Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.756.14ON47747723700.0
YEL060C (PRB1)6.14ON63546413231e-177
Smik_5.276.14ON60846313121e-176
TBLA0A073006.14ON57345613031e-175
Skud_5.296.14ON60848013061e-175
SAKL0E01012g6.14ON54447312921e-174
TDEL0G045506.14ON56447712801e-172
Suva_5.76.14ON66448112871e-172
NCAS0F002206.14ON69541912811e-170
Kwal_56.223876.14ON54342112651e-170
Kpol_1032.56.14ON68044912711e-169
NDAI0K028806.14ON70449212711e-169
KLLA0D00979g6.14ON56145812551e-168
KLTH0C11396g6.14ON55046812531e-168
Ecym_30186.14ON57543512461e-167
ACR012C6.14ON54143712321e-165
KAFR0L003606.14ON50242312271e-165
ZYRO0C07942g6.14ON54846712201e-163
CAGL0B03619g6.14ON46842212081e-162
KNAG0E009206.14ON53145411811e-157
TPHA0M002306.14ON58542310621e-139
Skud_15.1646.14ON48242010181e-134
Smik_15.1726.14ON47842310161e-133
Suva_15.1786.14ON47642110131e-133
YOR003W (YSP3)6.14ON4784249921e-130
CAGL0E02651g6.14ON4854209501e-123
KAFR0B065506.14ON4564249211e-119
NCAS0D026306.14ON4514338601e-110
NDAI0I022806.14ON4824397941e-100
CAGL0L13266gsingletonON5794517136e-87
KNAG0F02970singletonON4203526791e-83
SAKL0A02002g6.313ON4793724413e-48
ZYRO0D08822g6.313ON4904064397e-48
TDEL0A072806.313ON4363684271e-46
NCAS0D043906.313ON4923844283e-46
Kpol_1028.616.313ON5183244181e-44
CAGL0L10802g6.313ON5173454092e-43
Kwal_23.61836.313ON4933254073e-43
Suva_3.846.313ON5273894013e-42
KLTH0A06094g6.313ON4963403977e-42
NDAI0I005606.313ON4833953967e-42
Smik_3.1496.313ON4913253942e-41
KNAG0I024706.313ON4753803896e-41
YCR045C (RRT12)6.313ON4913933889e-41
Kpol_1018.56.313ON4653453833e-40
Skud_3.1246.313ON5403253822e-39
KAFR0J024506.313ON4783653773e-39
TBLA0F039706.313ON7343383685e-37
TPHA0D037606.313ON6073253631e-36
KLLA0F06028g6.313ON5083193601e-36
AAR069W6.313ON7683213492e-34
Ecym_21056.313ON6103273436e-34
Kwal_33.133721.78ON3773442942e-28
Kpol_2000.691.78ON3863582881e-27
TBLA0A067006.313ON4973282788e-26
KLTH0F02288g1.78ON3803062572e-23
TDEL0C062301.78ON3643042252e-19
ZYRO0F16764g1.78ON3863152182e-18
TPHA0B045201.78ON3883141891e-14
TBLA0A054101.78ON3823081641e-11
SAKL0G00440g2.6ON83664770.75
Smik_2.2853.117ON27886686.4
KAFR0A080402.6ON76666688.9
Skud_13.1732.565ON920107689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.75
         (477 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   917   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   514   e-177
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   509   e-176
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   506   e-175
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   507   e-175
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   502   e-174
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   497   e-172
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   500   e-172
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   498   e-170
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   491   e-170
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   494   e-169
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   494   e-169
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   488   e-168
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   487   e-168
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   484   e-167
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   479   e-165
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   477   e-165
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   474   e-163
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   469   e-162
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   459   e-157
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   413   e-139
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   396   e-134
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   395   e-133
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   394   e-133
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   386   e-130
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   370   e-123
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   359   e-119
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     335   e-110
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   310   e-100
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   279   6e-87
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              266   1e-83
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   174   3e-48
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   173   7e-48
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   169   1e-46
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   169   3e-46
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   165   1e-44
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   162   2e-43
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   161   3e-43
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   159   3e-42
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   157   7e-42
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    157   7e-42
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   156   2e-41
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   154   6e-41
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   154   9e-41
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   152   3e-40
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   151   2e-39
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   149   3e-39
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   146   5e-37
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   144   1e-36
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   143   1e-36
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   139   2e-34
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   136   6e-34
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   117   2e-28
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   115   1e-27
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   111   8e-26
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   103   2e-23
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    91   2e-19
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...    89   2e-18
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    77   1e-14
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    68   1e-11
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    34   0.75 
Smik_2.285 Chr2 (519776..520612) [837 bp, 278 aa] {ON} YBR146W (...    31   6.4  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    31   8.9  
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    31   9.5  

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/477 (93%), Positives = 448/477 (93%)

Query: 1   MLFLVFLTLLNFCHALVLPEEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMS 60
           MLFLVFLTLLNFCHALVLPEEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMS
Sbjct: 1   MLFLVFLTLLNFCHALVLPEEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMS 60

Query: 61  QLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLR 120
           QLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLR
Sbjct: 61  QLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLR 120

Query: 121 LSPLVKFIERDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYV 180
           LSPLVKFIERDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYV
Sbjct: 121 LSPLVKFIERDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYV 180

Query: 181 IDTGINITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXX 240
           IDTGINITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYG            
Sbjct: 181 IDTGINITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKV 240

Query: 241 LRSNGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXX 300
           LRSNGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDL         
Sbjct: 241 LRSNGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAG 300

Query: 301 XXXXXXXXNENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTY 360
                   NENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTY
Sbjct: 301 VHFAVAAGNENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTY 360

Query: 361 IGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFG 420
           IGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFG
Sbjct: 361 IGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFG 420

Query: 421 TKNALRDLPANTPNVIAYNGAGKSLEDFWNANDYVKNYQSLVITEQLQFILNKMNIF 477
           TKNALRDLPANTPNVIAYNGAGKSLEDFWNANDYVKNYQSLVITEQLQFILNKMNIF
Sbjct: 421 TKNALRDLPANTPNVIAYNGAGKSLEDFWNANDYVKNYQSLVITEQLQFILNKMNIF 477

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  514 bits (1323), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 261/464 (56%), Positives = 317/464 (68%), Gaps = 22/464 (4%)

Query: 32  SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLL 91
           S++IP  YI+VF  G  Q EI  H E + Q QLQSV +L  +  FF IST     S    
Sbjct: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFF-ISTKDTSLSTSEA 234

Query: 92  GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLAR 151
           GG++D F I N   GY G FT E+V+ +R +PLV F+ERDS+V  TE  TQ +APWGLAR
Sbjct: 235 GGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLAR 294

Query: 152 ISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDG 211
           ISHR RLNL +FNKYLYDD  G+GV +YVIDTG+NI + DF  RA WGKTIP  + ++DG
Sbjct: 295 ISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDG 354

Query: 212 NGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDV--GT 269
           NGHGTH AGTIAS HYG            LRSNG+G+MSDV+KGVEY   AHQ++     
Sbjct: 355 NGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKK 414

Query: 270 AGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVG 329
            GFKGS ANMSLGGGKS +LDL                 NENQDACNTSPA+A++AITVG
Sbjct: 415 KGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVG 474

Query: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389
           ASTLSD RAYFSNWG+CV +FAPGLNILSTYIGS DATATLSGTSMASPH+AGL+ YFLS
Sbjct: 475 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLS 534

Query: 390 LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449
           LQP   S+F+  GQ  ++TP QLKKK++ + TK+ L D+P +TPNV+ YNG G+ L  FW
Sbjct: 535 LQPGSDSEFFELGQ-DSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593

Query: 450 NANDYVKNYQS----------------LVITEQLQFILNKMNIF 477
             ND  K++ S                 +I +Q++ IL+K+NI 
Sbjct: 594 --NDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  509 bits (1312), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 255/463 (55%), Positives = 319/463 (68%), Gaps = 20/463 (4%)

Query: 32  SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLL 91
           S++IP  YIVVF +GV + E++ H E++ Q QLQSV +L  +  FFT ST     S    
Sbjct: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFT-STRDTYLSTSEA 207

Query: 92  GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLAR 151
           GG++D F I N   GY G FT E+++ +R +PLV F+ERDS+V  TE  TQ +APWGLAR
Sbjct: 208 GGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLAR 267

Query: 152 ISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDG 211
           ISHR RLNL +FNKYLYDD  G+GV +YVIDTG+NI + DF  RA WGKTIP  + ++DG
Sbjct: 268 ISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDG 327

Query: 212 NGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDV--GT 269
           NGHGTH AGTIAS HYG            LRSNG+G+MSDV+KGVEY   AHQ+      
Sbjct: 328 NGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKK 387

Query: 270 AGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVG 329
            GFKGS ANMSLGGGKS +LDL                 NENQDACNTSPA+A++AITVG
Sbjct: 388 KGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVG 447

Query: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389
           ASTLSD RAYFSNWG+CV +FAPGLNILSTYIGS +ATATLSGTSMASPH+AGL+ YFLS
Sbjct: 448 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLS 507

Query: 390 LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449
           LQP   S+F+  GQ  ++TP QLKKK++ + TK+ L D+P +TPN + YNG G+ L  FW
Sbjct: 508 LQPGSDSEFFELGQ-DSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566

Query: 450 ---------------NANDYVKNYQSLVITEQLQFILNKMNIF 477
                          N ++++ +   L+  EQ++ +L+K+NI 
Sbjct: 567 NDTKKSHPSGSKHELNMDEFIGSKTDLLF-EQVRDVLDKLNII 608

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  506 bits (1303), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 255/456 (55%), Positives = 316/456 (69%), Gaps = 18/456 (3%)

Query: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGG 93
           +IP+ YI+ F + V   EI  H +++++LQ QS+  LP+DH +F      D     L   
Sbjct: 124 IIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLD-----LQQP 178

Query: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153
           + D F I + L GY G FTD+V++F+RL+PLV+F+E+DS V+  E  TQ  APWGLARIS
Sbjct: 179 IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARIS 238

Query: 154 HRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNG 213
           HR RLNL +FNKYL+DD  G+GV AYVIDTG+N+ + DF GRA WGKTIP  + ++DGNG
Sbjct: 239 HRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNG 298

Query: 214 HGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGT--AG 271
           HGTH AGTIAS HYG            LRSNG+GSMSDVLKGVEY   +H  DV    +G
Sbjct: 299 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKKSG 358

Query: 272 FKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGAS 331
           FKGS ANMSLGGGKS SLDL                 NENQDACNTSPA+A+ AITVGAS
Sbjct: 359 FKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGAS 418

Query: 332 TLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQ 391
           TLSD RAYFSNWG+CV +FAPGLNILSTYIGS DATATLSGTSMASPH+AGL++YFLSLQ
Sbjct: 419 TLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQ 478

Query: 392 PAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWN- 450
           P   S+F +  +   ITP QLKK+++++GTK+ L D+P  TPNV+ +NGAG+ L DFWN 
Sbjct: 479 PEQDSEF-ATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFWNI 537

Query: 451 -------ANDYVKNYQSL--VITEQLQFILNKMNIF 477
                  +N+  KN   +  V+ +Q   I  KMN+ 
Sbjct: 538 SKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  507 bits (1306), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 259/480 (53%), Positives = 321/480 (66%), Gaps = 26/480 (5%)

Query: 16  LVLPEEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHE 75
           LV   +  PA++     ++IP  YI+VF +GV Q     H E++ Q QLQSV +L  +  
Sbjct: 137 LVSTAQFDPAAM----PKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDA 192

Query: 76  FFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVH 135
           FF IST     S    GG++D F I N   GY G FT E+++ +R +PLV F+ERDS+V 
Sbjct: 193 FF-ISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVE 251

Query: 136 TTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGR 195
            T+  TQ +APWGLARISHR RLNL +FNKYLYDD  G+GV +YVIDTG+N+ + DF  R
Sbjct: 252 ATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 311

Query: 196 AYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKG 255
           A WGKTIP  + ++DGNGHGTH AGTIAS HYG            LRSNG+G+MSDV+KG
Sbjct: 312 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKG 371

Query: 256 VEYVVGAHQRDV--GTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQD 313
           VEY   AHQ+       GFKGS ANMSLGGGKS +LDL                 NENQD
Sbjct: 372 VEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 431

Query: 314 ACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGT 373
           ACNTSPA+A++AITVGASTLSD RAYFSNWG+CV IFAPGLNILSTYIGS DATATLSGT
Sbjct: 432 ACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGT 491

Query: 374 SMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTP 433
           SMASPH+AGL+ YFLSLQP   S+F+  GQ  ++TP QLK K++ + TK+ L D+P +TP
Sbjct: 492 SMASPHVAGLLTYFLSLQPGSDSEFFEMGQ-DSLTPQQLKNKLIHYSTKDILFDVPEDTP 550

