Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.746.15ON25725711661e-163
NCAS0D026606.15ON2612547701e-103
KNAG0F028806.15ON2692327671e-102
NDAI0I022506.15ON2712617431e-98
KLLA0D01023g6.15ON2682297352e-97
KAFR0A050606.15ON2692357334e-97
CAGL0E02673g6.15ON2632627325e-97
Skud_15.1656.15ON2572457316e-97
TDEL0G045406.15ON2452147272e-96
KLTH0C11352g6.15ON2682607222e-95
Suva_15.1796.15ON2592277212e-95
YOR004W (UTP23)6.15ON2542537177e-95
SAKL0E01056g6.15ON2692297188e-95
ZYRO0C07920g6.15ON2932677182e-94
Smik_15.1736.15ON2512197054e-93
ACR011C6.15ON2532316977e-92
TPHA0J002806.15ON2712526962e-91
Kwal_56.223996.15ON2742276851e-89
Ecym_30196.15ON2662336535e-85
TBLA0A072906.15ON2592586319e-82
ZYRO0A06754g5.392ON1891461601e-12
KLTH0E02860g5.392ON1891451592e-12
TPHA0D023105.392ON1891451583e-12
Kpol_1055.185.392ON1891451574e-12
Kwal_55.200895.392ON1891451531e-11
KLLA0A07018g5.392ON1891431522e-11
CAGL0M01056g5.392ON1891451522e-11
TDEL0E023305.392ON1891461504e-11
NDAI0C045505.392ON1891451504e-11
Suva_2.5095.392ON1891441504e-11
Skud_4.6065.392ON1891441504e-11
Smik_4.5995.392ON1891441504e-11
YDR339C (FCF1)5.392ON1891441504e-11
SAKL0G07766g5.392ON1891431495e-11
AEL102W5.392ON1891431495e-11
NCAS0F030905.392ON1891451487e-11
KNAG0C052705.392ON1891451487e-11
KAFR0D042805.392ON1891451487e-11
Ecym_74695.392ON1891451479e-11
TBLA0H017505.392ON1891451452e-10
Kwal_56.22400singletonOFF51501343e-10
TPHA0F024306.31ON79865860.027
ZYRO0B09306g1.332ON1065112711.9
TPHA0F007404.125ON56749693.1
TPHA0P016602.32ON70248675.7
KLTH0E08360g4.129ON124281676.1
NDAI0A053803.321ON163054676.2
CAGL0H08393g3.284ON61244667.4
Smik_3.1936.377ON36443658.7
Kpol_495.195.622ON60717659.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Kpol_1045.74
         (774 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   453   e-163
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   301   e-103
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   300   e-102
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   290   1e-98
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   287   2e-97
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   286   4e-97
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   286   5e-97
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   286   6e-97
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   284   2e-96
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   282   2e-95
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   282   2e-95
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   280   7e-95
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   281   8e-95
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   281   2e-94
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   276   4e-93
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   273   7e-92
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   272   2e-91
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   268   1e-89
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   256   5e-85
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   247   9e-82
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    66   1e-12
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    66   2e-12
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    65   3e-12
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    65   4e-12
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    64   1e-11
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    63   2e-11
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    63   2e-11
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    62   4e-11
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    62   4e-11
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    62   4e-11
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    62   4e-11
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    62   4e-11
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    62   4e-11
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    62   5e-11
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    62   5e-11
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    62   7e-11
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    62   7e-11
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    62   7e-11
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    61   9e-11
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    60   2e-10
Kwal_56.22400 s56 complement(111071..111226) [156 bp, 51 aa] {OF...    56   3e-10
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    38   0.027
ZYRO0B09306g Chr2 (730191..733388) [3198 bp, 1065 aa] {ON} highl...    32   1.9  
TPHA0F00740 Chr6 (169745..171448) [1704 bp, 567 aa] {ON} Anc_4.1...    31   3.1  
TPHA0P01660 Chr16 complement(345369..347477) [2109 bp, 702 aa] {...    30   5.7  
KLTH0E08360g Chr5 complement(762740..766468) [3729 bp, 1242 aa] ...    30   6.1  
NDAI0A05380 Chr1 complement(1212670..1217562) [4893 bp, 1630 aa]...    30   6.2  
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...    30   7.4  
Smik_3.193 Chr3 complement(287624..288718) [1095 bp, 364 aa] {ON...    30   8.7  
Kpol_495.19 s495 (53075..54898) [1824 bp, 607 aa] {ON} (53075..5...    30   9.8  

