Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.766.13ON48548524660.0
Kpol_1032.46.13ON46746220890.0
SAKL0E00946g6.13ON49346020100.0
TPHA0J002706.13ON49646820000.0
TDEL0G045806.13ON48446019850.0
KLTH0C11462g6.13ON49247419780.0
Kwal_56.223626.13ON49346019760.0
Ecym_30166.13ON48947719740.0
ACR013C6.13ON48846019690.0
Suva_16.436.13ON48847919670.0
YPL262W (FUM1)6.13ON48847519610.0
Smik_6.4706.13ON48847519600.0
Skud_16.166.13ON48847519590.0
KLLA0D00902g6.13ON49246019590.0
CAGL0A01045g6.13ON48348419570.0
ZYRO0C07964g6.13ON50546319100.0
KNAG0E027506.13ON49848318700.0
NCAS0D026206.13ON49347818460.0
KAFR0B065206.13ON49546718350.0
NDAI0I024706.13ON47546518120.0
TBLA0A071306.13ON50048417920.0
TBLA0G010006.13ON46546017810.0
KLLA0A08404g1.354ON4612091125e-05
SAKL0D09746g1.354ON4642291125e-05
Kwal_47.180664.197ON4823221116e-05
NDAI0J019504.197ON4823241091e-04
CAGL0B02794g4.197ON4821751091e-04
CAGL0I08987g1.354ON4612291081e-04
Skud_12.4434.197ON4821751072e-04
KLLA0B13189g4.197ON4821781063e-04
Kpol_1042.164.197ON4822211063e-04
KNAG0B058404.197ON4821751063e-04
Suva_10.4594.197ON4821751063e-04
YLR359W (ADE13)4.197ON4821751063e-04
SAKL0B04972g4.197ON4821751053e-04
NCAS0J012004.197ON4821751053e-04
Smik_12.4464.197ON4821751053e-04
Ecym_24524.197ON4821821044e-04
KNAG0I015601.354ON4622181036e-04
Ecym_27491.354ON4702861028e-04
AEL019W1.354ON4692181010.001
TPHA0B010404.197ON4821751010.001
Kpol_1018.1251.354ON4602651000.001
TPHA0A021901.354ON4632241000.001
TDEL0D022201.354ON4652091000.001
TBLA0A083204.197ON4822051000.001
TDEL0E017604.197ON482175980.002
ZYRO0B07964g4.197ON482175980.002
ZYRO0G00748g1.354ON462208970.003
KLTH0A03344g4.197ON482175960.004
KAFR0A062304.197ON482180950.005
ABL006C4.197ON482175930.010
TBLA0F034801.354ON466224910.016
Kwal_27.127821.354ON465217860.066
KLTH0G19338g1.354ON465277830.15
Suva_4.4946.148ON85090820.23
Ecym_44523.426ON122171751.7
Skud_2.3696.148ON84890732.7
TBLA0B068102.610ON103196714.8
Kpol_513.235.20ON708102706.1
Skud_7.4413.492ON80742706.2
KNAG0D034804.117ON116272706.5
ZYRO0C02332g3.58ON53161697.5
TBLA0B089002.383ON69383697.9
KNAG0E003407.39ON902182698.3
KNAG0J016208.659ON453125689.6
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Kpol_1045.76
         (1458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   954   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   809   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   778   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   775   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   769   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   766   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   765   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   764   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   763   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   762   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   759   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   759   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   759   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   759   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   758   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   740   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   724   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   715   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   711   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   702   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   694   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   690   0.0  
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    48   5e-05
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    48   5e-05
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    47   6e-05
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    47   1e-04
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    47   1e-04
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    46   1e-04
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    46   2e-04
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    45   3e-04
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    45   3e-04
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    45   3e-04
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    45   3e-04
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    45   3e-04
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    45   3e-04
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    45   3e-04
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    45   3e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    45   4e-04
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    44   6e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    44   8e-04
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    44   0.001
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    44   0.001
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    43   0.001
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    43   0.001
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    43   0.001
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    43   0.001
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    42   0.002
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    42   0.002
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    42   0.003
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    42   0.004
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    41   0.005
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    40   0.010
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    40   0.016
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    38   0.066
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    37   0.15 
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    36   0.23 
Ecym_4452 Chr4 complement(923429..927094) [3666 bp, 1221 aa] {ON...    33   1.7  
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...    33   2.7  
TBLA0B06810 Chr2 (1607954..1611049) [3096 bp, 1031 aa] {ON} Anc_...    32   4.8  
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...    32   6.1  
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    32   6.2  
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    32   6.5  
ZYRO0C02332g Chr3 complement(188031..189626) [1596 bp, 531 aa] {...    31   7.5  
TBLA0B08900 Chr2 complement(2110882..2112963) [2082 bp, 693 aa] ...    31   7.9  
KNAG0E00340 Chr5 (49652..52360) [2709 bp, 902 aa] {ON} Anc_7.39 ...    31   8.3  
KNAG0J01620 Chr10 (298427..299788) [1362 bp, 453 aa] {ON} Anc_8....    31   9.6  

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] {ON}
            complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  954 bits (2466), Expect = 0.0
 Identities = 485/485 (100%), Positives = 485/485 (100%)
 Frame = +1

Query: 1    MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 180
            MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE
Sbjct: 1    MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60

Query: 181  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 360
            RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS
Sbjct: 61   RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120

Query: 361  GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 540
            GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH
Sbjct: 121  GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ
Sbjct: 181  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240

Query: 721  QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 900
            QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG
Sbjct: 241  QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300

Query: 901  ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 1080
            ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 301  ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360

Query: 1081 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 1260
            VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS
Sbjct: 361  VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420

Query: 1261 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 1440
            ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM
Sbjct: 421  ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480

Query: 1441 LGPSS 1455
            LGPSS
Sbjct: 481  LGPSS 485

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
            [1404 nt, 468 aa]
          Length = 467

 Score =  809 bits (2089), Expect = 0.0
 Identities = 403/462 (87%), Positives = 433/462 (93%)
 Frame = +1

Query: 67   GFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNT 246
            GFR+ETDGFGEIKVPA+KYWGAQT+RS+ENFKIGG RERMPE VV+AFGVLKK AAIVN 
Sbjct: 6    GFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNE 65

Query: 247  ELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 426
            E G LD   SKLIQQAADEV  GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIELKGG
Sbjct: 66   EFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 125

Query: 427  VLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHI 606
            ++GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVT+I+ HL+P++T L+DALA KS EFEHI
Sbjct: 126  IMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHI 185

Query: 607  VKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNG 786
            VKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE +  NL+FLAQGGTAVGTGLNTK G
Sbjct: 186  VKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIG 245

Query: 787  WAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSG 966
            +AERIA ++SKETG+ FKTAPNKFEALAAHDAIVE+SGALNTVACSLFKIAQDIRYLGSG
Sbjct: 246  FAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSG 305

Query: 967  PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVF 1146
            PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVF
Sbjct: 306  PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 365

Query: 1147 KPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAA 1326
            KPV+ISNLLSS++LLGDA  SF +HCVEGI+ANE KI++LLH SLMLVTALNPKIGYD+A
Sbjct: 366  KPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSA 425

Query: 1327 TKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 1452
            TKVAKNAHKKGITLKESALELGVLTE EFDEWVVPEKMLGPS
Sbjct: 426  TKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 493

 Score =  778 bits (2010), Expect = 0.0
 Identities = 388/460 (84%), Positives = 423/460 (91%)
 Frame = +1

Query: 70   FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 249
            +R+ETD FGEIKVPA+KYWGAQT+RSFENFKIGG+RERMPEAVVRAFGVLKK AAIVN  
Sbjct: 32   YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 91

Query: 250  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 429
            LG LDP  SK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 92   LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 151

Query: 430  LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 609
             GSK++HPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT LRD+   KS EF  IV
Sbjct: 152  KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 211

Query: 610  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 789
            KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E++  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 212  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 271

Query: 790  AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 969
            AE+IA ++SKETG+ FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 272  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 970  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 1149
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 332  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 1150 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 1329
            PV+ISNLLSSV+LL DAS SFRVHCV+GIKANE +IS+LLH SLMLVTALNPKIGYDAA+
Sbjct: 392  PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 451