Query: 434 NVIAYNGAGKSLEDFWNANDYVKNYQSL----------------VITEQLQFILNKMNIF 477
           N + YNG G+ L  FW  ND  K++ S                 +I EQ++ +L+K+NI 
Sbjct: 551 NALIYNGGGQDLSAFW--NDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLDKLNII 608

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  502 bits (1292), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 252/473 (53%), Positives = 320/473 (67%), Gaps = 18/473 (3%)

Query: 20  EEVRPASLIT-PN-SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFF 77
           EEV+ A L++ P  + +IP+ YI+VF +  T  EIS H E +S+   +SV  L     FF
Sbjct: 61  EEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFF 120

Query: 78  TISTSS----DVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSM 133
             +  S     + +    GG+++ F I N L+GY G FTDEVV+F+R++  V+FIE+DS+
Sbjct: 121 AATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSL 180

Query: 134 VHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFG 193
           V  +E  TQ  APWGL+RISHR RLNL +FNKYLYDD  GKGV +YVIDTGIN+ + DF 
Sbjct: 181 VFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFN 240

Query: 194 GRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVL 253
           GRA WGKT+P  + + DGNGHGTH AGTIAS HYG            LRSNG+G+MSDV+
Sbjct: 241 GRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVV 300

Query: 254 KGVEYVVGAHQR--DVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNEN 311
           KGVE+   +HQ        GFKGS ANMSLGGGKS +LDL                 NEN
Sbjct: 301 KGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 360

Query: 312 QDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLS 371
           QDACNTSPAAAE AITVGASTLSD RAYFSNWG+CV IFAPGLN+LSTYIGS  ATATLS
Sbjct: 361 QDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420

Query: 372 GTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPAN 431
           GTSMASPH+AGL+ YFLSLQP   S+F+   QA+ ITP QLKKK++A+ TK+ L +LP +
Sbjct: 421 GTSMASPHVAGLLTYFLSLQPDSDSEFF---QASGITPAQLKKKLIAYSTKDVLYELPED 477

Query: 432 TPNVIAYNGAGKSLEDFWNANDY-------VKNYQSLVITEQLQFILNKMNIF 477
           TPN + YNG G+ L DFW  ++        +++++   ++E ++    K ++ 
Sbjct: 478 TPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLL 530

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  497 bits (1280), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 259/477 (54%), Positives = 321/477 (67%), Gaps = 30/477 (6%)

Query: 20  EEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTI 79
           E V P S I PN+   P+ YIVV     +  EI+LH+E ++Q QLQSV +L  D  FF+ 
Sbjct: 99  EGVAPLS-IPPNA--FPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSA 154

Query: 80  STSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEA 139
                       GG++D F +   L+GY G FTD VVE +R SP+V F+E DS VH +E 
Sbjct: 155 QGVR------TTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEF 208

Query: 140 TTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWG 199
            TQ  APWGL+RISHR RLNL +FNKYL+DD  GKGV +YVIDTGIN+ + DF GRA+WG
Sbjct: 209 DTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWG 268

Query: 200 KTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYV 259
           KTIP  + ++DGNGHGTH AGTIAS HYG            LRSNG+GSMSDV+KGVE+ 
Sbjct: 269 KTIPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFA 328

Query: 260 VGAHQRDV--GTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNT 317
             +HQ+ V     GFKGS ANMSLGGGKS +LDL                 NENQDACNT
Sbjct: 329 AQSHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNT 388

Query: 318 SPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMAS 377
           SPAAAE+A+TVGASTLSD RAYFSN+G+CV IFAPGLNILSTYIGS DATATLSGTSMAS
Sbjct: 389 SPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMAS 448

Query: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437
           PH+AGL+ YFLSLQP   S F+  G +  +TP+QLKKK++A+ TK+ L DLP +TPN + 
Sbjct: 449 PHVAGLLTYFLSLQPDSDSDFFDAG-SQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALI 507

Query: 438 YNGAGKSLEDFWNANDYVK--------NYQSL---------VITEQLQFILNKMNIF 477
           YNG G  L+ FW+ +D  +        + Q L          + +Q++ +L+++NI 
Sbjct: 508 YNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  500 bits (1287), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 256/481 (53%), Positives = 325/481 (67%), Gaps = 27/481 (5%)

Query: 16  LVLPEEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHE 75
           LV  E+  P ++    +++IP  YI+VF + V   E + H ET+ Q QLQSV +L  +  
Sbjct: 192 LVSTEQFNPDAI----TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247

Query: 76  FFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVH 135
           FF IST     S+   GG++D F I +   GY G FT E+V+ +R +PLV F+E+DS+V 
Sbjct: 248 FF-ISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVE 306

Query: 136 TTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGR 195
            T+  TQ +APWGLAR+SHR RLNL +FNKYLYDD  G+GV +YVIDTG+N+ + DF  R
Sbjct: 307 ATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 366

Query: 196 AYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKG 255
           A WGKTIP  + ++DGNGHGTH AGTIAS HYG            LRSNG+G+MSDVLKG
Sbjct: 367 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKG 426

Query: 256 VEYVVGAHQR--DVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQD 313
           VEY   AHQ+  +    GFKGS ANMSLGGGKS +LDL                 NENQD
Sbjct: 427 VEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 486

Query: 314 ACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGT 373
           ACNTSPA+A++AITVGASTLSD RAYFSN+G+CV +FAPGLNILSTYIGS +ATATLSGT
Sbjct: 487 ACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGT 546

Query: 374 SMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTP 433
           SMASPH+AGL+ YFLSLQP   S+F+  GQ  ++TP QLKKK++ + TK+ L D+P +TP
Sbjct: 547 SMASPHVAGLLTYFLSLQPGSDSEFFEMGQ-DSLTPQQLKKKLIHYSTKDILFDIPDDTP 605

Query: 434 NVIAYNGAGKSLEDFWNANDYVKNYQSL-----------------VITEQLQFILNKMNI 476
           N + YNG G+ L  FW  ND  K++ S                  +I EQ++ +L+K+NI
Sbjct: 606 NALIYNGGGQDLSAFW--NDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNI 663

Query: 477 F 477
            
Sbjct: 664 I 664

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  498 bits (1281), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 245/419 (58%), Positives = 295/419 (70%), Gaps = 7/419 (1%)

Query: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGG 93
           +IP  YIVVF + +   E+  H E ++Q+QL+S   LP D +FF+ S   D + N   GG
Sbjct: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESIN--QGG 155

Query: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153
           +   F I N L+GY G FTDEV+E +R++PLV+++E+DS+V  TE   Q NAPWGLARIS
Sbjct: 156 ILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARIS 215

Query: 154 HRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNG 213
           HR RLNL +FNKYLYDD  GKGV  YVIDTGIN  + DF  RA WGKTIP  + ++DGNG
Sbjct: 216 HRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNG 275

Query: 214 HGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQR--DVGTAG 271
           HGTH AGTIAS HYG            LRSNG+GSMSDV+KGVE+   +H +       G
Sbjct: 276 HGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKG 335

Query: 272 FKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGAS 331
           FKGS ANMSLGGGKS +LDL                 NENQDACNTSPA+AERAITVGAS
Sbjct: 336 FKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAS 395

Query: 332 TLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQ 391
           TLSD RAYFSNWG+CV IFAPGLNILSTYIG  DATATLSGTSMASPH+AGL+ YFLSLQ
Sbjct: 396 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQ 455

Query: 392 PAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWN 450
           P   S+F+     T +TP Q+KKK++ + +K+ L DLP  TPN + +NGAG +L+D WN
Sbjct: 456 PGSDSEFFD---PTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWN 511

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  491 bits (1265), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 242/421 (57%), Positives = 293/421 (69%), Gaps = 6/421 (1%)

Query: 33  EVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFF--TISTSSDVNSNGL 90
           + IP+ YIVVF + V   E+  H+E +S+   QSV  L  +  FF  T+     + +   
Sbjct: 78  DAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSR 137

Query: 91  LGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLA 150
            GG+ D F +   L GY G FT E+V+F+R++PLV F+E+DSMV+  E  TQ  APWGL+
Sbjct: 138 EGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197

Query: 151 RISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVD 210
           RISHR +LNL +FNKYLYDD  GKGV +YVIDTGINI + DF GRA WGKT+P  + + D
Sbjct: 198 RISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQD 257

Query: 211 GNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDV--G 268
           GNGHGTH AGTIAS HYG            LRSNG+GSMSDV+KGVE+   +HQ  V   
Sbjct: 258 GNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKN 317

Query: 269 TAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITV 328
             GFKGS ANMSLGGGKS +LD+                 NENQDACN+SPAAAE AITV
Sbjct: 318 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITV 377

Query: 329 GASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFL 388
           GASTL+D RAYFSNWG+CV IFAPGLN+LSTYIGS  ATATLSGTSMASPH+AGL+ YFL
Sbjct: 378 GASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFL 437

Query: 389 SLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDF 448
           SLQP   S+++    A  ITP QLKKK++A+ TKNAL DLP +T N + YNG G+ L+DF
Sbjct: 438 SLQPDSDSEYFH--AAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDF 495

Query: 449 W 449
           W
Sbjct: 496 W 496

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  494 bits (1271), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 313/449 (69%), Gaps = 25/449 (5%)

Query: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGG 93
           VIP  YI+VF + V+  ++ +H + +++ Q Q              ++ SD  S+ +LGG
Sbjct: 231 VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ-------------YASVSDETSSSILGG 277

Query: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153
           + + F + N  HGY G F +++V+F+RLSP+V F+E+DS+VH  E  TQ NAPWGLARIS
Sbjct: 278 IEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARIS 337

Query: 154 HRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNG 213
           HR  LNL ++NKYLYDD+ G+GV AYVIDTGINI + +FGGRA WGKTIP  + +VDGNG
Sbjct: 338 HRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNG 397

Query: 214 HGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDV--GTAG 271
           HGTH AGTIAS +YG            LRS+G+G+MSDVLKGVEY   +HQ+ +     G
Sbjct: 398 HGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKG 457

Query: 272 FKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGAS 331
           FKGS ANMSLGGGKSRSLDL                 NENQDACN+SPAA+E AITVGAS
Sbjct: 458 FKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGAS 517

Query: 332 TLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQ 391
           TLSD RAYFSNWG+CV +FAPGLNILSTYIGS +ATATLSGTSMASPH+AGL++YFLS+Q
Sbjct: 518 TLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQ 577

Query: 392 PAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWN- 450
           P   S+F+S G + +I+P QLKKK++A+ TKN  +DLP  TPN++ YN AG ++ DFW  
Sbjct: 578 PDADSEFFSSG-SNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKP 635

Query: 451 -------ANDYVKNYQSLVITEQLQFILN 472
                   N+  K ++   + +  Q+I +
Sbjct: 636 KSESSAEPNERAKEFELEDLVDSAQWIAD 664

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  494 bits (1271), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 258/492 (52%), Positives = 323/492 (65%), Gaps = 37/492 (7%)

Query: 22  VRPASLITP------------NSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTD 69
           ++ A LITP            +  ++P  YI+VF + +  +EIS H E +S++Q QS + 
Sbjct: 214 IKLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273

Query: 70  LPYDHEFFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIE 129
           LP  H FF  STS +   +   GG+   F I N L GY+G FT EV++ +RL+PLVK++E
Sbjct: 274 LPPHHHFFH-STSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVE 332

Query: 130 RDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITN 189
           RDS+V TTE  TQ NAPWGL+RISHR RLNL +FNKYLYDD  GKGV  +VIDTGIN+ +
Sbjct: 333 RDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNH 392

Query: 190 VDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSM 249
           VDFG RA WGKTIP+ + ++DGNGHGTH AGTIAS HYG            LRSNG+GSM
Sbjct: 393 VDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSM 452

Query: 250 SDVLKGVEYVVGAH-QRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXX 308
           SDV+KGVE+    H   +     +KGS ANMSLGGGKS +LDL                 
Sbjct: 453 SDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512

Query: 309 NENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGS-PDAT 367
           NENQDACN+SPA+AE AITVGASTLSD RAYFSNWG+CV +FAPGLNILSTY+G   D T
Sbjct: 513 NENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572

Query: 368 ATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD 427
           ATLSGTSMASPH+AGL+ YFLSLQP  KS F++      ITP+QLKKK++A+ T + L D
Sbjct: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632

Query: 428 LPANTPNVIAYNGAGKSLEDFWN-----------ANDYVKNYQSLVIT-----------E 465
           LP  TPN + YNGAG  + D WN           A++   N+++LV +           +
Sbjct: 633 LPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFD 692

Query: 466 QLQFILNKMNIF 477
           Q++ +  KMNI 
Sbjct: 693 QIRNVFEKMNII 704

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  488 bits (1255), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 305/458 (66%), Gaps = 8/458 (1%)

Query: 24  PASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSS 83
           P S +   +  IP  YI+VF +  + +E+  H E +S    +++  L  +  FFT ++  
Sbjct: 86  PLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGE 145

Query: 84  D----VNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEA 139
                V ++ L GG++D F I   L GY G FT EV++F+R SPLV+F+E DSMV +   
Sbjct: 146 HSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSF 205