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  453 bits (1166), Expect = e-163
 Identities = 231/257 (89%), Positives = 231/257 (89%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 541 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETESXXXXXXXXXSNANS 720
           D                 GPKQPNPLSMKKRKSKPASNEVEAETES         SNANS
Sbjct: 181 DEPKSEKSEKTSESKKNKGPKQPNPLSMKKRKSKPASNEVEAETESKKKRRRKHRSNANS 240

Query: 721 NESEIKHSDNENASDGE 771
           NESEIKHSDNENASDGE
Sbjct: 241 NESEIKHSDNENASDGE 257

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  301 bits (770), Expect = e-103
 Identities = 152/254 (59%), Positives = 184/254 (72%), Gaps = 1/254 (0%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVYNHTF+FREPYQ +VD+Q+V DC  S +D+ KGL RTLQAEVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALY+ ++Q AI +A+ FERRRCNH PKDPK+P+ECIES+V+I G NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHT-AG 537
           +QD+ IRRKLR++PGVP+VH+SRAVMI+EPLSDAS K+S+R E +KLYKGLND K+T   
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 538 LDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETESXXXXXXXXXSNAN 717
                              GPK PNPLSMKK+K +P  N  E  TE          S+ N
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQEPKRNR-EDSTED-------QESSEN 232

Query: 718 SNESEIKHSDNENA 759
             +   KH     A
Sbjct: 233 KKKRRRKHKPKTEA 246

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  300 bits (767), Expect = e-102
 Identities = 145/232 (62%), Positives = 181/232 (78%), Gaps = 7/232 (3%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVYNHTF+FREPYQ I+DD++VL   +SKFD+ K L+RT+QAEVK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALY T+N++AI +AK +ERRRCNHPPKDPKSP ECIES+VDIKG NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
            Q++D+RRKLR++PGVP++HVSRAVMI+EPLSDAS +IS+R+E+ KL+ GLND+K  AG+
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAK-AAGI 179

Query: 541 D-------XXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETE 675
                                    GPKQPNPLSMKK+K    S +    T+
Sbjct: 180 KAAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKKDGNSEQKNVGTK 231

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  290 bits (743), Expect = 1e-98
 Identities = 146/261 (55%), Positives = 186/261 (71%), Gaps = 5/261 (1%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVYNHTFKFR PYQ +VD+Q+VLDC  S +D+ KGLK TLQ+EVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALY+ +NQ+AI +A+ FERRRCNH PK+PK+ +ECIES+V+I G NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHT--- 531
           SQD+  RRKLR++PGVP++H+SRAVMI+EPLSD S ++S R E +KLYKGLND K T   
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 532 --AGLDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETESXXXXXXXXX 705
                +                 GPK PNPLSMKK+K+  ASN +    ++         
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKT--ASNSMNENIKN-----REGH 233

Query: 706 SNANSNESEIKHSDNENASDG 768
           ++AN ++S+ K      +  G
Sbjct: 234 NDANIDDSKKKRRRKHKSKTG 254

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  287 bits (735), Expect = 2e-97
 Identities = 140/229 (61%), Positives = 179/229 (78%), Gaps = 3/229 (1%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQMLVYNHTFKFR+PYQ +VDDQLVL+   S FD +KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQ+LY+T+NQ AI   K+FERRRCNH PK+PKS LEC+ S+VD+ G NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           +QD++IRR+LRKIPGVP+V+++R+VM++EPLS+AS K+S  +E+ KLYKGLND K  AG+
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKF-AGI 179

Query: 541 ---DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETES 678
              +                 GPK+PNPLSMKK+K+  ++  + + + S
Sbjct: 180 ARDENDEAGAENQENKPKKRKGPKEPNPLSMKKKKTTESTGSISSLSAS 228

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  286 bits (733), Expect = 4e-97
 Identities = 142/235 (60%), Positives = 181/235 (77%), Gaps = 11/235 (4%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+++V     S FD++KGLKRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALY+T +Q AI +AK FERRRCNHPPK+PK+P+EC+ S+V++ G NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQD+DIRR+LR++PGVP+VH+SR+VMI+EPLSD S KIS R+E++KLYKGLND K+ AGL
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKY-AGL 179