Query: 1330 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            KVAKNAHKKGITLKESAL+LGVL EKEFDEWV+PEKM+GP
Sbjct: 452  KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 491

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
            YPL262W
          Length = 496

 Score =  775 bits (2000), Expect = 0.0
 Identities = 381/468 (81%), Positives = 426/468 (91%)
 Frame = +1

Query: 46   RYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKK 225
            R +S+  GFR+ETDGFGEIKVPANKYWGAQTERSFENF+IGG RERMP+ VV+AFGVLKK
Sbjct: 28   RCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKK 87

Query: 226  CAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 405
             AAIVN   G LDP  SK+IQ+AADEV  GKLNDHFPLVVFQTGSGTQSNMNANEVISNR
Sbjct: 88   SAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 147

Query: 406  AIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAK 585
            AIEL GG LGSK++HPNNH N AQSSND+FPTVMHIAAVT+I+ HL+PE+ +LRDAL +K
Sbjct: 148  AIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESK 207

Query: 586  SAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGT 765
            S +F HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI RIE +  NL+FLAQGGTAVGT
Sbjct: 208  SKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGT 267

Query: 766  GLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQD 945
            GLNT+ G+AE+IA +ISKETG+AFKTAPNKFEALAAHDAIVEASGA+ TVA SLFKIAQD
Sbjct: 268  GLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQD 327

Query: 946  IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASG 1125
            IRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  + FAG  G
Sbjct: 328  IRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQG 387

Query: 1126 QFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNP 1305
            QFELNVFKPV+ISNLLSS++LLGD S+SFR+HCVEGIKANE +I++L+++SLMLVTALNP
Sbjct: 388  QFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNP 447

Query: 1306 KIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            KIGYD ATKVAKNAHKKGITLKESA++LG LTE EFDEWVVPEKM+GP
Sbjct: 448  KIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
            Anc_6.13 YPL262W
          Length = 484

 Score =  769 bits (1985), Expect = 0.0
 Identities = 382/460 (83%), Positives = 421/460 (91%)
 Frame = +1

Query: 70   FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 249
            FRVETD FGEIKV A++YWGAQT+RS ENF+IGG RERMPE +VRAFGVLKK AA+VN  
Sbjct: 23   FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNES 82

Query: 250  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 429
            LG LDP  ++ I+QAADEVA GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 83   LGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 142

Query: 430  LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 609
            LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I++HLLPEL HLRD+L AKS EF  IV
Sbjct: 143  LGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIV 202

Query: 610  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 789
            KIGRTHLQDATPLTLGQEFSGYVQQ++NGI+R+E +   L++LAQGGTAVGTGLNTK G+
Sbjct: 203  KIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGF 262

Query: 790  AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 969
            AE+IA ++SKETGL FKTAPNKFEALAAHDA+VEASGALNTVACSLFKIAQDIRYLGSGP
Sbjct: 263  AEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGP 322

Query: 970  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 1149
            RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 323  RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFK 382

Query: 1150 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 1329
            PV+ISNLLSSV+LL DAS SFRVHCV+GI AN  +I +L+H SLMLVTALNPKIGYDAA+
Sbjct: 383  PVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAAS 442

Query: 1330 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPE M+GP
Sbjct: 443  KVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  766 bits (1978), Expect = 0.0
 Identities = 388/474 (81%), Positives = 422/474 (89%), Gaps = 4/474 (0%)
 Frame = +1

Query: 40   QTRYISNLKGF----RVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRA 207
            +TR IS         RVETD FGEI VPA+KYWGAQT+RS ENFKIGG+RERMPE VVRA
Sbjct: 18   KTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRA 77

Query: 208  FGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNAN 387
            FG+LKK AAIVN  LG LDP  SK IQQAADEV +GKL DHFPLVVFQTGSGTQSNMNAN
Sbjct: 78   FGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNAN 137

Query: 388  EVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLR 567
            EVISNRAIE+ GG +G+K IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT LR
Sbjct: 138  EVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALR 197

Query: 568  DALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQG 747
            D+ A KS EFE IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E++  +L+FLAQG
Sbjct: 198  DSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQG 257

Query: 748  GTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSL 927
            GTAVGTGLNTK G+ E+IA ++SKETG+ FKTAPNKFEALAAHDAIVE SGALNT+ACSL
Sbjct: 258  GTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSL 317

Query: 928  FKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVT 1107
            FKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+T
Sbjct: 318  FKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAIT 377

Query: 1108 FAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLML 1287
            FAGASGQFELNVFKPV+ISNLLSSV+LLGDA  SFRVHCV+GI+AN  KI++LLH SLML
Sbjct: 378  FAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLML 437

Query: 1288 VTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            VTALNPKIGYDAA+KVAKNAHKKGITLKESALEL VLT  EFD+WVVPE M+GP
Sbjct: 438  VTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
            (FUM1) - mitochondrial and cytoplasmic fumarase (fumarate
            hydralase) [contig 186] FULL
          Length = 493

 Score =  765 bits (1976), Expect = 0.0
 Identities = 381/460 (82%), Positives = 416/460 (90%)
 Frame = +1

Query: 70   FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 249
            +RVETD FGEIKVP +K WGAQT+RS ENFKIGG RERMPE +V+AFG+LKK AAIVN  
Sbjct: 32   YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91

Query: 250  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 429
            LG LDP  SK IQ AADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNRAI+L GG 
Sbjct: 92   LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151

Query: 430  LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 609
            +GSK IHPNNHCN AQSSNDTFP+VMHIAAVT+++  LLPEL  LRDA A K+ EF+ IV
Sbjct: 152  VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211

Query: 610  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 789
            KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E +  NL+FLAQGGTAVGTGLNTK G+
Sbjct: 212  KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271

Query: 790  AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 969
            AE+IA ++SKETG+ FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 272  AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 970  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 1149
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 332  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 1150 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 1329
            PV+ISNLLSS++LLGDA  SFRVHCVEGI+ANE KI++LLH SLMLVTALNPKIGYDAA+
Sbjct: 392  PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451

Query: 1330 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            KVAKNAHKKGITLKESALELGVL+  EFDEWVVPE M+GP
Sbjct: 452  KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
            Ashbya gossypii ACR013C
          Length = 489

 Score =  764 bits (1974), Expect = 0.0
 Identities = 380/477 (79%), Positives = 422/477 (88%), Gaps = 4/477 (0%)
 Frame = +1

Query: 34   RVQTRYISNLKG----FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVV 201
            R+  R +S   G    FR+ETD FGEIKVPANKYWGAQT+RS ENFKIGG RERMPE ++
Sbjct: 12   RIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPII 71

Query: 202  RAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMN 381
            +AFG+LKK AAIVN  LG LDP  SK IQQAADEV  GKL DHFPLVVFQTGSGTQSNMN
Sbjct: 72   KAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMN 131

Query: 382  ANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTH 561
            ANEVISNRAIEL GG LG+K+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT 
Sbjct: 132  ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191

Query: 562  LRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLA 741
            LRD+   K+ EF HIVKIGRTHLQDATPLTLGQEF GY QQ+TNGI R+E++  +L+FLA
Sbjct: 192  LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251

Query: 742  QGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVAC 921
            QGGTAVGTGLNTK G+AE+IA ++SKET + FKTAPNKFEALAAHDA+VE SGALNTVAC
Sbjct: 252  QGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVAC 311

Query: 922  SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 1101
            SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ 
Sbjct: 312  SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNST 371

Query: 1102 VTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSL 1281
            +TFAGASGQFELNVFKPV+ISNLL+S++LL DAS SFRVHCV+GIKANE KI+++LH SL
Sbjct: 372  ITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESL 431

Query: 1282 MLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 1452
            MLVTALNPKIGYD+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPEKM+GP+
Sbjct: 432  MLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPT 488

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPL262W
            (FUM1)
          Length = 488

 Score =  763 bits (1969), Expect = 0.0
 Identities = 375/460 (81%), Positives = 422/460 (91%)
 Frame = +1

Query: 70   FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 249
            FRVETD FGEI+VPA+KYWGAQT+RS ENF+IGG+RERMPE VVRAFGVLKK AA+VN +
Sbjct: 27   FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86