Query: 140 TTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWG 199
            TQ +APWGLARISHR +LNL +FNKYLYDD  GKGV AYV+DTG+N+ + DF GRA WG
Sbjct: 206 NTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWG 265

Query: 200 KTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYV 259
           KTIP  + +VDGNGHGTH AGTI S+HYG            LRSNG+G+MSDV+KGVEYV
Sbjct: 266 KTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYV 325

Query: 260 VGAHQRDV--GTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNT 317
             AH++ V     GFKGS ANMSLGGGKS +LDL                 NENQDACNT
Sbjct: 326 AEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNT 385

Query: 318 SPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMAS 377
           SPAAAE AITVGASTLSD RAYFSNWG+CV IF PGLNILSTYIGS  ATATLSGTSMA+
Sbjct: 386 SPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMAT 445

Query: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437
           PH+ GL+ YFLSLQP   S+++    A  ITP QLKKK++ F TKN L DLP +T N + 
Sbjct: 446 PHVVGLLTYFLSLQPDADSEYFH--AAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLI 503

Query: 438 YNGAGKSLEDFWNANDYVKNYQSLVITEQLQFILNKMN 475
           YNG G+ L+D W  +  +    S      L+ ++N ++
Sbjct: 504 YNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLD 541

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  487 bits (1253), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 247/468 (52%), Positives = 310/468 (66%), Gaps = 20/468 (4%)

Query: 20  EEVRPASLITPNSE--VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFF 77
           E V  + L++ + +   IP+ YIVVF + ++  E+  H + +S+  LQSV  L   HEFF
Sbjct: 62  ESVELSPLVSSSGKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFF 121

Query: 78  TISTSSDVNSNGLL-------------GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPL 124
           T ST + V                   GG++D F +   L GY G FTDE+V+F+R++PL
Sbjct: 122 T-STENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPL 180

Query: 125 VKFIERDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTG 184
           V F+E+DS+V   E  TQ  APWGL+RISHR +LNL +FNKYLYDD  GKGV +YVIDTG
Sbjct: 181 VDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTG 240

Query: 185 INITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSN 244
           +N+ + DF GRA WGKTIP  + + DGNGHGTH AGTIAS HYG            LRSN
Sbjct: 241 VNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 300

Query: 245 GAGSMSDVLKGVEYVVGAHQRDV--GTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXX 302
           G+GSMSDV+KGVE+   +HQ  V     GFKGS ANMSLGGGKS +LD+           
Sbjct: 301 GSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIH 360

Query: 303 XXXXXXNENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIG 362
                 NENQDACN+SPA+AE A+TVGASTL+D RAYFSNWG+CV IFAPGLN+LSTYIG
Sbjct: 361 FAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG 420

Query: 363 SPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTK 422
           S  ATATLSGTSMASPH+AGL+ YFLSLQP   S+++    A  ITP QLKKK++A+ TK
Sbjct: 421 SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFH--AAGGITPSQLKKKLIAYSTK 478

Query: 423 NALRDLPANTPNVIAYNGAGKSLEDFWNANDYVKNYQSLVITEQLQFI 470
           N L D+P +T N + +NG G+ L+DFW     V   +  + +E   FI
Sbjct: 479 NVLGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFI 526

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  484 bits (1246), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 239/435 (54%), Positives = 307/435 (70%), Gaps = 7/435 (1%)

Query: 21  EVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTIS 80
           +++ ASL + NS  IP+ YIV+F +GVT  ++ +H + ++   ++++  L   H FF  +
Sbjct: 96  DMKLASL-SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDAT 154

Query: 81  TS---SDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTT 137
                  +++  + GG+ +MF+I   L GY G FTD +++ +R S LVK IE+DS+VH +
Sbjct: 155 EGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHAS 214

Query: 138 EATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAY 197
           +  TQ  APWGLAR+SHR RLNL +FNKYLYDD  GKGV AYVIDTGINI +V+F GRA 
Sbjct: 215 DFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQ 274

Query: 198 WGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVE 257
           WGKTIP+ +A+ DGNGHGTH AGTIAS  YG            LR+NG G+MSDVL+GVE
Sbjct: 275 WGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVE 334

Query: 258 YVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNT 317
           YVV  H++  G   FKGS ANMSLGGGKS +L+L                 NENQDACNT
Sbjct: 335 YVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNT 394

Query: 318 SPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMAS 377
           SPA++++ ITV ASTLSD RAYFSNWG CV IFAPGLNILSTYIGS  A ATLSGTSMAS
Sbjct: 395 SPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMAS 454

Query: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437
           PH+AGL+AYFLSLQP   S++Y+    ++I+P+ LKKKIVA+G+KN L ++PA T N + 
Sbjct: 455 PHVAGLLAYFLSLQPDSGSEYYT---GSSISPEALKKKIVAYGSKNLLNNVPARTANNLI 511

Query: 438 YNGAGKSLEDFWNAN 452
           +NG G SL+ FWN+ 
Sbjct: 512 FNGGGGSLDSFWNSK 526

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  479 bits (1232), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 243/437 (55%), Positives = 295/437 (67%), Gaps = 11/437 (2%)

Query: 20  EEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTI 79
           E+  P   +   +  IP+ YIVVF EGV+  E + H+E +     +SV  L   H FF  
Sbjct: 56  EQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFR- 114

Query: 80  STSSDVNSNGLL-----GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMV 134
           ST  + N  G+      GG+   F +G  L GY G FT+++V  LR +P V F+E DSMV
Sbjct: 115 STRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMV 174

Query: 135 HTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGG 194
             ++ TTQ  APWGLAR+SHR +LN  +FNKYLYDD  G+GV +YVIDTGINI +VDF  
Sbjct: 175 FASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFED 234

Query: 195 RAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLK 254
           RA WGKTIP  +A+ DGNGHGTH AGTIAS  YG            LRSNG GSMSDVL+
Sbjct: 235 RALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLR 294

Query: 255 GVEYVVGAHQRDVGTA--GFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQ 312
           GVEY V AH++    A  GFKGS ANMSLGGG+S++LDL                 NENQ
Sbjct: 295 GVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQ 354

Query: 313 DACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSG 372
           DACNTSPAA+++AITVGASTL+D RAYFSNWG+CV +FAPG+NILSTYIGS  A ATLSG
Sbjct: 355 DACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSG 414

Query: 373 TSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANT 432
           TSMASPH+AGL+ YFLSLQP   S+F ++     I+P+ LKKK++ FGTK+AL  LPA T
Sbjct: 415 TSMASPHVAGLLTYFLSLQPDGDSEFRNK---QTISPEVLKKKVIDFGTKDALSSLPART 471

Query: 433 PNVIAYNGAGKSLEDFW 449
            NV+ YNG G  L DFW
Sbjct: 472 ANVLIYNGGGADLSDFW 488

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  477 bits (1227), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 237/423 (56%), Positives = 296/423 (69%), Gaps = 13/423 (3%)

Query: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVN----SNG 89
           +IP+ YI+VF +GV++ +I  H E ++ L LQ  +    D   FT    +D+N       
Sbjct: 57  IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND---FTEYLQTDINVPESMRQ 113

Query: 90  LLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGL 149
            LGG+   F I + L GY    +DE++ F+RL+PL+ FIE D+MVHTT+  TQ NAPWGL
Sbjct: 114 SLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGL 173

Query: 150 ARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANV 209
           ARISHR  LNL+ FNKYLYDD  GK V AYVIDTG+++ +V+F  RA+WGKTIP  + ++
Sbjct: 174 ARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDI 233

Query: 210 DGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAH-QRDVG 268
           DGNGHGTHVAGTI S HYG            LRSNG+GSMSDV+KGVE+ V +H +R   
Sbjct: 234 DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKN 293

Query: 269 TAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITV 328
               KGSVANMSLGGGKS +LDL                 NENQ+ACN+SPA+AE+A+TV
Sbjct: 294 EKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTV 353

Query: 329 GASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGS-PDATATLSGTSMASPHIAGLVAYF 387
           GAST+SD RAYFSNWG+CV IFAPGLNILSTYIG+  D TATLSGTSMASPH+AGL+AY+
Sbjct: 354 GASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYY 413

Query: 388 LSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLED 447
           LSLQP   S+F ++    AI+  QLKKK++ + TK+ L DLP  TPNV+ YNG G+ L D
Sbjct: 414 LSLQPEKSSEFSTR----AISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSD 469

Query: 448 FWN 450
           FWN
Sbjct: 470 FWN 472

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  474 bits (1220), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 245/467 (52%), Positives = 308/467 (65%), Gaps = 11/467 (2%)

Query: 12  FCHALVLPEEVRPASLITPNSE--VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTD 69
           F   L    + R A L+ P     V+   YI++F +GV   EI  H E + Q+ LQ V+ 
Sbjct: 64  FASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQ 123

Query: 70  LPYDHEFFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIE 129
           LP +H FF      D   +  LGG+   F I   L GY+G F  +V++ +R+SPL++ +E
Sbjct: 124 LPEEHSFFE-GIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVE 182

Query: 130 RDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITN 189
           +DS+V+T +A T+  APWGLARISHR RLNL ++NKYLYD+ GG GV +YVIDTG+N+ +
Sbjct: 183 QDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHH 242

Query: 190 VDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSM 249
             FGGRA WGKTIPAG+ + DGNGHGTH AGTI S  YG            LRSNG+GSM
Sbjct: 243 NQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSM 302

Query: 250 SDVLKGVEYVVGAHQRDV--GTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXX 307
           SDVLKGVE+    HQ  V     GFKGS ANMSLGGGKS SLD                 
Sbjct: 303 SDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAA 362

Query: 308 XNENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDAT 367
            NE+QDACNTSPA+A   ITVGASTLSD RAYFSN+G+CV +FAPGLNILSTYIGS  +T
Sbjct: 363 GNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSST 422

Query: 368 ATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD 427
           ATLSGTSMASPH+AGL+AYFLSLQP   S+F +    ++I+PDQLKKK++AF TK+ L D
Sbjct: 423 ATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDA---GSSISPDQLKKKLLAFSTKDVLSD 479

Query: 428 LPANTPNVIAYNGAGKSLEDFWNANDYVKNYQSLVITEQLQFILNKM 474
           +P+ TPN++ YNG G  L  FW + +     Q L   E++   L+ +
Sbjct: 480 IPSGTPNLLIYNGGGGDLSGFWGSKEVA---QELEFNEKVDLELHDL 523

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  469 bits (1208), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 235/422 (55%), Positives = 295/422 (69%), Gaps = 10/422 (2%)

Query: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGL-LG 92
           ++P+ YIVV  +GV+   ++  +  +S     ++ DLP +H+FF       VN+ GL  G
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNF-----VNAEGLPRG 55

Query: 93  GVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARI 152
           G++D+F I +   G  G F + VV+ L  S +V+F+ERDS+VH +   TQ NAPWGLARI
Sbjct: 56  GIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARI 115

Query: 153 SHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGN 212
           SHR RLNL  FNKYLYD+ GG+GV AYVIDTGIN+ +V+F GRA WGKTIP  + ++DGN
Sbjct: 116 SHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGN 175

Query: 213 GHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDV-GTAG 271
           GHGTH AGTIAS HYG            L+S+G+G+MSDV+KGVEY   AH ++      
Sbjct: 176 GHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK 235

Query: 272 FKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGAS 331
           FKGS ANMSLGGGKS +LD+                 NENQDACNTSPA+AE+AITVGAS
Sbjct: 236 FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAS 295

Query: 332 TLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPD-ATATLSGTSMASPHIAGLVAYFLSL 390
           TLSD RAYFSNWG+CV IFAPGLNILSTYIG  +  TA+LSGTSMASPH+AGL+ YFLSL
Sbjct: 296 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSL 355

Query: 391 QPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLP-ANTPNVIAYNGAGKSLEDFW 449
           QP   S+FY   +   +TP QLKKK++A+ TKN L DLP  ++PN++ YNGAG  L  FW
Sbjct: 356 QPDSDSEFYDASK-HGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

Query: 450 NA 451
           N+
Sbjct: 415 NS 416

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  459 bits (1181), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 292/454 (64%), Gaps = 33/454 (7%)

Query: 38  NYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGGVRDM 97
            YI++F EGVT  +IS H + + Q+ L++                SDV++ G++  V D 
Sbjct: 97  KYIILFKEGVTAEQISAHKQLLQQVLLET----------------SDVSAQGIVADVLDS 140

Query: 98  FKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARISHRSR 157
           F +   L GY    +  V+E +R SP V+ +E+DS VHT E  TQ NAPWGLARISHR  
Sbjct: 141 FDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDP 200

Query: 158 LNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNGHGTH 217
           L+L +FNKYLYDD  G+GV +Y+IDTGIN+ + +F GRA WGKTIP  + + DGNGHGTH
Sbjct: 201 LSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTH 260

Query: 218 VAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGT--AGFKGS 275
            AGTIAS HYG            LRSNG+GSMSDV+ GVE+    H     +    FKGS
Sbjct: 261 CAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGS 320