Query: 541 ----DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKR-------KSKPASNEVEAET 672
               +                 GPK PNPLS++K+       K    +++V+ ET
Sbjct: 180 KLDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKNDDVQEET 234

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  286 bits (732), Expect = 5e-97
 Identities = 143/262 (54%), Positives = 184/262 (70%), Gaps = 5/262 (1%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVYNHTFKFREPYQ ++DDQ+V+D   SK+D++K LKRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALY+T N+ AI + KEFERRRC H P +  SP ECI ++VD+KG NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA-- 534
            QD++IRR LRK+PGVP++H+SR+VMI+EPLSDAS K+S   E+ KL++GLND K+    
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 535 GLDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAET---ESXXXXXXXXX 705
           G                   GPKQPNPLSMKK+K +    E + ET   +S         
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQQTETSADQSQPTKRRRSR 240

Query: 706 SNANSNESEIKHSDNENASDGE 771
            + + +++    ++N N S+ E
Sbjct: 241 KHKHGSKNSTDTNENGNLSEEE 262

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  286 bits (731), Expect = 6e-97
 Identities = 140/245 (57%), Positives = 182/245 (74%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLV +C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP ECIES+VD+ G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQD+ +RRKLR +PGVP++H++R+VMI+EPLS AS K S++ E+ KL+KGLND  +    
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLND-PNVEKT 179

Query: 541 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETESXXXXXXXXXSNANS 720
           +                 GPK PNPLS+KK+K+   SNE + E ++           +++
Sbjct: 180 EKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAFKEKKRRRKHKSST 239

Query: 721 NESEI 735
           N+S I
Sbjct: 240 NKSAI 244

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  284 bits (727), Expect = 2e-96
 Identities = 140/214 (65%), Positives = 170/214 (79%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAK+YRKQMLVYNHTFKFREPYQ +VD+Q+VLDC  S FD++KGL+RTLQAEVKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALY+T+ Q AI +AK FERRRCNHPPK+PK P+EC+ESIV + G NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQD+D RR LR+ PGVP+VH  R+VM++EPLSDAS K+S   E +KL+KGLND ++ AG+
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRN-AGI 179

Query: 541 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSK 642
                               KQPNPLS+KKRK++
Sbjct: 180 KTENPQTSIKKR-------TKQPNPLSVKKRKTE 206

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  282 bits (722), Expect = 2e-95
 Identities = 138/260 (53%), Positives = 183/260 (70%), Gaps = 3/260 (1%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQMLVYNH FKFREPYQ +VDDQ+V D  ++ FD++KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCC+QA+Y+T NQ+AI +AK FERRRCNHPPK+ K P+EC++S+V + G+NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQD  IR+KLR++PGVP+++++R+VM++EPLS AS   S   EK+KL+KGLND K+ AGL
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKY-AGL 179

Query: 541 ---DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETESXXXXXXXXXSN 711
              +                 GPK PNPLS+KK+K+ P S +    ++            
Sbjct: 180 PAEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDESPPSDKISVTDAEPVDR 239

Query: 712 ANSNESEIKHSDNENASDGE 771
           ++S     +H    +   GE
Sbjct: 240 SSSGRRRRRHHKRSSTEAGE 259

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  282 bits (721), Expect = 2e-95
 Identities = 139/227 (61%), Positives = 176/227 (77%), Gaps = 1/227 (0%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLV +C  S FD+  GLKRTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP ECIES+V++ G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQD+D+RRKLR +PGVP++H++R+VMI+EPLS AS K S   E+ KLYKGLND  +    
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLND-PNIEKA 179

Query: 541 DXXXXXXXXXXXXXXXXXGPKQPNPLSM-KKRKSKPASNEVEAETES 678
           +                 GPK PNPLSM KK+K+ P+ +EV+ + ++
Sbjct: 180 EAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEVKDKDDA 226

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  280 bits (717), Expect = 7e-95
 Identities = 144/253 (56%), Positives = 181/253 (71%), Gaps = 1/253 (0%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLVL+C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCC+QALY+T N  AI++AK+FERRRCNH  KDPKSP ECIES+V+I G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQD+D+RRKLR +PGVP++H++R+VM++EPLS AS K S+  E+ KLYKGLND  +   L
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLND-PNIEKL 179