Query: 250  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 429
            LG L+P  +K IQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 87   LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146

Query: 430  LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 609
            LGSK++HPNNHCN AQSSNDTFP+VMHIAAVT+I++ LLPEL  LR +   K+ EF HIV
Sbjct: 147  LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206

Query: 610  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 789
            KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+E AQ++LRFLAQGGTAVGTGLNT+ G+
Sbjct: 207  KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266

Query: 790  AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 969
            AE+IAA++S+ETGL F+TAPNKFEALAAHDA+VEASGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 267  AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326

Query: 970  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 1149
            RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 327  RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386

Query: 1150 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 1329
            PV+I+NLLSSV+LL DA+RSFRVHCV+GI+ NE +I++LLH SLMLVTALNPKIGYDAA+
Sbjct: 387  PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446

Query: 1330 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
             VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPEKM+GP
Sbjct: 447  AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGP 486

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  762 bits (1967), Expect = 0.0
 Identities = 381/479 (79%), Positives = 425/479 (88%)
 Frame = +1

Query: 13   AIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPE 192
            AI  ++ +V  R +++   FR ETD FGEI VPA+KYWGAQT+RSF+NFKIGG+RERMP 
Sbjct: 11   AILQSSYKVNIRRMNST--FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPL 68

Query: 193  AVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQS 372
             +V AFGVLKK AAIVN  LGGLDP  SK IQQAADEVA GKL+DHFPLVVFQTGSGTQS
Sbjct: 69   PLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQS 128

Query: 373  NMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPE 552
            NMNANEVISNRAIE+ GG +GSK++HPNN CN +QSSNDTFPTVMHIAA  QI + L+PE
Sbjct: 129  NMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPE 188

Query: 553  LTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLR 732
            LT+L++AL AKS EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+    + L 
Sbjct: 189  LTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLS 248

Query: 733  FLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNT 912
            FLAQGGTAVGTGLNTK G+  +IA +ISKETGL F+TAPNKFEALAAHDAIVE SGALNT
Sbjct: 249  FLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNT 308

Query: 913  VACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1092
            +ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGN
Sbjct: 309  LACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 368

Query: 1093 NAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLH 1272
            NAA+TF G+ GQFELNVFKPV+I+NLL+S++L+ DASRSFR+HCVEGIKANE +I ELL 
Sbjct: 369  NAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLT 428

Query: 1273 RSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            +SLMLVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPE MLGP
Sbjct: 429  KSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
            converts fumaric acid to L-malic acid in the TCA cycle;
            cytosolic and mitochondrial distribution determined by
            the N-terminal targeting sequence, protein conformation,
            and status of glyoxylate shunt; phosphorylated in
            mitochondria
          Length = 488

 Score =  759 bits (1961), Expect = 0.0
 Identities = 380/475 (80%), Positives = 424/475 (89%), Gaps = 4/475 (0%)
 Frame = +1

Query: 37   VQTRYISNLK----GFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVR 204
            V++ Y  N++     FR ETD FGEI VPA+KYWGAQT+RSF+NFKIGG+RERMP  +V 
Sbjct: 13   VKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVH 72

Query: 205  AFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNA 384
            AFGVLKK AAIVN  LGGLDP  SK IQQAADEVA+GKL+DHFPLVVFQTGSGTQSNMNA
Sbjct: 73   AFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNA 132

Query: 385  NEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHL 564
            NEVISNRAIE+ GG +GSK++HPNNHCN +QSSNDTFPTVMHIAA  QI   L+PELT+L
Sbjct: 133  NEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNL 192

Query: 565  RDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQ 744
            ++AL AKS EF+HIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  + + L FLAQ
Sbjct: 193  KNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQ 252

Query: 745  GGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACS 924
            GGTAVGTGLNTK G+  +IA +ISKETGL F+TAPNKFEALAAHDAIVE SGALNT+ACS
Sbjct: 253  GGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACS 312

Query: 925  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAV 1104
            LFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAA+
Sbjct: 313  LFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 372

Query: 1105 TFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLM 1284
            TFAG+ GQFELNVFKPV+I+NLL+S++L+ DA+ SFRVHCVEGIKANE +I ELL +SLM
Sbjct: 373  TFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLM 432

Query: 1285 LVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            LVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPE MLGP
Sbjct: 433  LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGP 487

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
            YPL262W (REAL)
          Length = 488

 Score =  759 bits (1960), Expect = 0.0
 Identities = 380/475 (80%), Positives = 423/475 (89%), Gaps = 4/475 (0%)
 Frame = +1

Query: 37   VQTRYISNLKG----FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVR 204
            VQ+ Y  N++     FR ETD FGEI VPA+KYWGAQT+RSF+NFKIGG+RERMP  +V 
Sbjct: 13   VQSSYKFNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVH 72

Query: 205  AFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNA 384
            AFGVLKK AAIVN  LGGLDP  SK IQ+AADEVA+GKL+DHFPLVVFQTGSGTQSNMNA
Sbjct: 73   AFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNA 132

Query: 385  NEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHL 564
            NEVISNRAIE+ GG +GSKE+HPNNHCN +QSSNDTFPTVMHIAA  QI   L+PEL +L
Sbjct: 133  NEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANL 192

Query: 565  RDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQ 744
            ++AL AKS EF+HIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  + + L FLAQ
Sbjct: 193  KNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQ 252

Query: 745  GGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACS 924
            GGTAVGTGLNTK G+  +IA +ISKETGL F+TAPNKFEALAAHDAIVE SGALNT+ACS
Sbjct: 253  GGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACS 312

Query: 925  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAV 1104
            LFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAA+
Sbjct: 313  LFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 372

Query: 1105 TFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLM 1284
            TFAG+ GQFELNVFKPV+I+NLL+S++L+ DA+ SFRVHCVEGIKANE +I ELL +SLM
Sbjct: 373  TFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLM 432

Query: 1285 LVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            LVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPE MLGP
Sbjct: 433  LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  759 bits (1959), Expect = 0.0
 Identities = 379/475 (79%), Positives = 423/475 (89%), Gaps = 4/475 (0%)
 Frame = +1

Query: 37   VQTRYISNLKG----FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVR 204
            +Q+ Y  NL+     FR+ETD FGEI VPA+KYWGAQT+RSF+NFKIGG+RERMP  +V 
Sbjct: 13   LQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVH 72

Query: 205  AFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNA 384
            AFGVLKK AA+VN  LGGLDP  SK IQQAADEV +GKL+DHFPLVVFQTGSGTQSNMNA
Sbjct: 73   AFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNA 132

Query: 385  NEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHL 564
            NEVISNRAIE+ GG +GSKE+HPNNHCN +QSSNDTFPTVMHIAA  QI   L+PELT+L
Sbjct: 133  NEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNL 192

Query: 565  RDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQ 744
            ++AL AKS EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  + + L FLAQ
Sbjct: 193  KNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQ 252

Query: 745  GGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACS 924
            GGTAVGTGLNTK G+  +IA +IS ETGL F+TAPNKFEALAAHDAIVE SGALNT+ACS
Sbjct: 253  GGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACS 312

Query: 925  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAV 1104
            LFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAA+
Sbjct: 313  LFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 372

Query: 1105 TFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLM 1284
            TFAG+ GQFELNVFKPV+I+NLL+S++L+ D++ SFRVHCVEGIKANE +I ELL +SLM
Sbjct: 373  TFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLM 432

Query: 1285 LVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            LVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPE MLGP
Sbjct: 433  LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  759 bits (1959), Expect = 0.0
 Identities = 376/460 (81%), Positives = 422/460 (91%)
 Frame = +1

Query: 70   FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 249
            +RVETD FGEI+VP++KYWGAQT+RS +NFKIGG RERMPE +V+AFGVLKK AA+VN  
Sbjct: 31   YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90

Query: 250  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 429
            LG LDP  +K I+QAADEVA GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 91   LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150

Query: 430  LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 609
            LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+ HLLPEL  L+ AL  KS EF+HIV
Sbjct: 151  LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210

Query: 610  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 789
            KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++++  +L+FLAQGGTAVGTGLNTK G+
Sbjct: 211  KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270

Query: 790  AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 969
            AE IA ++SKETG+ FKTAPNKFEALAAHDA+VEASGALNT+A SLFKIA DIRYLGSGP
Sbjct: 271  AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330