Query: 276 VANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGASTLSD 335
            ANMSLGGGKS SLD                  NENQDACNTSPAA+ERAITVGASTLSD
Sbjct: 321 TANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSD 380

Query: 336 SRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVK 395
            RAYFSNWG CV IFAPGLNILSTY GS DATATLSGTSMASPH+AGL+ YFLSLQP   
Sbjct: 381 DRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKS 440

Query: 396 SQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWN----- 450
           SQF   G +  ITP+QLKKK++ + TK  L DLP +TPN + YNG G  L DFW      
Sbjct: 441 SQF---GTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKK 497

Query: 451 ------ANDYVKNYQSL-VITEQLQFILNKMNIF 477
                 A++Y   + S   + EQ++ +  K+NIF
Sbjct: 498 SHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  413 bits (1062), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 223/423 (52%), Positives = 284/423 (67%), Gaps = 26/423 (6%)

Query: 39  YIVVFNEGVTQNEISLHIETMSQL-QLQSVTDLPYDHEFFTISTSSDVNSNGLLGG---V 94
           YI+VF +GV + ++  H++ MS L +  S    P          ++   ++ L  G   V
Sbjct: 136 YIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRP----------AAAPGASALRDGFDRV 185

Query: 95  RDMFKIGNDLHGYTG-MFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153
            D F++     GY   + + ++V+F+RL+PLV ++E+DS+VH+ +  TQ NAPWGLARIS
Sbjct: 186 MDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARIS 244

Query: 154 HRSRLNLSTFNKYLY-DDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGN 212
           HR  LNL  FNKYLY  +  GKGV AYV+DTGI++++++FG RA WGKTIP  + ++DGN
Sbjct: 245 HREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGN 304

Query: 213 GHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAH------QRD 266
           GHGTH AGTI S HYG            LRS+G+G+MSDVLKGVE+V   H       R 
Sbjct: 305 GHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRK 364

Query: 267 VGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAI 326
              + +KG+ ANMSLGGGKS +LD                  NENQDACN+SPAAAE AI
Sbjct: 365 DKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAI 424

Query: 327 TVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAY 386
           TVGASTLSD RAYFSN+G+CV IFAPGLNILSTYIG+ DATATLSGTSMASPH+AGL+ Y
Sbjct: 425 TVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTY 484

Query: 387 FLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLE 446
            LSLQP   S+FY     + +TP Q+KKKI+ + TKNAL DLPA+TPN + YNG G +  
Sbjct: 485 LLSLQPDKGSEFYVPN--SELTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNST 541

Query: 447 DFW 449
           DFW
Sbjct: 542 DFW 544

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  396 bits (1018), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 263/420 (62%), Gaps = 7/420 (1%)

Query: 32  SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLL 91
           S+ +PY YI+VFNE +T   I  H + + + Q  SV+ +  D  F   + S+  + N   
Sbjct: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLR-TVSASASPNPQF 124

Query: 92  GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLAR 151
           GG+   F I     GYTG FTDEV+E +   PLVKFIE +S V  + ++ Q +APWGL R
Sbjct: 125 GGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHR 184

Query: 152 ISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDG 211
           ISHR R       +YLY+D  G GV +YV+DTGI+  + DF GRA WG  IP  +   D 
Sbjct: 185 ISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDL 244

Query: 212 NGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGTAG 271
           NGHGTH AG I S H+G            LRSNG G++SDV+KG+EYV   H       G
Sbjct: 245 NGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRG 304

Query: 272 --FKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVG 329
             FKGS AN+SLG  KS ++++                 NE++DAC +SPA AE++ITVG
Sbjct: 305 SKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVG 364

Query: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389
           AST SD RA+FSNWG CV +FAPG+NI+STYIGS +AT +LSGTSMA+PH+AG+++Y LS
Sbjct: 365 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLS 424

Query: 390 LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449
           LQPA  S+F+       ++P QLK+KI+ F T+  L D+   TPN + YNG GK L++FW
Sbjct: 425 LQPAQDSEFFYD----TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  395 bits (1016), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/423 (46%), Positives = 266/423 (62%), Gaps = 7/423 (1%)

Query: 29  TPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSN 88
           T  +E+IPY YIVVFNE ++   I  H + + +    SV+ L  D  F  + +SS +  +
Sbjct: 61  THKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSS-IAPD 119

Query: 89  GLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWG 148
             LGG+   F I     GY G FTDE++  +   PL+KFIE++S V  +  + Q +APWG
Sbjct: 120 LQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWG 179

Query: 149 LARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEAN 208
           L RISHR +       +YLY+D  G+GV +YV+DTGI+  + DF GRA WG  IP  +  
Sbjct: 180 LHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEA 239

Query: 209 VDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAH--QRD 266
            D NGHGTH AG I S HYG            LRSNG G++SDV+KG+EYV   H     
Sbjct: 240 SDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSR 299

Query: 267 VGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAI 326
             +  FKGS AN+SLG  KS ++++                 NEN+DAC +SPA A+++I
Sbjct: 300 KKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSI 359

Query: 327 TVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAY 386
           TVGAST SD RA+FSNWG CV +FAPG+NI+STYIGS +AT +LSGTSMA+PH+AG+++Y
Sbjct: 360 TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSY 419

Query: 387 FLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLE 446
           FLSLQPA  S+++      A++P +LK+K++ F T   L D+  NTPN + YNG GK L+
Sbjct: 420 FLSLQPAPDSEYFDN----ALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILD 475

Query: 447 DFW 449
           D W
Sbjct: 476 DLW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  394 bits (1013), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/421 (46%), Positives = 271/421 (64%), Gaps = 9/421 (2%)

Query: 31  NSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGL 90
            +E +PY YI+ F+E  +   I  H   + ++Q +SV+ L  D  FF +STS+   S+  
Sbjct: 63  KAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFF-VSTSAP--SDLQ 119

Query: 91  LGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLA 150
            GG+   F I     GYTG FT+EV++ +   P++KFIE++S V  T +T Q  APWGL 
Sbjct: 120 FGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLH 179

Query: 151 RISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVD 210
           RISHR +       +YLY+D  G+GV +YV+DTGI+I + DF GRA WG  IP  +   D
Sbjct: 180 RISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASD 239

Query: 211 GNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAH--QRDVG 268
            NGHGTH AG I S H+G            LRSNG G++SDV+KG+EYVV  H      G
Sbjct: 240 LNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKG 299

Query: 269 TAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITV 328
              FKGS AN+SLG  KS ++++                 NE++DAC +SPA AE++ITV
Sbjct: 300 GPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITV 359

Query: 329 GASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFL 388
           GAST SD RA+FS+WG CV +FAPG+NILSTYIGS +A+ +LSGTSMA+PH+AG+++YFL
Sbjct: 360 GASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFL 419

Query: 389 SLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDF 448
           SLQP+  S+F+     + ++P QLK+KI+ F T+  L D+  +TPN + YNG G+ L++F
Sbjct: 420 SLQPSSDSEFFD----STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475

Query: 449 W 449
           W
Sbjct: 476 W 476

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  386 bits (992), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 270/424 (63%), Gaps = 7/424 (1%)

Query: 28  ITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNS 87
           +   +E +PY Y++VFNE ++  +I  H++ + +    SV  L  +  F+ +  SS V+S
Sbjct: 60  VAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRV-ISSSVSS 118

Query: 88  NGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPW 147
               GG+ + F I     GYTG FTDE+++ +   P++KF+E+++ V  + ++ Q  APW
Sbjct: 119 KSQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPW 178

Query: 148 GLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEA 207
           GL R+SHR +       +YLY+D  GKGV +YV+DTGI+  + DF GRA WG  IPA + 
Sbjct: 179 GLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDE 238

Query: 208 NVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAH--QR 265
             D NGHGTH AG I S H+G            LRSNG G++SDV+KG+EYV   H    
Sbjct: 239 ASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESS 298

Query: 266 DVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERA 325
                 FKGS AN+SLG  KS ++++                 NE++DAC +SPA AE++
Sbjct: 299 KKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKS 358

Query: 326 ITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVA 385
           ITVGAST SD RA+FSNWG CV +FAPG+NI+STYIGS +AT +LSGTSMASPH+AG+++
Sbjct: 359 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILS 418

Query: 386 YFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSL 445
           YFLSLQPA  S+F++     A +P +LK+K++ F T+  L D+  +TPN + YNG GK L
Sbjct: 419 YFLSLQPAPDSEFFND----APSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKL 474

Query: 446 EDFW 449
           + FW
Sbjct: 475 DGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 197/420 (46%), Positives = 262/420 (62%), Gaps = 7/420 (1%)

Query: 31  NSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGL 90
           N  +IP  YIV+F + VT  EI  H+  + ++   S+     D +F   +  +D+++ G+
Sbjct: 70  NDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDISTRGI 127

Query: 91  LGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLA 150
             G++  F IG  + GY G FT+   +F+  SPLV+ +E DS+V       Q + PWGL 
Sbjct: 128 --GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLG 185

Query: 151 RISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVD 210
           RIS R +L +     Y YDD GGK    +VIDTGI + + DF GRA WGKTI   + + D
Sbjct: 186 RISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYD 245

Query: 211 GNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGT- 269
            NGHGTH AGTIAS HYG            LRS+G+GSMSDV++GVEY V A+     T 
Sbjct: 246 LNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTK 305

Query: 270 AGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVG 329
           +  KG+  NMSLG  KS +L+                  NE+ DACN+SPA+A   ITVG
Sbjct: 306 SNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVG 365

Query: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389
            STLSD  A+FSN+G+CV IFAPG+NI+STYIGS +AT +LSGTSM+SPH+AG++AY+LS
Sbjct: 366 GSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLS 425

Query: 390 LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449
           LQP  KSQFY   + +AI+P  LKKK++ + T   L  LPA T N++ YNG GK+L  FW
Sbjct: 426 LQPDHKSQFYH--EHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  359 bits (921), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 195/424 (45%), Positives = 254/424 (59%), Gaps = 21/424 (4%)

Query: 27  LITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVN 86
           L    +++I   YIV+F       E  LH +     QL++     Y +E+       D  
Sbjct: 52  LSAKQNDIIKDQYIVIFKNSAMMAEKELHFK-----QLKNFIKT-YSYEW---DEKDDHK 102

Query: 87  SNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAP 146
           SN       ++FKIG  L GY      E ++ LR  P+V+ IE DS VH  +   Q + P
Sbjct: 103 SN------LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTP 156

Query: 147 WGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGE 206
           WGL+RIS R R+ +     Y YDD     V AYV+DTGI I++  F GRA WGKTI   +
Sbjct: 157 WGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPND 216

Query: 207 ANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRD 266
            + D +GHGTHVAG IAS  +G            LRSNG G MSDVLKG+E+VV  H ++
Sbjct: 217 VDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKN 276

Query: 267 VGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAI 326
              +  KGSV N+SLG  KS +L L                 NEN DAC TSPA A RAI
Sbjct: 277 KNYS--KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAI 334

Query: 327 TVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAY 386
           TVGAS  SD RA+FSNWG+CV +FAPG+N++STYIGS +AT +LSGTS A+P+ AGL+AY
Sbjct: 335 TVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAY 394

Query: 387 FLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLE 446
           +LSLQP   S +++      +TP +LK+KIVAFG+K+ L +LP NTPN++ YNGAG++L 
Sbjct: 395 YLSLQPDKDSGYFT----GEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLS 450

Query: 447 DFWN 450
            FW 
Sbjct: 451 HFWK 454

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  335 bits (860), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/433 (43%), Positives = 247/433 (57%), Gaps = 30/433 (6%)

Query: 24  PASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSS 83
           P+++I   +  IP  YIV+F    T  +   H+ T++   L   TD  Y     TI  S 
Sbjct: 42  PSNIIHHAASPIPNQYIVLFKSDTTDIQRETHLATLNSWLLN--TDPQY-----TILHS- 93

Query: 84  DVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQY 143
                         F++ +DL GYT    ++++  L   P+++ IE+DS VH      Q 
Sbjct: 94  --------------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQI 139

Query: 144 NAPWGLARISHRSRLNLSTFNKYLYDDLGGKG-VKAYVIDTGINITNVDFGGRAYWGKTI 202
           ++PWGLARIS R RL L     Y YDD G     K Y++DTGIN  + +F GRA WG   
Sbjct: 140 DSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVF 199

Query: 203 PAGEANV-DGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVG 261
              E N  D NGHGTH AG I S  YG            L + G G MS V++G+EYV  
Sbjct: 200 TPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQ 259

Query: 262 AHQRDVGT---AGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTS 318
            H++D+      GFKGSV N+SLG GKS +L                   NE+ DAC+TS
Sbjct: 260 QHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTS 319

Query: 319 PAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSP-DATATLSGTSMAS 377
           PA +  A+TVGAS+ SD R +FSNWG CV +FAPG+NI+STYIG   + T +LSGTSM++
Sbjct: 320 PADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSA 379