Query: 541 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKS-KPASNEVEAETESXXXXXXXXXSNAN 717
                             GPK PNPLS+KK+K     S+EV+ + ++         S   
Sbjct: 180 QESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKEDT---------SKEK 230

Query: 718 SNESEIKHSDNEN 756
                 KH  N N
Sbjct: 231 KKRRRRKHKSNTN 243

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  281 bits (718), Expect = 8e-95
 Identities = 140/229 (61%), Positives = 177/229 (77%), Gaps = 5/229 (2%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQMLVYNHTFKFREPYQ +VDDQ+V+   +S FD+ KGLKRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALY T +Q AI +AK +ERRRCNHPPK+ K+ LECIES+V+  G NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           +QD+DIRRKLR++PGVP+++++R+VM++EPLS+AS ++S+  E++KL+KGLND KH AGL
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH-AGL 179

Query: 541 ----DXXXXXXXXXXXXXXXXXGPKQPNPLSMK-KRKSKPASNEVEAET 672
                                 GPK+PNPLS+K KR  +  + +  AET
Sbjct: 180 AHDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKRDQREENTKAPAET 228

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  281 bits (718), Expect = 2e-94
 Identities = 144/267 (53%), Positives = 183/267 (68%), Gaps = 10/267 (3%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSY+KQMLVYN+ F+FREPYQ ++DDQLV DC +S +D++ GLKRTLQAEVK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQALY T NQ+AI + K FERRRCNHPPK+ K P ECI+S+V++ GSNKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQD+ +RRKLRK+PGVP++H+SR+VM++EPLS+AS +++E  E++KL KGLND K  AGL
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPK-LAGL 179

Query: 541 ----DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKP------ASNEVEAETESXXXX 690
                                 GPK PNPLS++K++ KP         E E E ES    
Sbjct: 180 KTTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQKKPEQQGQGQGQEQEQEHES---E 236

Query: 691 XXXXXSNANSNESEIKHSDNENASDGE 771
                +         KH  +    DG+
Sbjct: 237 REHEDAGKKKRRRRRKHKGSHEDGDGQ 263

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  276 bits (705), Expect = 4e-93
 Identities = 134/219 (61%), Positives = 171/219 (78%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLVL+C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP +CIES+VDI G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           SQD+ +RRKLR +PGVP++H++R+VM++EPLS AS K S+  E+ KLYKGLND  +   +
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLND-PNVDKV 179

Query: 541 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNE 657
                             GPK PNPLS+KK+K   ++++
Sbjct: 180 QEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSD 218

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  273 bits (697), Expect = 7e-92
 Identities = 137/231 (59%), Positives = 172/231 (74%), Gaps = 5/231 (2%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAK+Y+KQMLVYNHTFKFREPYQ +VDDQ+VL+  +S FD+LKGLKRTLQAEVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCCMQ LY T NQ+AI+  K +ERRRCNH  K+PK P+EC++S+V + G N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHT--A 534
           SQD+ IRR LRK+PGVP+V+++RAVM++EPLS  S ++S   EK KL+KGLND K+T  A
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 535 GLDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSK---PASNEVEAETES 678
                               GPK PNPLSMKKRK K   P S+  E + ++
Sbjct: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKADA 230

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  272 bits (696), Expect = 2e-91
 Identities = 136/252 (53%), Positives = 179/252 (71%), Gaps = 8/252 (3%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAE-VKV 177
           MRQ+RAKSY+KQM+VYNHTFKFREPYQ +VD+Q+V D  +S +++ + L++TLQAE +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 178 MITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVV 357
           MITQCCMQ LY T NQE I  AK FERRRCNH  KDPK PLECIESIV+I G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 358 ASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAG 537
           A+Q+M++RRKLR++PGVPI+H+SR+VMI+EP+SD+S++++ + E+ KLYKGLND K++  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 538 ---LDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKS----KPASNEVEAETESXXXXXX 696
               +                 G K+PNPLS KK+      KPA+   +A  +       
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKKVKVEIPKPAATTTDAANKKRRRKHR 240