Query: 970  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 1149
            RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AA+TFAGASGQFELNVFK
Sbjct: 331  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390

Query: 1150 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 1329
            PV+ISNLLSS++LLGDAS SFR+HCVEGIKANE +I++LLH SLMLVTALNPKIGYDAA+
Sbjct: 391  PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450

Query: 1330 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            KVAKNAHKKGITLKESALEL VL+ +EFD+WV+PEKM+GP
Sbjct: 451  KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  758 bits (1957), Expect = 0.0
 Identities = 385/484 (79%), Positives = 425/484 (87%)
 Frame = +1

Query: 1    MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 180
            MLR++ R  T  +   Y + +  +RVETD FGEIKVPA+KYWGAQT+RSF+NFKIGG+RE
Sbjct: 1    MLRASSRAKTSLIG--YSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARE 58

Query: 181  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 360
            RMPE +VRAFGVLKK AAIVN +LG LD   +  IQQAADEVA GKLNDHFPLVVFQTGS
Sbjct: 59   RMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGS 118

Query: 361  GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 540
            GTQSNMNANEVISNRAIEL GG LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  
Sbjct: 119  GTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNS 178

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            LLPE+T L+DAL  K+ EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE   
Sbjct: 179  LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238

Query: 721  QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 900
             +L++LAQGGTAVGTGLNTK G+ + IA +ISKETG+ FKTAPNKFEALAAHDAIVEASG
Sbjct: 239  PHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASG 298

Query: 901  ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 1080
            ALNTVACSLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 299  ALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 358

Query: 1081 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 1260
            VMGNNAAVTFAGA+GQFELNVFKPV+ISNLLSS++LL DA  SFRVHCVEGI+AN  KI+
Sbjct: 359  VMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKIN 418

Query: 1261 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 1440
              LH SLMLVTALNPKIGYDAA+K+AKNA KK ITLKESALEL  LT +EFDEWV+PE M
Sbjct: 419  HNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENM 478

Query: 1441 LGPS 1452
            +GP+
Sbjct: 479  VGPT 482

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 505

 Score =  740 bits (1910), Expect = 0.0
 Identities = 368/463 (79%), Positives = 409/463 (88%)
 Frame = +1

Query: 61   LKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIV 240
            L+  RVETD FGEIKVPA+KYWGAQT+RSFENF+IGG RERMPEAVV AFG+LKK  A V
Sbjct: 41   LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 100

Query: 241  NTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELK 420
            N   G LDP  +  I+QAADEVA+GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEL 
Sbjct: 101  NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 160

Query: 421  GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 600
            GG LGSK +HPNNH NM+QSSNDTFPTVMHIAAV  I++ LLP LT L+D+L  KS EF 
Sbjct: 161  GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 220

Query: 601  HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTK 780
             IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+E    +L+ LAQGGTAVGTGLNTK
Sbjct: 221  DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 280

Query: 781  NGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 960
             GWAE +AAE++KETG+ F+TAPNKFEALAAHDA+VEASGALNT+A SLFKIAQDIRYLG
Sbjct: 281  IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 340

Query: 961  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELN 1140
            SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++A+TFAGASGQFELN
Sbjct: 341  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 400

Query: 1141 VFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYD 1320
            VFKPV+ISNLLSS+ LL DAS SFRVHCV+GI+AN   I++LLH SLMLVTALNPKIGYD
Sbjct: 401  VFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 460

Query: 1321 AATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            AA+KVAKNAHK GITLKESAL+L +LT +EFD WVVPE M+GP
Sbjct: 461  AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
            YPL262W
          Length = 498

 Score =  724 bits (1870), Expect = 0.0
 Identities = 364/483 (75%), Positives = 418/483 (86%)
 Frame = +1

Query: 1    MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 180
            +LR+ +R N   +    I+N + FRVETD FGEI VPA++YWGAQT+RSF+NFKIGG RE
Sbjct: 18   LLRNNLRRN---MSASAITNQE-FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDRE 73

Query: 181  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 360
            ++PE VVRAFG+LKK AA VN  LG LD + +  I+ AADEVA GKL+DHFPLVVFQTGS
Sbjct: 74   KIPEPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGS 133

Query: 361  GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 540
            GTQSNMNANEVISNRAIEL GG LGSK++HPNNH N +QSSNDTFPTVMHIAA T+I+  
Sbjct: 134  GTQSNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANK 193

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            L+PEL +L+DAL  K  EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R++ + 
Sbjct: 194  LIPELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSL 253

Query: 721  QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 900
             +L FLAQGGTAVGTGLNTK G+ + +A E+SKETGL F+TAPNKFEALAAHDAIVEASG
Sbjct: 254  YHLHFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASG 313

Query: 901  ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 1080
            ALNT+ACSLFKIAQDIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 314  ALNTLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQ 373

Query: 1081 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 1260
            VMGNN+ +TFAG+ GQFELNV+KP++ISNLLSS++LL DAS+SFR+HC+  +KAN+ KI 
Sbjct: 374  VMGNNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKID 433

Query: 1261 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 1440
            E L++SLMLVTALNPKIGYDAA KVAKNAH K ITLKESALELGVLTEKEFDEWV+PE M
Sbjct: 434  ENLNKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENM 493

Query: 1441 LGP 1449
            + P
Sbjct: 494  ISP 496

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
            Anc_6.13 YPL262W
          Length = 493

 Score =  715 bits (1846), Expect = 0.0
 Identities = 352/478 (73%), Positives = 414/478 (86%)
 Frame = +1

Query: 16   IRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEA 195
            ++ + + + T   ++ + +R+ETD FGEIKVPA+KYWGAQT+RSF+NFKIGGSRER+P+ 
Sbjct: 14   LQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDP 73

Query: 196  VVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSN 375
            ++ AFG+LKK AAIVN  LG LDP  +  I++AADEV  GKL DHFPLVVFQTGSGTQ+N
Sbjct: 74   IITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTN 133

Query: 376  MNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPEL 555
            MN NEVISNRAIEL GG LGSK+IHPNNHCN +QSSNDTFP+VMHIAAV +I+  L+PEL
Sbjct: 134  MNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPEL 193

Query: 556  THLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRF 735
            T L+DAL  K+ EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE +  +L+F
Sbjct: 194  TKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKF 253

Query: 736  LAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTV 915
            LAQGGTAVGTGLNTK G+ + IA E+SKETG+ FKTAPNKFEALAAHDAIV ASGALNTV
Sbjct: 254  LAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTV 313

Query: 916  ACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 1095
            A SLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN
Sbjct: 314  AGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNN 373

Query: 1096 AAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHR 1275
              ++ AG+ GQFELNV+KP++I+NLL+S++L+ DA +SFR+HC++ +KAN+ KI+E L++
Sbjct: 374  QTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNK 433

Query: 1276 SLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            SLMLVTALNPKIGYDAA+K+AKNAH K ITLKESALEL  LT +EFDEWVVPE M+GP
Sbjct: 434  SLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
            YPL262W
          Length = 495

 Score =  711 bits (1835), Expect = 0.0
 Identities = 354/467 (75%), Positives = 408/467 (87%), Gaps = 1/467 (0%)
 Frame = +1

Query: 52   ISNLKG-FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKC 228
            +S++K  FR ETD FGEI VP +KYWGAQT+RS +NFKIGG RE++P  ++ AFG+LKK 
Sbjct: 27   MSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKS 86

Query: 229  AAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRA 408
            AAIVN  LG LD   +K I  AADEV+ GKLNDHFPLVVFQTGSGTQSNMNANEVISNRA
Sbjct: 87   AAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRA 146

Query: 409  IELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKS 588
            IEL GG LGSK +HPNNH N +QSSNDTFPTVMHIAA+ +I++ LLPEL  L+++L  KS
Sbjct: 147  IELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKS 206

Query: 589  AEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTG 768
             EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI RIE A  +L+FLAQGGTAVGTG
Sbjct: 207  NEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTG 266

Query: 769  LNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDI 948
            LNTK G+ + IA +IS+ETG+ F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDI
Sbjct: 267  LNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDI 326