Query: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437
           P + GL+AYFLSLQP  KSQFY+    T+ TP QLK KI++F T+  L ++P  TPN I 
Sbjct: 380 PFVTGLIAYFLSLQPDTKSQFYT--GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIV 437

Query: 438 YNGAGKSLEDFWN 450
           YNG G SL+DFWN
Sbjct: 438 YNGGGHSLKDFWN 450

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  310 bits (794), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/439 (42%), Positives = 245/439 (55%), Gaps = 36/439 (8%)

Query: 30  PNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNG 89
           P    IP  YIV+F    T  +IS   + +S L       +  D++ +      +VN N 
Sbjct: 58  PQKNFIPDQYIVLFENDTTDLQISRFEQFLSSL-------IEEDNQKY------NVNDN- 103

Query: 90  LLGGVRDMFKIGNDLHGYT------GMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQY 143
               V   F+I ND  G            D          ++K IERDS VH  + TTQ 
Sbjct: 104 -YSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQI 162

Query: 144 NAPWGLARISHRSRLNLSTFNKYLYDDLG-GKGVKAYVIDTGINITNVDFGGRAYWGKTI 202
           ++ WGL+RIS R+ L L     Y YDD G GKGV  Y++DTGIN  +++F GRA WG ++
Sbjct: 163 DSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSL 222

Query: 203 PAGEANV-DGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVG 261
           P  E ++ D NGHGTH AG I S  YG            L   G GSMSDV+ G+E+V  
Sbjct: 223 PVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAN 282

Query: 262 AHQRDVGT--------AGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQD 313
           +H              + FKGSV N+SLG  KS SLD+                 NE++D
Sbjct: 283 SHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDED 342

Query: 314 ACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIG-SPDATATLSG 372
           AC TSPA +   ITVGAS+ SD RA+FSNWG CV +FAPG+NI STYIG + + T +LSG
Sbjct: 343 ACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSG 402

Query: 373 TSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANT 432
           +SM+SP ++GL AY+LSLQP V SQF+     + +TPDQLK+KI+ F T   L++LP +T
Sbjct: 403 SSMSSPFVSGLTAYYLSLQPDVSSQFHD----SLMTPDQLKRKIIDFSTNGMLKELPLDT 458

Query: 433 PNVIAYNGAGKSLEDFWNA 451
            N + YNG GK L  FWNA
Sbjct: 459 ANKLVYNGGGKDLSGFWNA 477

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  279 bits (713), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 162/451 (35%), Positives = 243/451 (53%), Gaps = 18/451 (3%)

Query: 11  NFCHALVLPEEVRPASLITPNSE-------VIPYNYIVVFNEGVTQNEISLHIETMSQLQ 63
           NF      P  V+ A L+ P  E       ++PY YIV+F      NEI LHI+T+++LQ
Sbjct: 39  NFFKQSKRPGNVK-APLVAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQ 97

Query: 64  LQSVTDLPYDHEFFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSP 123
           L+    L  +  FF  +   +  S   LGGV   F IG+  +GY G FTDEVVEF+R   
Sbjct: 98  LRGSISLAPNDPFFHHTRDKEF-STEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQS 156

Query: 124 LVKFIERDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDT 183
           +V ++E DS++   +  T  N+ W LARISHR +L LS FN+Y +D  GG+ + AY++DT
Sbjct: 157 IVDYVEMDSILTIDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDT 216

Query: 184 GINITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRS 243
           G+  T+  +  R   G  I   E   D NGHGT +AG +     G            L  
Sbjct: 217 GVYQTHAYYIERTIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNW 276

Query: 244 NGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXX 303
            G G++S+++KG+ +V   H + +   G  G+V   S+ G KSRSL+             
Sbjct: 277 QGRGTVSNIIKGLSFVNHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHV 336

Query: 304 XXXXXNENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGS 363
                 +  +ACN+SPA++ + ITV   +++D      NWG CV I+ PG  + +TY   
Sbjct: 337 VVGAGTKGINACNSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNL 396

Query: 364 PDATAT----LSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAF 419
                T    ++G+S A+  +AGL+AYF SLQP + +          +TP++LK++++ F
Sbjct: 397 ERNQFTNEISVTGSSAAAAQVAGLLAYFASLQPGLGTP-----DVIPLTPEELKERLIDF 451

Query: 420 GTKNALRDLPANTPNVIAYNGAGKSLEDFWN 450
           GTK  L +L   +PN+IA+NGAG +L+ F+N
Sbjct: 452 GTKGKLTNLERMSPNIIAFNGAGGNLDSFFN 482

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  266 bits (679), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 204/352 (57%), Gaps = 16/352 (4%)

Query: 96  DMFKIGNDLHGYT-GMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARISH 154
           + F I ++L G+T   F    V FL   P V+ +E +S V+    T Q + PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 155 RSRLNLSTFNKYLYDDLG-GKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNG 213
           R R+ +     Y YD  G  K V  Y++DTGI + + +F GRA WGKTI   + + D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 214 HGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAH----QRDVGT 269
           HGTH AG +    YG            L + G G MSDV++G+E+ V  H    Q +V  
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDEV-- 252

Query: 270 AGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVG 329
              +GS+ N+SLG G+S +L                   NE+ +AC +SPA  +  +TVG
Sbjct: 253 ---RGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVG 309

Query: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIG-SPDATATLSGTSMASPHIAGLVAYFL 388
            ST SD RA+FSNWG C+ +FAPG+N+ S+Y+G + + T +LSGTS ++PH+AGL+AY L
Sbjct: 310 GSTFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLL 369

Query: 389 SLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNG 440
           SL+P  KSQF++        P QLK+K+V+  T+  L ++P +T N++ +NG
Sbjct: 370 SLEPDTKSQFHTAWS----NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  174 bits (441), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 126/372 (33%), Positives = 173/372 (46%), Gaps = 45/372 (12%)

Query: 104 LHGYTGMFTDEVVEFLRLSPLVK----------FIERDSMV--HTTEATTQYNAPWGLAR 151
             G+T  F  + VE L+ +PLV           F +++ +   ++     Q +AP  LAR
Sbjct: 61  FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLAR 120

Query: 152 ISHRSRLNLST-------FNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPA 204
           +S R  L  S        FN Y      G  V AY+IDTGI   + D GGRAY+G  +  
Sbjct: 121 LSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM-V 179

Query: 205 GEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQ 264
           GE   D NGHGTHVAG + S  +G            L + G G+++ V+  +E+ V  H 
Sbjct: 180 GEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVN-HC 238

Query: 265 RDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAER 324
           +  G       VAN+SLG  ++  L+                  N N +AC  SPA+A  
Sbjct: 239 KKSGML----CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAIS 294

Query: 325 AITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGL 383
           AITVGA    +D+ A FSNWG CV +FA G+ ++S     P      SGTSMASP +AGL
Sbjct: 295 AITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVAGL 354

Query: 384 VAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD----LPANTPNVIAYN 439
            A  L                + I P  +K+KI+   T+N  +         TPN IA+N
Sbjct: 355 AAVLLD---------------SGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFN 399

Query: 440 GAGKSLEDFWNA 451
           G  K  + F  A
Sbjct: 400 GVRKEDDIFEEA 411

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  173 bits (439), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 130/406 (32%), Positives = 188/406 (46%), Gaps = 63/406 (15%)

Query: 104 LHGYTGMFTDEVVEFLRLSPLV-------KFIERDSMVHTTEATTQYN------------ 144
             G T   + +VVE +R +PLV       +F   D ++   E    Y+            
Sbjct: 61  FRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNP 120

Query: 145 --------APWGLARISHRSRLNLS---------TFNKYLYDDLGGKGVKAYVIDTGINI 187
                   AP  LAR+S R+ L            +FN Y Y    G+ + AY+IDTGI  
Sbjct: 121 FKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYK 180

Query: 188 TNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAG 247
            + DF GRA +G+    GE   D NGHGTHVAG + S ++G            L + G G
Sbjct: 181 EHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQG 239

Query: 248 SMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXX 307
           +++ V+  VE+ V   +    ++G KG VAN+SLG  ++  ++                 
Sbjct: 240 NLTTVISAVEFAVNHCK----SSGKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAA 295

Query: 308 XNENQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDA 366
            N N +AC  SPA+A  AITVGA    +D+ A FSNWG CV IFA G+ + S     P  
Sbjct: 296 GNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHK 355

Query: 367 TATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALR 426
               SGTSMASP + GLVA  L                  + P+ +K K+V   T + L+
Sbjct: 356 PIAFSGTSMASPSVTGLVAILLD---------------KGVEPENIKAKLVELATHDLLQ 400

Query: 427 D----LPANTPNVIAYNGAGKSLEDFWNANDYVKNYQSLVITEQLQ 468
                    TPN IA+NG  +  +++ +A   + + +SLV  ++LQ
Sbjct: 401 RRTLFFKPGTPNRIAFNGMEREDDEYDDAVYPIVDLESLV--QELQ 444

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  169 bits (427), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 171/368 (46%), Gaps = 52/368 (14%)

Query: 114 EVVEFLRLSPLV-------KFIERDSMVHTTEA--------TTQYNAPWGLARISHRSRL 158
           ++V+ +R SPLV       +F+  D   H  E           Q  AP  L+R+S RS+L
Sbjct: 73  DLVDRIRRSPLVAEVVPNIQFVAYDE--HDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQL 130

Query: 159 NLS----------TFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEAN 208
                        +FN Y  +   G G+ AY+IDTGI   + +FGGRA +G+ +  GE  
Sbjct: 131 PYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGP 189

Query: 209 VDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVG 268
            DGNGHGTHVAG + S  YG            L + G G+++ V+  +E+ V   +   G
Sbjct: 190 GDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHCRSSEG 249

Query: 269 TAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITV 328
               KG V N+SLG  ++  ++                  N N +AC  SPA+A  AITV
Sbjct: 250 ----KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITV 305

Query: 329 GA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYF 387
           GA    +DS A FSNWG CV IFAPG+ + S            SGTSMASP I GL A  
Sbjct: 306 GAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAIL 365

Query: 388 LSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD----LPANTPNVIAYNGAGK 443
           L                  +  D++K  I+   T +  +         TPN +A+NG  K
Sbjct: 366 LD---------------EGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKK 410

Query: 444 SLEDFWNA 451
           + + F NA
Sbjct: 411 NDDKFSNA 418

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  169 bits (428), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 134/384 (34%), Positives = 179/384 (46%), Gaps = 58/384 (15%)

Query: 98  FKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTE------------------- 138
           F IG+   G+T   TD+++E ++ +PLV  +  +  VH  E                   
Sbjct: 62  FSIGS-FKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQ 120

Query: 139 -----ATTQYNAPWGLARISHRSRLNLSTFNK--------YLYDDLG-GKGVKAYVIDTG 184
                   QY AP  LAR+S R +L     +K        Y YD    G  V AY+ID+G
Sbjct: 121 KGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSG 180

Query: 185 INITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSN 244
           I + + +F GRA  G  +  GE + D NGHGTHVAG + S  YG            L   
Sbjct: 181 IYLEHEEFNGRAIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRL 239

Query: 245 GAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXX 304
           G GS++ VL G+E+ V  H ++    G    VAN+SLG  ++  L+              
Sbjct: 240 GQGSLAMVLGGIEFAV-KHCQETSKKG--RCVANLSLGSMRTAILNKAIKAAIDAGLVVV 296

Query: 305 XXXXNENQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGS 363
               N N +AC  SPA+A  AITVGA     D+ A FSNWGQC+ IFAPG+ I S  I  
Sbjct: 297 VAAGNNNLNACWYSPASAPEAITVGAFDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFK 356

Query: 364 PDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKN 423
                T SGTSMASP +AGL A  L            QG    ++ +++K  I+  GT N
Sbjct: 357 DKEDVTYSGTSMASPTVAGLAALTL-----------DQG----VSAEEVKDYILEMGTDN 401

Query: 424 AL--RDL--PANTPNVIAYNGAGK 443
               R L     TPN I +NG  +
Sbjct: 402 VFHRRSLLFKPGTPNKICFNGVKR 425

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  165 bits (418), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 120/324 (37%), Positives = 155/324 (47%), Gaps = 37/324 (11%)

Query: 142 QYNAPWGLARISHRSRL--------NLSTFNKYLYDD-LGGKGVKAYVIDTGINITNVDF 192
           QY AP  L RIS R +L            F  Y Y+D   G  + AY++DTGI   + DF
Sbjct: 154 QYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPDF 213

Query: 193 GGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDV 252
             R   G  +  GE   D NGHGTHVAG + S  +G            L   G+G+++ V
Sbjct: 214 ENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTTV 272

Query: 253 LKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQ 312
           L G+++ V  H R +     K  VANMSLG  ++  ++                  N N 
Sbjct: 273 LSGIQFAVD-HCRLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNSNV 331

