S   G       N  +A++  D +VE         CSLF     + ++D+  + S
Sbjct: 223 LG--FSDVIG-------NSLQAVSDRDFVVEI-----MFWCSLFMNHISRFSEDL-IIYS 267

Query: 322 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFA 371
                + +LS      GSS+MP K NP   E +     +V G+ A    +
Sbjct: 268 TAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGSLAGFMMS 316

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 111/279 (39%), Gaps = 34/279 (12%)

Query: 94  LIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNN 153
           L Q+  DE+  G       ++  +  S +    + +E I        G ++G    H   
Sbjct: 57  LTQEELDEIHRG-----LEIIRGEWASNSFVEKDGDEDIHTANERRLGEIIGR---HIAG 108

Query: 154 HCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDA 213
             +  +S ND   T M I     +  ++   L  L  A+  ++ +    +  G THLQ A
Sbjct: 109 KVHTGRSRNDQVATDMRIYCREALD-NMAKILKDLVGAILQRAEQEIDALMPGYTHLQRA 167

Query: 214 TPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVG---TGLNTKNGWAERIAAE 270
            P+      + Y    T   +R+++ ++ L     G  A+     G++ ++  AER+  +
Sbjct: 168 QPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDREH-IAERLGFD 226

Query: 271 ISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLF-----KIAQDIRYLGSGPRC 325
                        N  +A++  D +VE         CSLF     + ++D+  + S    
Sbjct: 227 ---------GVIGNSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEF 271

Query: 326 GYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 364
            + +LS      GSS+MP K NP   E +     +V G+
Sbjct: 272 NFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 78  AIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 137
           A+ + EL   DP  +K + + +D+  +G     F L     G G ++  +  E   N+ +
Sbjct: 643 AMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNKEL 702

Query: 138 ELKGG-----VLGSKEIH-PNNHCNMAQSS 161
           E K G      L +K  H PN H N A+SS
Sbjct: 703 EHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 170 HIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQ 211
           H   +TQ+ Q    +LT L+D LAA+  E E  VK  RT LQ
Sbjct: 696 HEQQITQVKQTYNDQLTELQDKLAAEEKELE-AVKRERTRLQ 736

>Ecym_4452 Chr4 complement(923429..927094) [3666 bp, 1221 aa] {ON}
           similar to Ashbya gossypii ADR029W
          Length = 1221

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 112 PLVVFQTG--SGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVM 169
           P++    G  S ++ N        N  + +  GV  SK++ PN +C      N+T PT  
Sbjct: 272 PILTISCGEQSASEFNFYKTRFSINVVVGIPYGVFDSKKLLPNKNCIRVDKDNNTTPTPF 331

Query: 170 HIAAVTQISQH 180
           +  +V   S H
Sbjct: 332 YNFSVLSCSTH 342

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 20/102 (19%)

Query: 367 AVTFAGASGQF--ELNVFKPVLISNLLSSVQL----LGDASRSFRVHCVE-----GIKAN 415
           A+ + G +G     L V   VLI+ L+  + +    LG   R  +   ++      ++ N
Sbjct: 369 AIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKN 428

Query: 416 EAKISELLHRSLMLVTALNP--------KIGYDAATKVAKNA 449
           E KI  + HR LML   L P          GYD   K+ KNA
Sbjct: 429 EIKIQNV-HRPLMLPNELTPFEIKFENVTFGYDKERKILKNA 469

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1162

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 13/72 (18%)

Query: 26  VETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFG------------VL 73
           ++TD    IKVP N+  G Q  RS + ++  G   R+PE + ++FG            +L
Sbjct: 52  LKTDLETGIKVPLNETEGTQNHRSTDRYRKYGDN-RIPERLPKSFGKLIWEAFNDKTMLL 110

Query: 74  KKCAAIVNTELG 85
              AAIV+  LG
Sbjct: 111 LTAAAIVSFALG 122

>KLLA0D10956g Chr4 complement(934074..935738) [1665 bp, 554 aa] {ON}
           uniprot|P54111 Kluyveromyces lactis GPA2 Guanine
           nucleotide-binding protein alpha-2 subunit
          Length = 554

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%)

Query: 378 ELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELL 423
           EL  +KP +  N++ + + L  A R+F V   E  + +E+ + ELL
Sbjct: 261 ELLEYKPFIFDNIIETGKDLAKARRTFNVQLEEDAEISESDLDELL 306

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 78  AIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 137
           A+ + EL   DP   K + + +D+  +G     F L     G G ++  +  E + N+ +
Sbjct: 641 AMRDDELKASDPLQVKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEVRNKDL 700

Query: 138 ELKGGVLGSKEI------HPNNHCNMAQSS 161
           ELK G + + E+        N H +  +SS
Sbjct: 701 ELKKGNINNDELGHKSDRTQNEHVSEPESS 730

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,707,459
Number of extensions: 1863187
Number of successful extensions: 4752
Number of sequences better than 10.0: 72
Number of HSP's gapped: 4870
Number of HSP's successfully gapped: 72
Length of query: 485
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 371
Effective length of database: 40,409,475
Effective search space: 14991915225
Effective search space used: 14991915225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)