Query: 949  RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQ 1128
            RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ +TFAG+ GQ
Sbjct: 327  RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQ 386

Query: 1129 FELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPK 1308
            FELNV+KP+LISNLLSS++LL DAS SFRVHC++G+KAN   I+E L++SLMLVTALNP 
Sbjct: 387  FELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPY 446

Query: 1309 IGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            IGYD A+K+AKNAH K ITLKESALELG+LTE++F EWV+PEKM+GP
Sbjct: 447  IGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
            Anc_6.13 YPL262W
          Length = 475

 Score =  702 bits (1812), Expect = 0.0
 Identities = 343/465 (73%), Positives = 407/465 (87%)
 Frame = +1

Query: 55   SNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAA 234
            SN   FRVETD FGEIKVP+NKYWGAQT+RSF+NFKIGG RE++P  +++AFG+LKK AA
Sbjct: 9    SNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAA 68

Query: 235  IVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 414
            IVN  LG LDP+ +  I +A+DEV  GKLNDHFPLVVFQTGSGTQ+NMNANEVISNRA E
Sbjct: 69   IVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANE 128

Query: 415  LKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAE 594
            L G  LGSK+IHPNNH N +QSSNDTFP+VMHIAAV +++ +L+P+LT L+++L  K+ E
Sbjct: 129  LIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKE 188

Query: 595  FEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLN 774
            + +IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI+ +  +L+FLAQGGTAVGTGLN
Sbjct: 189  YANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLN 248

Query: 775  TKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRY 954
            TK G+ + IA E+SKETG+ F+TAPNKFEALAAHDAIV AS A+ TVA SLFKIAQDIRY
Sbjct: 249  TKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRY 308

Query: 955  LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFE 1134
            LGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  +  AG+ GQFE
Sbjct: 309  LGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368

Query: 1135 LNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIG 1314
            LNV+KP++I+NLL+S++L+ DA  SF++HCV+G+KAN  KI+E LH+SLMLVTALNPKIG
Sbjct: 369  LNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIG 428

Query: 1315 YDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 1449
            YDAA+K+AKNAH K ITLKESALELG+LTE+EFD+WV+PE M+GP
Sbjct: 429  YDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
            YPL262W
          Length = 500

 Score =  694 bits (1792), Expect = 0.0
 Identities = 343/484 (70%), Positives = 403/484 (83%)
 Frame = +1

Query: 1    MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 180
            + R+  R  ++   +  I++L+G R ETD FGEI+VPANKYWGAQT+RSF NFKIGG RE
Sbjct: 17   IFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERE 76

Query: 181  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 360
            RMPE ++RAFG  KK AAIVN  LG LD      I QAA+EV+ G LN+HFPLVVFQTGS
Sbjct: 77   RMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGS 136

Query: 361  GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 540
            GTQSNMNANEVISNRAIEL GG LGSK++HPNNH N +QSSNDTFPTVMHIAA+T+I+  
Sbjct: 137  GTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNT 196

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            LLP L  LR+ L +K+ EFE I+KIGRTHLQDATPLTLGQEFSGY QQLTN I+RIE+  
Sbjct: 197  LLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNL 256

Query: 721  QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 900
              L+++AQGGTAVGTGLNTK G+AE+ A ++S +T L+F T+PNKFE+LAAHDAIV    
Sbjct: 257  PELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHA 316

Query: 901  ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 1080
            +LNT+ACSLFKI+QDIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQ
Sbjct: 317  SLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQ 376

Query: 1081 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 1260
            VMGNN+ ++FAGASGQFELN +KP++I+NLLSS +LL DA  SF +HC  GI+AN+ KI 
Sbjct: 377  VMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKID 436

Query: 1261 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 1440
             LLH SLMLVT+LNPKIGYDAA+KVAKNAH KGITLK+SALEL +L+ K+FDEWV PE M
Sbjct: 437  RLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENM 496

Query: 1441 LGPS 1452
            LGP+
Sbjct: 497  LGPN 500

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
            YPL262W
          Length = 465

 Score =  690 bits (1781), Expect = 0.0
 Identities = 334/460 (72%), Positives = 395/460 (85%)
 Frame = +1

Query: 73   RVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTEL 252
            R+E DGFGE++VPANKYWGAQT+R+  NF IGG RERMPE ++ A+G+LKK  AIVN  L
Sbjct: 5    RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 253  GGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGVL 432
            G LDP  SK IQ+AADEVA G LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE+ GG L
Sbjct: 65   GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 433  GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVK 612
            GSK +HPNNH N +QS+ND+FPT MHI+AV ++   LLPEL  LRDAL  KS EF  IVK
Sbjct: 125  GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 613  IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWA 792
            IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ +  NL+F+AQGGTAVGTG+NTK  + 
Sbjct: 185  IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 793  ERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPR 972
              +A +IS ETG+ FKTAPNKFEALA+HDAIVE SGALNT+ACSLFKI+QDIR+LGSGPR
Sbjct: 245  ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 973  CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFKP 1152
            CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+A+TFAGASGQFELN +KP
Sbjct: 305  CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 1153 VLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAATK 1332
            ++ISNLL+S++LL D+  SFR+HC+ GI+ANE KI++LL+ SLMLVTALNPKIGYDAAT 
Sbjct: 365  LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 1333 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 1452
            +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE M+ PS
Sbjct: 425  IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPS 464

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 461

 Score = 47.8 bits (112), Expect = 5e-05
 Identities = 55/209 (26%), Positives = 85/209 (40%), Gaps = 1/209 (0%)
 Frame = +1

Query: 475  QSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTL 654
            +S ND   T M I     ++  +LP L+ L   +  ++ E   ++  G THLQ A P+  
Sbjct: 111  RSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQPIRW 170

Query: 655  GQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLA 834
                S Y    T   +R+++  + L     G  A+        G    I  E     GL 
Sbjct: 171  AHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALA-------GHPYGIDREF-LAAGLN 222

Query: 835  FK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEP 1011
            F     N   A+A  D +VE     +     + + A+D+  + S    G+ +LS      
Sbjct: 223  FNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS-DAYST 280

Query: 1012 GSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1098
            GSS+MP K NP   E +     +V G  A
Sbjct: 281  GSSLMPQKKNPDSLELLRGKSGRVFGQLA 309

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 464

 Score = 47.8 bits (112), Expect = 5e-05
 Identities = 59/229 (25%), Positives = 91/229 (39%), Gaps = 1/229 (0%)
 Frame = +1

Query: 406  AIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAK 585
            A E + G +  +EI    H    +S ND   T M I     +++ LLP L      L  +
Sbjct: 92   ANERRLGEIIGREISGKVHTG--RSRNDQVATDMRIYCRDILNEVLLPALQAFIKVLTTR 149

Query: 586  SAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGT 765
            + E   ++  G THLQ A P+      S Y    T    R+++  + L     G  A+  
Sbjct: 150  AKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALA- 208

Query: 766  GLNTKNGWAERIAAEISKETGLAFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQ 942
                  G    I  E     GL F+    N   A++  D +VE           + + ++
Sbjct: 209  ------GHPYGIDREFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSE 261

Query: 943  DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1089
            D+  + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 262  DL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
            (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05
 Identities = 74/322 (22%), Positives = 134/322 (41%), Gaps = 17/322 (5%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            L+P+L ++ D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT    G+ L   +   +++ A   + T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 1071
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E +  +
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCERVCSL 304

Query: 1072 CVQVMGNNAAVTFAGASGQ-FELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANE 1248
              + +G+  +     AS Q FE  +    +    L S  L  D   S  ++   G+    
Sbjct: 305  -ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSGLVVYP 363

Query: 1249 AKISELLHRSLMLVTALN---PKIGYDAATKVAKNA-----HKKGITLKESA----LELG 1392
              I   +   L  +   N     +G  A+ +    A     H+    +KE      L   
Sbjct: 364  KVIERRIKSELPFMATENFIMAMVGKGASRQEVHEAIRVLSHQAAAVVKEEGGDNDLIER 423

Query: 1393 VLTEKEFDE-WVVPEKMLGPSS 1455
            V T+K F+  W   + +L PS+
Sbjct: 424  VKTDKFFEPIWEELDSLLDPST 445

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 70/324 (21%), Positives = 139/324 (42%), Gaps = 19/324 (5%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNEAMT 1065
                L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E + 
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCERVC 302