Query: 313 DACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNI--LSTYIGSPDATAT 369
            AC TSPA+A+ AITVGA    +++ AYFSNWG CV IFAPG+ I  LS    S     T
Sbjct: 332 SACWTSPASAKNAITVGAFDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESHHKHVT 391

Query: 370 LSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDL- 428
            SGTSMASP +AGL A  L                  + P  +K K++   TK+    L 
Sbjct: 392 HSGTSMASPVVAGLAAILLD---------------KGVEPFDVKDKLLHLSTKDVFNKLT 436

Query: 429 ---PANTPNVIAYNGAGKSLEDFW 449
                 TPN IAYNG    +EDF+
Sbjct: 437 LFFKYGTPNKIAYNG----IEDFF 456

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  162 bits (409), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 157/345 (45%), Gaps = 55/345 (15%)

Query: 141 TQYNAPWGLARISHRSRLNL---------STFNKYLYDDLGGKGVKAYVIDTGINITNVD 191
           TQ  AP  LAR+S RS+L           S FN Y Y    G+ V AYV+D+G+ I + D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 192 FGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSD 251
           F GRAY+G        + D NGHGTHVAG I S  YG            L S G+G++  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 252 VLKGVEYVVG-----------------------AHQRDVGTAGFKGSVANMSLGGGKSRS 288
           V+ G+E+V                         +H  DV +   K  V N+SLG  +S  
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVES---KRCVINLSLGTFRSTI 335

Query: 289 LDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCV 347
           ++                  N N +AC TSPA+    ITVGA     DS A FSNWG CV
Sbjct: 336 INEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGAFDDRIDSIAKFSNWGNCV 395

Query: 348 SIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAI 407
            IFAPG+ + S     P      +GTSMA+P + GLVA  L                + I
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD---------------SGI 440

Query: 408 TPDQLKKKIVAFGTKNAL--RDL--PANTPNVIAYNGAGKSLEDF 448
            P Q+KK++    T N    R L     TPN IA+NG  +  +D+
Sbjct: 441 KPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDY 485

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  161 bits (407), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 119/325 (36%), Positives = 157/325 (48%), Gaps = 37/325 (11%)

Query: 142 QYNAPWGLARISHRSRL---------NLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDF 192
           Q NAP  LARIS RS L           S F+ Y  D   G  V AYVIDTGI   +  F
Sbjct: 133 QKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQF 192

Query: 193 GGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDV 252
            GRA +G  +  GE   D NGHGTHVAG I S  YG            L + G G+++ V
Sbjct: 193 QGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSV 251

Query: 253 LKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQ 312
           +  +E+ V  H R       +G VAN+SLG  ++  L+                  N N 
Sbjct: 252 ISAIEFTVN-HCRKSK----RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNSNA 306

Query: 313 DACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLS 371
           +AC +SPA++  AI+VGA    +D+ A FSNWG CV +FAPG+ I S     P  +   S
Sbjct: 307 NACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFKSVAYS 366

Query: 372 GTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGT-----KNALR 426
           GTSMASP + G+VA  L                + I P  +K++++   T     K AL 
Sbjct: 367 GTSMASPLVTGMVAVLLD---------------SGIHPFDIKEELINTATDSVFHKRALL 411

Query: 427 DLPANTPNVIAYNGAGKSLEDFWNA 451
             P  TPN +A+ G  K  + F +A
Sbjct: 412 FKPG-TPNRVAFTGVEKEDDIFEDA 435

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  159 bits (401), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 129/389 (33%), Positives = 177/389 (45%), Gaps = 57/389 (14%)

Query: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLV-------KFIERDS------MVHTT--- 137
           +   F IG+   G T   +  +V  L+ SPL+       KF   D+      M +TT   
Sbjct: 89  IEKKFSIGS-FRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKY 147

Query: 138 ---------EATTQYNAPWGLARISHRSRLNL---------STFNKYLYDDLGGKGVKAY 179
                      T Q +AP  LARIS   +L           S FN Y  D+  G+GV AY
Sbjct: 148 AYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAY 207

Query: 180 VIDTGINITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXX 239
           ++DTGI+  + +F  R   G  +   E   D NGHGTHVAG + S  +G           
Sbjct: 208 IMDTGIHAEHPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVK 266

Query: 240 XLRSNGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXX 299
            L  +G+G  S+VL G+E++V  H   V     K  VAN+SLG  +S  +++        
Sbjct: 267 VLGKDGSGEASNVLSGLEFIV-EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEE 325

Query: 300 XXXXXXXXXNENQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILS 358
                    N N DA   SPA+AE  ITVGA     D+ A FSNWG CV+IFAPG+ I S
Sbjct: 326 GIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIES 385

Query: 359 TYIGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVA 418
               + + +  LSGTSM++P + G+ A  LS                 I P+ + ++I  
Sbjct: 386 LSHLNDNESLVLSGTSMSTPIVTGVAAVLLS---------------KGIEPELIAQEIEY 430

Query: 419 FGTKNALRD----LPANTPNVIAYNGAGK 443
             T+N           +TPN I YNG  K
Sbjct: 431 LSTRNVFHRRTLFFKPSTPNQILYNGVDK 459

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  157 bits (397), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 117/340 (34%), Positives = 161/340 (47%), Gaps = 42/340 (12%)

Query: 142 QYNAPWGLARISHRSRL-----NLST----FNKYLYDDLGGKGVKAYVIDTGINITNVDF 192
           Q  AP  LARIS R+ L     N+S     F+ Y  D+  G  V AYVIDTGI   +   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 193 GGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDV 252
            GRA +G  +  GE   D NGHGTHVAG I S  +G            L + G G+++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 253 LKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQ 312
           +  +E+ V  H R       +G VAN+SLG  ++  L+                  N N 
Sbjct: 254 ISAIEFTVN-HCRK----SRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSNA 308

Query: 313 DACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLS 371
           +AC +SPA++  AITVGA    +D+ A FSNWG CV IFAPG+ I S     P      S
Sbjct: 309 NACWSSPASSLSAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKPVAFS 368

Query: 372 GTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD---- 427
           GTSMASP ++G+VA  L                + I P  +K +++   T +        
Sbjct: 369 GTSMASPIVSGMVANLLD---------------SGIHPFDIKTELIDLATDSVFHKRTLL 413

Query: 428 LPANTPNVIAYNGAGKSLEDFWNA-------NDYVKNYQS 460
               TPN +A+ G  K+ + + +A       +  VK+ QS
Sbjct: 414 FKPGTPNRVAFTGIDKTDDVYEDAVYPSVDIDRLVKDLQS 453

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  157 bits (396), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 129/395 (32%), Positives = 173/395 (43%), Gaps = 53/395 (13%)

Query: 90  LLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTE----------- 138
           L G +   F  G+   G T   T +VV  ++ +PLV  +  +  +H  +           
Sbjct: 52  LHGKISKTFSFGS-FRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYD 110

Query: 139 ---------------ATTQYNAPWGLARISHRSRLNLSTFNKYLYDDL---------GGK 174
                             Q  AP  LAR+S R  L     +K  Y+D           G 
Sbjct: 111 DIKQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGT 170

Query: 175 GVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXX 234
            V AY+ID+GI+I   +F GRA  G  +  GE   D NGHGTHVAG + S  YG      
Sbjct: 171 DVNAYIIDSGIDINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVT 229

Query: 235 XXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXX 294
                 L   G+GS+  V+  +E+VV       G +  K  VAN+SLG      L+    
Sbjct: 230 LVEVKALDRQGSGSLITVISALEFVVNH----CGKSKSKKCVANLSLGAFMMPLLNEAIK 285

Query: 295 XXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPG 353
                         N N DAC  SPA+ + AITVGA     D+ A FSNWG CV IFAPG
Sbjct: 286 ATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAFDDRIDTIAKFSNWGSCVDIFAPG 345

Query: 354 LNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLK 413
           + I S  I     +   SGTSMASP +AG+V+  + L   V+++          T D  +
Sbjct: 346 VAISSLSIKDNQKSVEFSGTSMASPQVAGIVS--ILLDQGVENEDIRDYLFELATDDVFQ 403

Query: 414 KKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDF 448
           K+ + F  +         TPN I +NG  K  EDF
Sbjct: 404 KRTLLFKPR---------TPNRITFNGISKKDEDF 429

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  156 bits (394), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 116/325 (35%), Positives = 156/325 (48%), Gaps = 32/325 (9%)

Query: 140 TTQYNAPWGLARISHRSRLNL---------STFNKYLYDDLGGKGVKAYVIDTGINITNV 190
           T Q +AP  LARIS   +L           S FN Y  DD  G+ V AY++DTGI   + 
Sbjct: 123 TYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHP 182

Query: 191 DFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMS 250
           +F  R   G  +   E   D NGHGTHVAG + S  YG            L  +G+G  S
Sbjct: 183 EFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEAS 241

Query: 251 DVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNE 310
           +VL G+E++V  H   V     K  VAN+SLG  +S  +++                 N 
Sbjct: 242 NVLSGLEFIV-EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 311 NQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATAT 369
           N DA   SPA+AE  ITVGA     D+ A FSNWG CV+IFAPG+ I S    + + T  
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTLV 360

Query: 370 LSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD-- 427
           LSGTSM++P + G+ A  LS                 I P+ + +++    T+N      
Sbjct: 361 LSGTSMSTPIVTGVAAVLLS---------------KGIEPEMIAQELEYLSTRNVFHRRT 405

Query: 428 --LPANTPNVIAYNGAGKSLEDFWN 450
                +TPN I YNG  K L+D ++
Sbjct: 406 LFFKPSTPNQILYNGVDK-LDDRYD 429

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  154 bits (389), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 127/380 (33%), Positives = 172/380 (45%), Gaps = 41/380 (10%)

Query: 92  GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEA------------ 139
           G +   F+IG +L G T   + +V++ ++  P VK +  + MV   E             
Sbjct: 50  GKINKRFQIG-ELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 140 TTQYNAPWGLARISHRSRLNLSTFNK--------YLYDDLG-GKGVKAYVIDTGINITNV 190
             Q  AP  LARIS R +L     NK        Y YD    G   +AY++DTG+   + 
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 191 DFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMS 250
           +F  R  +G T   GE   D NGHGTHVAG + S  +G            L + GAG++ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 251 DVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNE 310
            +L  +E+ V   Q    +      V NMSLG  KS  L+                  N 
Sbjct: 228 SILSALEFAVQDCQEHEDSQ----CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNF 283

Query: 311 NQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATAT 369
           N +AC TSP++A  AITVGA     D+ A FSNWG CV IFAPG+N+ S       +   
Sbjct: 284 NMNACWTSPSSATGAITVGAFDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPSFVK 343

Query: 370 LSGTSMASPHIAGLVAYFLSLQ-PAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDL 428
            SGTSMASP + G+VA  L    P    + Y Q  AT       KK+ + F         
Sbjct: 344 YSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELATDGV---FKKRTLVF--------- 391

Query: 429 PANTPNVIAYNGAGKSLEDF 448
              TPN + YNG  K  +++
Sbjct: 392 KPGTPNSVLYNGNKKHDDEY 411

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  154 bits (388), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 131/393 (33%), Positives = 175/393 (44%), Gaps = 61/393 (15%)

Query: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFI---------ERDSM-----VHTTEA 139
           +   F IG+   G T   +  +V  L+ SPLV  I         E DS+      +T  A
Sbjct: 49  IEKKFSIGS-FRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSYTFNA 107

Query: 140 TTQY---------------NAPWGLARISHRSRLNL---------STFNKYLYDDLGGKG 175
           T +Y               +AP  LARIS   +L           S FN Y   D  G+ 
Sbjct: 108 TAKYSYEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQD 167

Query: 176 VKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXX 235
           V AY++DTGI   + +F  R   G  +   E   D NGHGTHVAG + S  YG       
Sbjct: 168 VNAYIMDTGIFADHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNL 226

Query: 236 XXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXX 295
                L  +G+G  S+VL G+E++V  H   V     K  VAN+SLG  +S  +++    
Sbjct: 227 VEVKVLGKDGSGEASNVLSGLEFIV-EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEG 285

Query: 296 XXXXXXXXXXXXXNENQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGL 354
                        N N DA   SPA+AE  ITVGA     D+ A FSNWG CV+IFAPG+
Sbjct: 286 AIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGV 345

Query: 355 NILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKK 414
            I S    + + T  LSGTSM++P + G+ A  LS                 I P+ + +
Sbjct: 346 EIESLSHLNYNDTLILSGTSMSTPIVTGVAAILLS---------------KGIEPEMIAQ 390

Query: 415 KIVAFGTKNALRD----LPANTPNVIAYNGAGK 443
           +I    T+N           +TPN I YNG  K
Sbjct: 391 EIEYLSTRNVFHRRTLFFKPSTPNQILYNGVDK 423

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  152 bits (383), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 108/345 (31%), Positives = 159/345 (46%), Gaps = 36/345 (10%)

Query: 133 MVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDD---------LGGKGVKAYVIDT 183
           + ++ +   Q  AP  L+R+S R +L     N   YD+           G  V AY+IDT
Sbjct: 106 LTYSDKIIIQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDT 165