Query: 1066 QVCVQVMGNNAAVTFAGASGQ-FELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGI-- 1236
             +  + +G+  +     AS Q FE  +    +    L S  L  D   S  ++   G+  
Sbjct: 303  SL-ARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTTDILLSTLLNISSGLVV 361

Query: 1237 --KANEAKISE----LLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVL 1398
              K  E +I      +   ++++          D   ++   +H+    +KE   +  ++
Sbjct: 362  YPKVIERRIKSELPFMATENIIMAMVEKKASRQDVHERIRVLSHQAAAVVKEQGGDNDLI 421

Query: 1399 TEKEFDEWVVP-----EKMLGPSS 1455
               + DE+  P     +++L PS+
Sbjct: 422  ERIQKDEYFKPIWGELDQLLEPST 445

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359w ADE13
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 44/175 (25%), Positives = 81/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128  VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++     + T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018c ARLY
          Length = 461

 Score = 46.2 bits (108), Expect = 1e-04
 Identities = 57/229 (24%), Positives = 93/229 (40%), Gaps = 1/229 (0%)
 Frame = +1

Query: 406  AIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAK 585
            A E + G L  ++I    H    +S ND   T M I     +++ + P +  L + L  +
Sbjct: 92   ANERRLGELIGRDIAGKVHTG--RSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNR 149

Query: 586  SAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGT 765
            + +   I+  G THLQ A P+      S Y    T  ++R+E+  + L     G  A+  
Sbjct: 150  AEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA- 208

Query: 766  GLNTKNGWAERIAAEISKETGLAFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQ 942
                  G   +  AE     GL F     N   A++  D +VE           + + ++
Sbjct: 209  --GHPYGIDRQFLAE-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSE 261

Query: 943  DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1089
            D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 262  DL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 43/175 (24%), Positives = 82/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A  ++ T  L F           +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 45/178 (25%), Positives = 83/178 (46%), Gaps = 6/178 (3%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            L+P+L ++ + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG--LAFKTAPNKFEALAAHDAIV 888
             ++      GT     + L   +G  +++ A + K     L F T         +    +
Sbjct: 188  NDIGLRGVKGTTGTQASFLTLFHGDHDKVEA-LDKRVAELLGFSTVYPVTGQTYSRKIDI 246

Query: 889  EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 1056
            +    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 247  DVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
            (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 50/221 (22%), Positives = 98/221 (44%), Gaps = 3/221 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ D LA  ++E++ +  +G TH Q A   T+G+  + ++Q+L   +    RA+
Sbjct: 128  IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   +    L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQV 1071
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   +V
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE---RV 301

Query: 1072 CVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLG 1194
            C   +  +    F+ A     +  F+  L  + +  + L G
Sbjct: 302  C--SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPG 340

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 43/175 (24%), Positives = 81/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ D L+  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 43/175 (24%), Positives = 81/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F           +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
            ADE13Adenylosuccinate lyase, catalyzes two steps in the
            'de novo' purine nucleotide biosynthetic pathway;
            expression is repressed by adenine and activated by Bas1p
            and Pho2p; mutations in human ortholog ADSL cause
            adenylosuccinase deficiency
          Length = 482

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 43/175 (24%), Positives = 81/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F           +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 43/175 (24%), Positives = 81/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            L+P+L ++ + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 43/175 (24%), Positives = 80/175 (45%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 43/175 (24%), Positives = 80/175 (45%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F           +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L++ A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
            Ashbya gossypii ABL006C
          Length = 482

 Score = 44.7 bits (104), Expect = 4e-04
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 10/182 (5%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            L+P+L ++ + L+  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--------AVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAH 876
             ++ F    GT        A+  G + K    ++  AE+S      F           + 
Sbjct: 188  NDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAELS-----GFDIIYPVTGQTYSR 242

Query: 877  DAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQ 1050
               ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  K NP +
Sbjct: 243  KVDIDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYKRNPMR 297

Query: 1051 NE 1056
             E
Sbjct: 298  CE 299

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
            YHR018C
          Length = 462

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 55/218 (25%), Positives = 85/218 (38%), Gaps = 1/218 (0%)
 Frame = +1

Query: 448  HPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTH 627
            H     +  +S ND   T M I     +++ LLP +  L   L  ++      +  G TH
Sbjct: 103  HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTH 162

Query: 628  LQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAA 807
            LQ A P+      S Y    T   +R+++  + L     G  A+        G    I  
Sbjct: 163  LQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA-------GHPYGIDR 215

Query: 808  EISKETGLAF-KTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYG 984
            E   E GL F     N   A++  D +VE           + + A+D+  + S    G+ 
Sbjct: 216  EFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFV 273

Query: 985  ELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1098
            +LS      GSS+MP K N    E +     +V G+ A
Sbjct: 274  KLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
            similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 43.9 bits (102), Expect = 8e-04
 Identities = 64/286 (22%), Positives = 108/286 (37%), Gaps = 5/286 (1%)
 Frame = +1

Query: 247  ELGGLDPATSKLIQQAADEV----ATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 414
            ++G LD     LI +   E+    ++GK  +H            +    ANE    R  E
Sbjct: 51   KIGLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGE 98

Query: 415  LKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAE 594
            L G  +  K        +  +S ND   T M I     +++ +LP ++     L  ++ E
Sbjct: 99   LIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRARE 151

Query: 595  FEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLN 774
               ++  G THLQ A P+      S Y    T    R+ +  + L    Q     G    
Sbjct: 152  EVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAG 208

Query: 775  TKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRY 954
               G   +  AE     G+      N   A++  D ++E     +     + + A+D+  
Sbjct: 209  HPYGIDRKYLAEQLGFNGI----IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLII 264

Query: 955  LGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1089
              +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 265  YSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 52/218 (23%), Positives = 88/218 (40%), Gaps = 1/218 (0%)
 Frame = +1

Query: 448  HPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTH 627
            H +   +  +S ND   T M +     +   + P L  L   L  ++ E   ++  G TH
Sbjct: 103  HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 628  LQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW-AERIA 804
            LQ A P+      S Y    T  +E  +R ++ +  L Q     G       G   E +A
Sbjct: 163  LQRAQPIRWSHWLSCYA---TYFVEDFKRLKEVIARLNQSPLGAGALAGHPYGIDREYLA 219

Query: 805  AEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYG 984
             E+  +  +      N   A++  D +VE     +     + ++A+D+  + S    G+ 
Sbjct: 220  CELGFDGVIG-----NSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFV 273

Query: 985  ELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1098
            +L+      GSS+MP K NP   E +     +V G  A
Sbjct: 274  KLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLA 310

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 43/175 (24%), Positives = 79/175 (45%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             +L      GT     + L   +G  +++     + T  L F T         +    ++
Sbjct: 188  NDLGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa] {ON}
            complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 68/265 (25%), Positives = 99/265 (37%), Gaps = 1/265 (0%)
 Frame = +1

Query: 301  EVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQS 480
            EV   K++D    +  +  S +      +E I + A E + G L   +I    H    +S
Sbjct: 55   EVELSKIHDGLDAIKKEWDSDSFVRHPNDEDI-HTANERRLGELIGTDISGKVHTG--RS 111

Query: 481  SNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQ 660
             ND   T + I     I   LLP L  L   L  +      I+  G THLQ A P+    
Sbjct: 112  RNDQCVTDLRIYCRDIIQDKLLPSLKSLIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSH 171

Query: 661  EFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFK 840
              S Y    T   +R+++    L     G  A+        G    I  E     GL F 
Sbjct: 172  WLSSYATYFTEDYKRLKQLLDRLNVSPLGAGALA-------GHPYGIDREF-LANGLGFN 223

Query: 841  -TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGS 1017
                N   A++  D +VE           + + A+D+  + S    G+  LS      GS
Sbjct: 224  GVIGNSLVAVSDRDFVVELLFWGTLFMNHISRFAEDL-IIYSTAEFGFITLS-DAYSTGS 281

Query: 1018 SIMPGKVNPTQNEAMTQVCVQVMGN 1092
            S+MP K N    E +     +V GN
Sbjct: 282  SLMPQKKNSDSLELLRGKSGRVFGN 306

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
            YHR018C
          Length = 463

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 54/224 (24%), Positives = 86/224 (38%)
 Frame = +1

Query: 421  GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 600
            G ++G+K    +   +  +S ND   T + I     +S  LL  L  L + L  ++ E  
Sbjct: 97   GEIIGTKI---SGKVHTGRSRNDQCVTDLRIYCREYLSDKLLKNLETLINVLINRAEEEI 153

Query: 601  HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTK 780
              +  G THLQ A P+      S Y        +R+ + ++ L     G  A+       
Sbjct: 154  EFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSPLGAGALA------ 207

Query: 781  NGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 960
             G    I  E   E         N   A++  D +VE           + + A+D+  + 
Sbjct: 208  -GHPYGIDREYLAEKLGFDSVIGNSLVAVSDRDFVVEILFWSTLFMNHISRFAEDL-IIY 265

Query: 961  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1092
            S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 266  STAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
            YHR018C
          Length = 465

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 52/209 (24%), Positives = 81/209 (38%), Gaps = 1/209 (0%)
 Frame = +1

Query: 475  QSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTL 654
            +S ND   T + I     ++  L P+L  L D +  +  E   ++  G THLQ A P+  
Sbjct: 112  RSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEIDVLMPGYTHLQRAQPIRW 171

Query: 655  GQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLA 834
                S Y    T   +R+ +    +     G  A+        G    I  E     GL 
Sbjct: 172  SHWLSSYATYFTEDFKRLRQIMDRINQSPLGAGALA-------GHPYGIDREF-LAAGLG 223

Query: 835  FK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEP 1011
            F     N   A++  D IVE           + + A+D+  + S    G+ +L+      
Sbjct: 224  FDGVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYST 281

Query: 1012 GSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1098
            GSS+MP K N    E +     +V G+ A
Sbjct: 282  GSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 49/205 (23%), Positives = 91/205 (44%), Gaps = 8/205 (3%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128  VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 721  QNLRFLAQGGT--------AVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAH 876
             ++      GT        A+  G + K    +    E+     L F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVEL-----LGFDTVYPVTGQTYSR 242

Query: 877  DAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
               ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 1057 AMTQVCVQVMGNNAAVTFAGASGQF 1131
             +  +  + +G+  + T   AS Q+
Sbjct: 300  RVCSL-ARHLGSLLSDTVQTASVQW 323

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 41/175 (23%), Positives = 81/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ + L+  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 41/175 (23%), Positives = 78/175 (44%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ D L+  +  ++ +  +G TH Q A   TLG+  + ++Q L   +   +RA+
Sbjct: 128  IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++     + T  L F+T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 248  VLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
            similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 462

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 53/208 (25%), Positives = 81/208 (38%)
 Frame = +1

Query: 475  QSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTL 654
            +S ND   T M I     +++ LLP L  L   +  ++ +    +  G THLQ A P+  
Sbjct: 112  RSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIGYLMPGYTHLQRAQPIRW 171

Query: 655  GQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLA 834
                S Y    T   E ++R +Q L    Q     G       G      AE   E G  
Sbjct: 172  SHWLSSYATYFT---EDLKRLRQLLERFNQSPLGAGALAGHPYGIDREFLAE---ELGFQ 225

Query: 835  FKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPG 1014
                 N   A++  D +VE           + + A+D+  + S    G+ +L+      G
Sbjct: 226  -GVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTG 282

Query: 1015 SSIMPGKVNPTQNEAMTQVCVQVMGNNA 1098
            SS+MP K N    E +     +V G+ A
Sbjct: 283  SSLMPQKKNADSLELLRGKSGRVFGDLA 310

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004
 Identities = 42/175 (24%), Positives = 80/175 (45%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            L+P+L ++ + L+  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +++ A   + T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
                L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005
 Identities = 44/180 (24%), Positives = 78/180 (43%), Gaps = 8/180 (4%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            L+P+L ++ + L   +   + +  +G TH Q A   TLG+  + ++Q+L   +   ERA+
Sbjct: 128  LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 721  QNLRFLAQGGT--------AVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAH 876
             ++      GT        A+  G + K    +    E+     L F T         + 
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHNKVEKLDERVVEL-----LGFDTVYPVTGQTYSR 242

Query: 877  DAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
               ++A   L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243  KIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR359W
            (ADE13)
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010
 Identities = 41/175 (23%), Positives = 79/175 (45%), Gaps = 3/175 (1%)
 Frame = +1

Query: 541  LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 720
            ++P+L ++ + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    RA+
Sbjct: 128  IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 721  QNLRFLAQGGT--AVGTGLNTKNGWAERIAAEISKETG-LAFKTAPNKFEALAAHDAIVE 891
             ++      GT     + L   +G  +R+ A   + T  L F           +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKIDID 247

Query: 892  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1056
              G+ ++   +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 248  ILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
            YHR018C
          Length = 466

 Score = 39.7 bits (91), Expect = 0.016
 Identities = 52/224 (23%), Positives = 88/224 (39%), Gaps = 1/224 (0%)
 Frame = +1

Query: 421  GGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFE 600
            G ++G+   H     +  +S ND   T + I     + + LLP +  L   +  ++    
Sbjct: 97   GEIIGT---HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEI 153

Query: 601  HIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTK 780
             I+  G THLQ A P+      S Y    T   +R+++  + L     G  A+       
Sbjct: 154  DILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA------ 207

Query: 781  NGWAERIAAE-ISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYL 957
             G    I  + +S E G       N   A++  D IV+           + + ++D+  +
Sbjct: 208  -GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-II 264

Query: 958  GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 1089
             S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 265  YSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa] {ON}
            YHR018C (ARG4) - argininosuccinate lyase [contig 260]
            FULL
          Length = 465

 Score = 37.7 bits (86), Expect = 0.066
 Identities = 50/217 (23%), Positives = 84/217 (38%)
 Frame = +1

Query: 448  HPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTH 627
            H     +  +S ND   T M I    +   +L   L  L  A+  +S +    +  G TH
Sbjct: 105  HIAGKVHTGRSRNDQVATDMRIYC-REALDNLAKILEDLIGAILQRSEQEIDALMPGYTH 163

Query: 628  LQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAA 807
            LQ A P+      + Y    T   +R+++ ++ L     G  A+        G    I  
Sbjct: 164  LQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALA-------GHPYGIDR 216

Query: 808  EISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGE 987
            E   E         N  +A++  D +VE     +     + + ++D+  + S     + +
Sbjct: 217  EFLAERLGFSDVIGNSLQAVSDRDFVVEIMFWCSLFMNHISRFSEDL-IIYSTAEFNFVK 275

Query: 988  LSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 1098
            LS      GSS+MP K NP   E +     +V G+ A
Sbjct: 276  LS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGSLA 311

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 465

 Score = 36.6 bits (83), Expect = 0.15
 Identities = 61/277 (22%), Positives = 107/277 (38%), Gaps = 6/277 (2%)
 Frame = +1

Query: 280  LIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNN 459
            L Q+  DE+  G       ++  +  S +    + +E I        G ++G    H   
Sbjct: 57   LTQEELDEIHRG-----LEIIRGEWASNSFVEKDGDEDIHTANERRLGEIIGR---HIAG 108

Query: 460  HCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDA 639
              +  +S ND   T M I    +   ++   L  L  A+  ++ +    +  G THLQ A
Sbjct: 109  KVHTGRSRNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRA 167

Query: 640  TPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQG-GTAVGTGLNTKNGWAERIAAEIS 816
             P+      + Y    T   +R+++ ++ L     G G   G          E IA  + 
Sbjct: 168  QPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDR---EHIAERLG 224

Query: 817  KETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLF-----KIAQDIRYLGSGPRCGY 981
             +  +      N  +A++  D +VE         CSLF     + ++D+  + S     +
Sbjct: 225  FDGVIG-----NSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNF 273

Query: 982  GELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 1092
             +LS      GSS+MP K NP   E +     +V G+
Sbjct: 274  VKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 36.2 bits (82), Expect = 0.23
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 6/90 (6%)
 Frame = +1