Query: 184 GINITNVDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRS 243
           GI   + +F GR  +   +   E   D NGHGTH+AG + S  +G            L  
Sbjct: 166 GIYKEHPEFEGRVKFAIDL-TQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDK 224

Query: 244 NGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXX 303
            G G +S +LK +E+ +   +  V     K  VAN+S G  ++  +D             
Sbjct: 225 KGQGQLSTILKALEFTIRHCKESVD----KKCVANLSFGAIRTAIIDEAIKEAHNAGIVL 280

Query: 304 XXXXXNENQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILS-TYI 361
                N N DAC  SPA+++  ITVGA    +++ A FSNWG CV +FAPG+ + S ++I
Sbjct: 281 VVAAGNSNIDACWNSPASSKDVITVGAFDDRTETIARFSNWGSCVDVFAPGVKVKSLSHI 340

Query: 362 GSPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGT 421
              D    LSGTSMASP ++G+ A  L                  + P  +K KI+   T
Sbjct: 341 NGSDVL-LLSGTSMASPSVSGIAAILLD---------------KGLNPKFVKSKIIESST 384

Query: 422 KNALRD----LPANTPNVIAYNGAGKSLEDFWNANDYVKNYQSLV 462
           KN        +  NTPN+I +NG  K  + F  A     +++ L+
Sbjct: 385 KNIFHQGTIMIKPNTPNLIVFNGIEKMDDSFEGARFPRIDFEGLI 429

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  151 bits (382), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 154/325 (47%), Gaps = 32/325 (9%)

Query: 140 TTQYNAPWGLARISHRSRLNL---------STFNKYLYDDLGGKGVKAYVIDTGINITNV 190
           T Q +AP  LARIS   +L           S FN Y  DD  G+ V AY++DTGI   + 
Sbjct: 172 TYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSDHP 231

Query: 191 DFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMS 250
           +F  R   G  +   E   D NGHGTHVAG + S  YG            L  +G+G  S
Sbjct: 232 EFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEAS 290

Query: 251 DVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNE 310
           +VL G+E++V  H   V     K  VAN+SLG  +S  +++                 N 
Sbjct: 291 NVLSGLEFIV-EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 349

Query: 311 NQDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATAT 369
           N DA   SPA+AE  ITVGA     D+ A FSNWG CV+IFAPG+ I S    + + T  
Sbjct: 350 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYEDTLI 409

Query: 370 LSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD-- 427
           LSGTSM++P + G+ A  LS                 I P  + ++I    T+N      
Sbjct: 410 LSGTSMSTPIVTGVAAVLLS---------------KGIEPALIAQEIEYLSTRNVFHRRT 454

Query: 428 --LPANTPNVIAYNGAGKSLEDFWN 450
                +T N I YNG  K L+D +N
Sbjct: 455 LFFKPSTANQILYNGVDK-LDDPYN 478

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  149 bits (377), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/365 (32%), Positives = 164/365 (44%), Gaps = 52/365 (14%)

Query: 114 EVVEFLRLSPLV---------KFIERDSMVHTTEATTQY-------NAPWGLARISHRSR 157
           +++E L+ +PLV         K  E D +    E T +Y        AP  LARIS R +
Sbjct: 77  KIMEKLKQNPLVADIVPNILFKAFENDEL--NNEQTQEYVSHVVQSEAPRHLARISRRDK 134

Query: 158 L-----NLST----FNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEAN 208
           L     N+S+    FN Y   +  G  V+AY++D+G++    DF GR  +G     G+  
Sbjct: 135 LPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDF-TGDGE 193

Query: 209 VDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVG 268
            D NGHGTHVAG + S  YG            L   G G++  VL  +E+ V     D  
Sbjct: 194 GDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVN----DCH 249

Query: 269 TAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITV 328
               K  VAN+SLG  K+  ++                  N N +AC TSPA+AE AITV
Sbjct: 250 EHPEKRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITV 309

Query: 329 GA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYF 387
           GA     D+ A FSNWG CV I+APG+ + S          + SGTSMASP + G VA  
Sbjct: 310 GAFDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQVAIL 369

Query: 388 LSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD----LPANTPNVIAYNGAGK 443
           L                  I  D +K  ++   T +  +        NTPN + +NG  K
Sbjct: 370 LD---------------KGIPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNGIEK 414

Query: 444 SLEDF 448
             + +
Sbjct: 415 EDDQY 419

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  146 bits (368), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 119/338 (35%), Positives = 158/338 (46%), Gaps = 35/338 (10%)

Query: 142 QYNAPWGLARISHRSRL-----NLSTFNK---YLYDD-LGGKGVKAYVIDTGINITNVDF 192
           Q  AP  LARIS R +L     N + F +   Y YDD   G+GV AYVIDTGI   + DF
Sbjct: 287 QRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKEHKDF 346

Query: 193 GGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDV 252
             R  +G  +  GE   D NGHGTHVAG I S  YG            +   G+  +S +
Sbjct: 347 EDRVEFGTDL-TGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQLSHI 405

Query: 253 LKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQ 312
           ++ +EY V      V     K  V NMSLG    + ++                  N N 
Sbjct: 406 IEAIEYTVNDCNSRVDK---KACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAAGNNNI 462

Query: 313 DACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLS 371
           DAC +SP +++ AITVGA     D  A FSNWG+CV IFA G+ + S     P      S
Sbjct: 463 DACWSSPGSSKNAITVGAFDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQVPYKYIKYS 522

Query: 372 GTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNAL--RDL- 428
           GTSMASP + G V+  L           SQG    + P+ +++++V   TK     R L 
Sbjct: 523 GTSMASPIVCGFVSILL-----------SQG----VKPNDVQEEMVKLSTKGDFTRRSLI 567

Query: 429 -PANTPNVIAYNGAG--KSLEDFWNANDYVKNYQSLVI 463
               T N I +NG     S E+    ND  ++Y+  +I
Sbjct: 568 FKPFTSNRILFNGMDPRDSYENDEMENDCGEDYEEEII 605

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 110/325 (33%), Positives = 150/325 (46%), Gaps = 35/325 (10%)

Query: 142 QYNAPWGLARISHRSRL--------NLSTFNKYLYDDL-GGKGVKAYVIDTGINITNVDF 192
           Q+ AP  L ++S R +L            F  Y YD    G     Y+IDTG+   + +F
Sbjct: 150 QFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKEF 209

Query: 193 GGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDV 252
           G R ++G     GE   D NGHGTHVAG I S  +G            L   G G+++ V
Sbjct: 210 GNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTSV 268

Query: 253 LKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQ 312
           L+G+E+ V   +      G K  V NMSLG  ++  ++                  N N 
Sbjct: 269 LEGIEFAVNNCKLKQQPMG-KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGNNNF 327

Query: 313 DACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLS 371
            AC TSPA++  AITVGA    +D+ A FSNWGQCV IFAPG+ I S      +     S
Sbjct: 328 SACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENGVIHS 387

Query: 372 GTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDL--- 428
           GTSMASP +AGLVA  +                     D++K+K++   +K+    L   
Sbjct: 388 GTSMASPIVAGLVAILME---------------KGYKCDEIKQKLIDDSSKSIFSKLTLF 432

Query: 429 -PANTPNVIAYNGAGKSLEDFWNAN 452
               TPN + YNG    +E+  N N
Sbjct: 433 FKYGTPNRVIYNG----IEEVINVN 453

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  143 bits (360), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 113/319 (35%), Positives = 157/319 (49%), Gaps = 31/319 (9%)

Query: 141 TQYNAPWGLARISHRSRL------NLSTFNKYLY-DDLGGKGVKAYVIDTGINITNVDFG 193
           +Q  AP  LARIS R++L      + S+  KY Y ++  G+GV  YV+D+G+N  + DF 
Sbjct: 153 SQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFE 212

Query: 194 GRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVL 253
           GRA  G     GE + D  GHGTHVAG I S  YG            L S G G++++++
Sbjct: 213 GRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNII 271

Query: 254 KGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRS-LDLXXXXXXXXXXXXXXXXXNENQ 312
           +G+EYVV    + +G    +  V NMSLG   + S LD                  N   
Sbjct: 272 EGLEYVV---NQCIGKK--RKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNSGL 326

Query: 313 DACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLS 371
           +AC  SPA   +AITV A    +D  A FSNWG C+ I+APG+N+ S        T  LS
Sbjct: 327 NACWYSPAKVRKAITVAAMDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-NKGRGTFVLS 385

Query: 372 GTSMASPHIAGLVAYFLS--LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLP 429
           GTSMASP +AG  A +L     PA   +  S+     +     KK+ +A   +       
Sbjct: 386 GTSMASPIVAGAAAIYLDQGADPAEVRKILSKTATRGV----FKKRAIAVRPR------- 434

Query: 430 ANTPNVIAYNGAGKSLEDF 448
             TPN + Y G  +  ++F
Sbjct: 435 --TPNKVLYTGNNQEDDEF 451

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 156/321 (48%), Gaps = 36/321 (11%)

Query: 142 QYNAPWGLARISHRSRLNLS-------TFNKYLYDDLGGKGVKAYVIDTGINITNVDFGG 194
           Q +AP  LAR   R+ L          TFN Y  ++  G+GV  YV+D+GI  ++ +F G
Sbjct: 428 QVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEFDG 487

Query: 195 RAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLK 254
           RA++G      E   D NGHGTHVAG + S  +G            +  +G GS S+++ 
Sbjct: 488 RAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNIIA 546

Query: 255 GVEYVVGAHQRDVGTAGFKGSVANMSLGG---GKSRSLDLXXXXXXXXXXXXXXXXXNEN 311
           GVE+ V  H +  G    K  VANMSLGG   G S +LD                  N  
Sbjct: 547 GVEFAV-KHCQQSG----KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGNSK 600

Query: 312 QDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATL 370
           + AC  SPA  + AITVGA    SD  A FSN+G+CV IFAPG+ + S      +    L
Sbjct: 601 ERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTMRVL 660

Query: 371 SGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTK---NALRD 427
           +GTSM++P  AG+VA  L            QG    I P ++K  +++  TK   +  R 
Sbjct: 661 NGTSMSAPITAGVVAVLL-----------DQG----IEPHEVKDHLLSISTKGLFHKRRL 705

Query: 428 LPANTPNVIAYNGAGKSLEDF 448
           + + TP+   + G  +  + F
Sbjct: 706 VSSRTPDRALFTGVKREDDSF 726

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  136 bits (343), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 113/327 (34%), Positives = 158/327 (48%), Gaps = 37/327 (11%)

Query: 142 QYNAPWGLARISHRSRLNLST-------FNKYLYDDLGGKGVKAYVIDTGINITNVDFGG 194
           Q  AP  LAR   RS L   T       FN Y   +  G+ V  Y++D+GI+ ++ +F G
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 195 RAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLK 254
           RA +G      E   D NGHGTHVAG + S  YG            +  +G GS S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 255 GVEYVVGAHQRDVGTAGFKGSVANMSLGG---GKSRSLDLXXXXXXXXXXXXXXXXXNEN 311
           GVE+ V  H +  G    K  VANMSLGG   G S +LD                  N  
Sbjct: 389 GVEFAV-KHCQQSG----KKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGNSK 442

Query: 312 QDACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATL 370
           + AC  SPA  + AITVGA    SD  A FSN+G+CV IFAPG+ + S      +    L
Sbjct: 443 ERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVRVL 502

Query: 371 SGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNAL---RD 427
           +GTSM++P  AG+VA  L            QG    +  + +K++++   TK      R 
Sbjct: 503 NGTSMSAPITAGVVAVLL-----------DQG----VKHEDVKERLIDLSTKGVFHRRRL 547

Query: 428 LPANTPNVIAYNGAGKSLEDFWNANDY 454
           + + TP+   +NG  +  +D +NA +Y
Sbjct: 548 VSSRTPDRTLFNGVPQE-DDVFNAIEY 573

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  117 bits (294), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 99/344 (28%), Positives = 163/344 (47%), Gaps = 22/344 (6%)

Query: 59  MSQLQLQSVTDLPYDHEFFTISTSSDV--------NSNGLLGGVRDMFKIGNDLHGYTGM 110
           +S L L++VT + +  E    S+ +D+        + NG +G +     +GN      G 
Sbjct: 6   LSLLGLKAVTAVQFIAELSDTSSVADILGERYAQMSDNGGVGAI----SLGNSFRAIYGD 61

Query: 111 FTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDD 170
           F   ++E L     +  +  D ++   E   Q +AP  LAR+S +S L  S    Y+Y  
Sbjct: 62  FPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLRGSD-GTYIYHS 120

Query: 171 LGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGE-ANVDGNGHGTHVAGTIASIHYGX 229
            GG GV  Y++DTGI+  + +  GR      + +   ++ D +GHGT VAG I S  +G 
Sbjct: 121 NGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVIGSATFGS 180