Query: 232 AIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 411
           A+ + EL   DP  +K + + +D+  +G     F L     G G ++  +  E   N+ +
Sbjct: 643 AMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNKEL 702

Query: 412 ELKGGVLGSKEIH------PNNHCNMAQSS 483
           E K G   + ++       PN H N A+SS
Sbjct: 703 EHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>Ecym_4452 Chr4 complement(923429..927094) [3666 bp, 1221 aa] {ON}
           similar to Ashbya gossypii ADR029W
          Length = 1221

 Score = 33.5 bits (75), Expect = 1.7
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 2/71 (2%)
 Frame = +1

Query: 334 PLVVFQTG--SGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVM 507
           P++    G  S ++ N        N  + +  GV  SK++ PN +C      N+T PT  
Sbjct: 272 PILTISCGEQSASEFNFYKTRFSINVVVGIPYGVFDSKKLLPNKNCIRVDKDNNTTPTPF 331

Query: 508 HIAAVTQISQH 540
           +  +V   S H
Sbjct: 332 YNFSVLSCSTH 342

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 6/90 (6%)
 Frame = +1

Query: 232 AIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 411
           A+ + EL   DP   K + + +D+  +G     F L     G G ++  +  E + N+ +
Sbjct: 641 AMRDDELKASDPLQVKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEVRNKDL 700

Query: 412 ELKGGVLGSKEI------HPNNHCNMAQSS 483
           ELK G + + E+        N H +  +SS
Sbjct: 701 ELKKGNINNDELGHKSDRTQNEHVSEPESS 730

>TBLA0B06810 Chr2 (1607954..1611049) [3096 bp, 1031 aa] {ON}
           Anc_2.610 YMR047C
          Length = 1031

 Score = 32.0 bits (71), Expect = 4.8
 Identities = 27/96 (28%), Positives = 39/96 (40%), Gaps = 11/96 (11%)
 Frame = +1

Query: 241 NTELG----GLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRA 408
           NT +G    G  PAT+ L  Q  +  A              TG   Q N N N +   + 
Sbjct: 255 NTSMGSGLLGSKPATNSLFGQNNNNTANNN----------NTGMFGQQNNNTNSIFGQQQ 304

Query: 409 IELKGGVLGSKE-------IHPNNHCNMAQSSNDTF 495
            +  GG+ G+K           NN+ NM  ++N+TF
Sbjct: 305 QQSSGGLFGNKPQGMGTGLFGQNNNTNM-NNTNNTF 339

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
            complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score = 31.6 bits (70), Expect = 6.1
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 19/102 (18%)
 Frame = +1

Query: 1099 AVTFAGASGQF--ELNVFKPVLISNLLSSVQL----LGDASRSFRVHCVE-----GIKAN 1245
            A+ + G +G     L V   VLI+ L+  + +    LG   R  +   ++      ++ N
Sbjct: 369  AIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKN 428

Query: 1246 EAKISELLHRSLMLVTALNP--------KIGYDAATKVAKNA 1347
            E KI  + HR LML   L P          GYD   K+ KNA
Sbjct: 429  EIKIQNV-HRPLMLPNELTPFEIKFENVTFGYDKERKILKNA 469

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score = 31.6 bits (70), Expect = 6.2
 Identities = 19/42 (45%), Positives = 24/42 (57%)
 Frame = +1

Query: 508 HIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQ 633
           H   +TQ+ Q    +LT L+D LAA+  E E  VK  RT LQ
Sbjct: 696 HEQQITQVKQTYNDQLTELQDKLAAEEKELE-AVKRERTRLQ 736

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1162

 Score = 31.6 bits (70), Expect = 6.5
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 12/72 (16%)
 Frame = +1

Query: 76  VETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFG------------VL 219
           ++TD    IKVP N+  G Q  RS + ++  G   R+PE + ++FG            +L
Sbjct: 52  LKTDLETGIKVPLNETEGTQNHRSTDRYRKYGD-NRIPERLPKSFGKLIWEAFNDKTMLL 110

Query: 220 KKCAAIVNTELG 255
              AAIV+  LG
Sbjct: 111 LTAAAIVSFALG 122

>ZYRO0C02332g Chr3 complement(188031..189626) [1596 bp, 531 aa] {ON}
           similar to uniprot|P53632 Saccharomyces cerevisiae
           YOL115W TRF4 DNA polymerase sigma involved in mitotic
           chromsome condensation
          Length = 531

 Score = 31.2 bits (69), Expect = 7.5
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = -2

Query: 335 GKWSFNLPVATSSAACWINLEVAGSRPPSSVFTIAAHFLRTPKARTTASGIRSLEPPILK 156
           G ++ +L +  S   C IN +       SS++ +A HFL+  K  T    I     PI+K
Sbjct: 146 GSYATDLYLPGSDIDCVINSKTGDKENRSSLYELA-HFLKNRKLATQVEVIAKARVPIIK 204

Query: 155 F 153
           F
Sbjct: 205 F 205

>TBLA0B08900 Chr2 complement(2110882..2112963) [2082 bp, 693 aa]
           {ON} Anc_2.383
          Length = 693

 Score = 31.2 bits (69), Expect = 7.9
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 4/83 (4%)
 Frame = +1

Query: 319 LNDHFPLVVFQTGSGTQSNMNANEVI----SNRAIELKGGVLGSKEIHPNNHCNMAQSSN 486
           +N  F  VV    S T +N   N +I    SN  + L   +  +K I+ NNH N   ++N
Sbjct: 488 INKQFANVVSNISSNTTNNNTTNLIIDDDSSNDTLNLANRL--TKSIN-NNHSNNNNNNN 544

Query: 487 DTFPTVMHIAAVTQISQHLLPEL 555
           +T  T  +I A     Q LLP++
Sbjct: 545 NTANTTNNIQAT---PQDLLPDV 564

>KNAG0E00340 Chr5 (49652..52360) [2709 bp, 902 aa] {ON} Anc_7.39
           YOR353C
          Length = 902

 Score = 31.2 bits (69), Expect = 8.3
 Identities = 41/182 (22%), Positives = 74/182 (40%), Gaps = 10/182 (5%)
 Frame = +1

Query: 25  NTVRVQTRYISNLKGFRVETDGFGEIK--------VPANKYWGAQTERSFENF--KIGGS 174
           N VR+Q   + ++ G  + TD    ++        +P ++YW    +R FE+   +I   
Sbjct: 137 NVVRLQKLEMLDIDGNNIPTDELELVQKYTPTNASIPRDEYWALALQRYFEDHPEQIHSH 196

Query: 175 RERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQT 354
           +++   ++             V T L  L         +    ++TG  N         +
Sbjct: 197 QQQSATSIPTTANNPNNG---VTTNLSSLHQEKFSKASKRMGFISTGSPN---------S 244

Query: 355 GSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQIS 534
           G GT S  N NE++S    EL+    GS E++  NH       ND F  +  ++  + I+
Sbjct: 245 GQGT-STAN-NEIMSTSNPELENETSGSTELY--NHTKY----NDYFKRLSVLSEESVIN 296

Query: 535 QH 540
           +H
Sbjct: 297 EH 298

>KNAG0J01620 Chr10 (298427..299788) [1362 bp, 453 aa] {ON} Anc_8.659
            YPL146C
          Length = 453

 Score = 30.8 bits (68), Expect = 9.6
 Identities = 32/125 (25%), Positives = 54/125 (43%)
 Frame = +1

Query: 1000 ENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSS 1179
            E  PG     GK    Q  +  ++ ++++     +T      + E  V K  LI +  SS
Sbjct: 114  EELPGGDAHHGKGKKVQGVSKREM-LKLLALAGRIT---GESKLENRVAKDGLIKS--SS 167

Query: 1180 VQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKG 1359
              L GD  +S ++    GIK +++K  +     L + T       +  ATK  K   +K 
Sbjct: 168  FDLWGD-DKSTQIQLSSGIKIDKSKTEKASKELLTMSTT-----SWSIATKTPKTLKEKP 221

Query: 1360 ITLKE 1374
            +T+KE
Sbjct: 222  VTIKE 226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 143,705,381
Number of extensions: 3321576
Number of successful extensions: 8277
Number of sequences better than 10.0: 66
Number of HSP's gapped: 8269
Number of HSP's successfully gapped: 66
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)