Query: 230 XXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSL 289
                        S G  ++  V++ +E     H   + +   + SV  +     K+  L
Sbjct: 181 AKKCNLFDVRVADSTGNATLIGVIRALE-----HASKLASVTQRPSVVVIPFTMRKNVIL 235

Query: 290 D-LXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGA--STLSDSRAYFSNWGQC 346
           +                   N NQ+AC++SPA+A  A+T+G+   T  DS A F+N+G C
Sbjct: 236 NSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTNYGDC 295

Query: 347 VSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSL 390
           +  FA G+NI S   G  ++    SGTS+++   +G+VAY++SL
Sbjct: 296 IDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  115 bits (288), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 106/358 (29%), Positives = 164/358 (45%), Gaps = 35/358 (9%)

Query: 58  TMSQLQLQSVTDLPYDHEFFTISTS-----SDVNSNGL--LGGVRDMFKIGNDLHGYTGM 110
           T++ L   S+  L   HE+    TS     S + SN L  L    D   IG+D HG++G 
Sbjct: 8   TVTGLFCWSILGLATAHEYVVQLTSETSLNSFLESNSLNNLDEPVDKIVIGSDFHGFSGE 67

Query: 111 FTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARISH---RSRLNLSTFNKYL 167
           F DEV+  L   P V  I  D M++  E   Q +AP  LAR+S+    SR++    N ++
Sbjct: 68  FEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSAKNENAFI 127

Query: 168 YDDLGGKGVKAYVIDTGINITNVDFGGRA------YWGKTIPAGEANVDGNGHGTHVAGT 221
           +    G GV  Y++D+GI+  +  F  R            IP G    D +GHGT +AG 
Sbjct: 128 FHSHAGIGVDVYIVDSGIDSQHPAFMNRHISKLIDLTDNPIPVG----DPHGHGTAIAGL 183

Query: 222 IASIHYGXXXXXXXXXXXXLRSNGAG-SMSDVLKGVEYVVGAHQRDVGTAGFKGSVANMS 280
           + S  +G            + +   G  +S +LK +E++   H R    A  + SVA + 
Sbjct: 184 VTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIEN-HSR----ATMRPSVAVLP 238

Query: 281 LGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVGASTLSDSR--- 337
               K+  L+                  N++  ACN SPA+A  + ++ +    D R   
Sbjct: 239 FSMSKNAILN-SAIESMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLDYRSSI 297

Query: 338 --AYFSNWGQCVSIFAPGLN---ILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSL 390
             A FSN+G+CV +F  G+    + +T     +  + +SGTSM+    AG V Y++SL
Sbjct: 298 EIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGYYMSL 355

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  111 bits (278), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 95/328 (28%), Positives = 150/328 (45%), Gaps = 37/328 (11%)

Query: 140 TTQYNAPWGLARISHRSRLNLS---TFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGR- 195
           +TQ+NAP  L+R S  ++L  +   T+N Y   D  G  V  YV+D+GI + + +F GR 
Sbjct: 143 STQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGRI 202

Query: 196 --AYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVL 253
             AY       G    D  GHGT VAG I S  YG            L + G G++  +L
Sbjct: 203 LEAYDFTDSGVG----DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSIL 258

Query: 254 KGVEYVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQD 313
           +G++++    + +  T G    + N SLG    + L+                  N   +
Sbjct: 259 QGLQFITKHCEEN--TNG--NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVN 314

Query: 314 ACNTSPAAAERAITVGA-STLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSG 372
           AC  +PA ++   TVG+     D+ A FSNWG+CV + APG+ + +    +   +   SG
Sbjct: 315 ACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSG 374

Query: 373 TSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD----- 427
           TS+++P + GL A  LS                 +  + L  +I   G+++ LR+     
Sbjct: 375 TSVSTPIVTGLAAILLS---------------KGVPKENLYDEIRKMGSRDLLRNKEFSR 419

Query: 428 LPANTPNVIAYNGAGKSLEDFWNANDYV 455
           LP  TPN+I   G  K  +D +  + Y+
Sbjct: 420 LPG-TPNLIVNIGPQKE-DDVYPDDAYI 445

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  103 bits (257), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 88/306 (28%), Positives = 141/306 (46%), Gaps = 13/306 (4%)

Query: 92  GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLAR 151
           GG      +GN      G F  +++E    S  +  +  D  +   E   Q +AP  LAR
Sbjct: 43  GGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLAR 102

Query: 152 ISHRSRL---NLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGE-A 207
           +S +S L   N S    Y+Y    G GV  Y++DTGI+ T+  F GR        +   A
Sbjct: 103 LSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVA 162

Query: 208 NVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDV 267
             D +GHGT VAG I S  +G              S G  S+  VL+ +E     H   +
Sbjct: 163 TGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALE-----HASKL 217

Query: 268 GTAGFKGSVANMSLGGGKSRSLD-LXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAI 326
                + S+  + L   ++  L+                   NEN+ AC+ SPA A  A+
Sbjct: 218 AAVTKRPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGAL 277

Query: 327 TVGASTLS--DSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLV 384
           T+G+  ++  D+ A F+N+ +CV +F  G+++ +  +    +   LSGTS+++   +GLV
Sbjct: 278 TIGSIDVARNDALAPFTNFAECVDLFTAGVDVATLGL-DHSSEHHLSGTSISAGVASGLV 336

Query: 385 AYFLSL 390
           AY++S+
Sbjct: 337 AYYMSI 342

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 131/304 (43%), Gaps = 25/304 (8%)

Query: 96  DMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARISHR 155
           +M  +G+      G F+ E +E+L     V  I RD  +   E   QY +P  L++    
Sbjct: 45  EMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQ---- 100

Query: 156 SRLNLSTFNKYLYDDLGGKGVKAYVIDTGIN-----ITNVDFGGRA-YWGKTIPAGEANV 209
               LS+   + +D + G  V  YV DTGI+     + NV+    A +    +P G    
Sbjct: 101 ----LSSGGSFTFDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRG---A 153

Query: 210 DGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGT 269
           D +GHGT +AG IAS  +G               +G   +S ++KG+   V AH R    
Sbjct: 154 DPHGHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASV-AHARFTK- 211

Query: 270 AGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAERAITVG 329
              + SV  + +  GK   +                   N+  DAC+ SP      + +G
Sbjct: 212 ---RPSVFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIG 268

Query: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNIL---STYIGSPDATATLSGTSMASPHIAGLVAY 386
           +    +  A FSN+G CV ++  G +IL   ST  G+     + +GTS +    AG+V Y
Sbjct: 269 SLDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGY 328

Query: 387 FLSL 390
            +S+
Sbjct: 329 HMSM 332

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/315 (27%), Positives = 135/315 (42%), Gaps = 30/315 (9%)

Query: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153
           + D+F++G+    +TG F+  +++ L   P V  I RD  +   E   Q NAP  L  +S
Sbjct: 45  ITDIFELGS-FRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 154 HRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYW------GKTIPAGEA 207
             S L   +   ++Y   GG GV  Y++DTGI+I + +                +P G  
Sbjct: 104 SISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQG-- 158

Query: 208 NVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDV 267
             D  GHGT +AG IAS  +G              SNG   +S +L+ +       QR +
Sbjct: 159 -TDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTLT----QRHI 213

Query: 268 -GTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPA----AA 322
            GT      V  + +  G +  L                   N  QDA N SPA      
Sbjct: 214 EGTKRPSVVVIPLEVEDGNNPILT-EAIASFDQSVPIIIPAGNNAQDALNFSPANVNPKP 272

Query: 323 ERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDA-------TATLSGTSM 375
           +  I VG+  ++++   F+N+G  V +F  G  I +      D+       T  +SGTS 
Sbjct: 273 KNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSA 332

Query: 376 ASPHIAGLVAYFLSL 390
           +S   AG++ Y++SL
Sbjct: 333 SSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 134/314 (42%), Gaps = 33/314 (10%)

Query: 98  FKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARISHRSR 157
            +IGN    ++G  + E V  +        I  +  +       Q +AP  L R++ +  
Sbjct: 53  IEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDS 111

Query: 158 LNLSTF----NKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWG------KTIPAGEA 207
           +  S +    N+Y++ D  G GV  Y++DTGI+I +  +               IP+G  
Sbjct: 112 IKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSG-- 169

Query: 208 NVDGNGHGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGA-GSMSDVLKGVEYVVGAHQRD 266
             D NGHGT +AG I S  +G            + +N    +MS VL  +  +    Q+ 
Sbjct: 170 --DFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSLIEKHEQKT 227

Query: 267 VGTAGFKGSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAER-- 324
           +     + S+  +     K+  L+                  N++Q+AC  SP   ++  
Sbjct: 228 M-----RPSIIVLPFQTEKNTILE-SAIENISKKIPVIIPAGNKHQNACKLSPMGIKKLS 281

Query: 325 -AITVGASTLSDSRAY-----FSNWGQCVSIFAPGLNILSTYI---GSPDATATLSGTSM 375
             + VG+   S+ + Y     FSN+G CV I+  G++I +      G  +    ++GTS 
Sbjct: 282 NVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSY 341

Query: 376 ASPHIAGLVAYFLS 389
           +   +AG+V Y++S
Sbjct: 342 SCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 123/308 (39%), Gaps = 24/308 (7%)

Query: 96  DMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARISHR 155
           +++ +G +   ++ +   + +  L     +  I  D  +   E   Q +AP  L ++   
Sbjct: 51  ELYSVGKNFQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLET 110

Query: 156 SRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGN--G 213
              +    N+++YD   G GV  Y+ DTGI   +               G    D     
Sbjct: 111 EAGD----NEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMPGMPGPPIRDQEILE 166

Query: 214 HGTHVAGTIASIHYGXXXXXXXXXXXXLRSNGAGSMSDVLKGVEYVVGAHQRDVGTAGFK 273
           HGT ++G I S  +G               NG   MS VLKG+  V    Q+ V     +
Sbjct: 167 HGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLNLV----QQHVKHTN-R 221

Query: 274 GSVANMSLGGGKSRSLDLXXXXXXXXXXXXXXXXXNENQDACNTSPAAAER---AITVGA 330
            SV N S    K+  L+                  N  Q  C+ SP   +R    +  G+
Sbjct: 222 PSVINFSYCTLKNAILN-SAFDNFPRDVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGS 280

Query: 331 STLSD---SRAYFSNWGQCVSIFAPGLNILSTYI------GSPDATATLSGTSMASPHIA 381
             ++D   + + FSN+G CV  +APG  +L+  I       S D    +SGTS +S   A
Sbjct: 281 LLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGA 340

Query: 382 GLVAYFLS 389
           G++ Y+++
Sbjct: 341 GVIGYYMA 348

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 168 YDDLGGKGVKAYVIDTGINITNVD----FGGRAYW--GKTIPAGEANVDGNGHGTHVAGT 221
           Y+++ G GV A ++D G++  N D    F     W      P  +  +  + HGT  AG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 222 IASI 225
           IA++
Sbjct: 245 IAAV 248

>Smik_2.285 Chr2 (519776..520612) [837 bp, 278 aa] {ON} YBR146W
           (REAL)
          Length = 278

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 396 SQFYSQGQATAITPDQLK-KKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWNANDY 454
           SQ+Y +   ++I PD +K K +  +G   A+    ++T  V    G G+ L +    NDY
Sbjct: 130 SQYYKK---SSILPDDIKIKTLDEYGRSMAIGKRKSSTSKVYVVRGTGEILVNGRQLNDY 186

Query: 455 ---VKNYQSLVITEQLQFILNKMNIF 477
              +K+ +S++   Q+   + K NIF
Sbjct: 187 FLKMKDRESIMYPLQVIESVGKYNIF 212

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 10/66 (15%)

Query: 168 YDDLGGKGVKAYVIDTGINITNVD----FGGRAYW----GKTIPAGEANVDGNGHGTHVA 219
           Y ++ GKGV A V+D G++  N D    F     W       +P  +  +  + HGT  A
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLP--KPTLADDYHGTRCA 209

Query: 220 GTIASI 225
           G IA++
Sbjct: 210 GEIAAV 215

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 aa]
           {ON} YMR019W (REAL)
          Length = 920

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 44/107 (41%), Gaps = 4/107 (3%)

Query: 23  RPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTS 82
           R   L  P SE+     +V   + +   +   H ET   L L  +       +   +S +
Sbjct: 556 RFYQLSLPASEMFEQMKLVKSKKFLQDEDDWFHEETFQMLDLSIIVTGFLKRDAQDLSLN 615

Query: 83  SDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIE 129
             V     LG   D F  GND++ Y G++      F ++ PL+ +++
Sbjct: 616 ETVQLRSQLGQWYDTFIAGNDINAYCGIYHG----FYKVQPLMTYLD 658

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,493,775
Number of extensions: 1928239
Number of successful extensions: 5010
Number of sequences better than 10.0: 70
Number of HSP's gapped: 4884
Number of HSP's successfully gapped: 73
Length of query: 477
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 364
Effective length of database: 40,524,141
Effective search space: 14750787324
Effective search space used: 14750787324
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)