Query: 697 XXXSNANSNESE 732
              ++ N NE E
Sbjct: 241 SNKNSENGNEGE 252

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  268 bits (685), Expect = 1e-89
 Identities = 131/227 (57%), Positives = 168/227 (74%), Gaps = 8/227 (3%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAKSYRKQMLVYNH FKFREPYQ +VDDQ+V D  ++ FD++KGLKRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCC+QA+Y+T++QEAI +AK FERRRCNHPPK+ K PLEC++S+V++ G NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSK----- 525
           +Q+ +IR  LRK+PGVP+V ++R+VM++EPLS AS  +S   E++KL+KGLND K     
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 526 ---HTAGLDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNE 657
                A                    GPK PNPLS+KK+K+  +  E
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSESRKE 227

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  256 bits (653), Expect = 5e-85
 Identities = 131/233 (56%), Positives = 172/233 (73%), Gaps = 8/233 (3%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 180
           MRQ+RAK+Y+KQMLVYNHTFKFR+PYQ +VDDQLVL+  +S FD+LKGLKRTLQAEVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 181 ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 360
           ITQCC+Q LY++ NQ AI+ AK +ERRRCNH  K+PK P ECI S+VDI G N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 361 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHT--- 531
           +QD++IRR LR++PGVP+++++R+VM++EPLS  S ++S+++E +KL KGLND K+    
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 532 -----AGLDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETE 675
                A +D                 GPK+PNPLS+K    KP  N+ +  +E
Sbjct: 180 NNTEDASVD---PKSPDANQLKRKIKGPKEPNPLSIK----KPRVNKAQLPSE 225

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  247 bits (631), Expect = 9e-82
 Identities = 127/258 (49%), Positives = 172/258 (66%), Gaps = 3/258 (1%)
 Frame = +1

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAE--VK 174
           MRQ+RAKSY+KQ++VYNHTFKFREPYQ I+DD LV +  ++K++++KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 175 VMITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYV 354
            MITQCC+ ALYK+++QE+ISI K FERRRCNH  K+P SP EC+ SIVD+ G NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 355 VASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA 534
           VA+QD+++RRKLRKIPGVP++H  R+VM++EPLSDAS + +E +E  KL  GLN +K + 
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180

Query: 535 GLDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETESXXXXXXXXXSNA 714
                                 K  NPLSMKK+ +  +++   +             SN+
Sbjct: 181 ---------EGGQENGIKKKKVKGVNPLSMKKKSNSNSNSNSNSN------------SNS 219

Query: 715 NSNESEIKHS-DNENASD 765
                 IKH  DNENA+D
Sbjct: 220 KPKPKPIKHERDNENATD 237

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 66.2 bits (160), Expect = 1e-12
 Identities = 43/146 (29%), Positives = 75/146 (51%), Gaps = 5/146 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    R PYQ ++D   +    Q K DI+KG+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD---DCLVNRV-----MQHKCYIVATNDAPLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSDA 462
           ++RKIPG+P++ V     ++E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 65.9 bits (159), Expect = 2e-12
 Identities = 41/145 (28%), Positives = 76/145 (52%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+  TL A+   MIT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C+H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD---DCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RK+PG+P++ V     ++E L D
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPD 187

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12
 Identities = 42/145 (28%), Positives = 71/145 (48%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L +      R PYQ ++D   +    Q K DI+KG+   L A+   +IT C M  L K  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQEAISIA----KEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +  I++        +R  C+H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCYIVATNDQGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RKIPG+P++ V     ++E L D
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPD 187

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 65.1 bits (157), Expect = 4e-12
 Identities = 40/145 (27%), Positives = 73/145 (50%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI+KG+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQEAISIA----KEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +  I++        +R  C+H         +CI + V      +H+ Y+VA+ D+ +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCYIVATNDVGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RK+PG+P++ V     ++E L D
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPD 187

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 63.5 bits (153), Expect = 1e-11
 Identities = 39/145 (26%), Positives = 76/145 (52%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K D+++G+  TL A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C+H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD---DCLVNRV-----LQHKCYIVATNDAALKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RK+PG+P++ V     ++E L D
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPD 187

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 63.2 bits (152), Expect = 2e-11
 Identities = 39/143 (27%), Positives = 74/143 (51%), Gaps = 5/143 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI+KG+   L A+  ++IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C+H         +CI     +    +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPL 453
           ++RK+PG+P++ V     ++E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 63.2 bits (152), Expect = 2e-11
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI+KG+   L A+   +IT C +  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RKIPG+P++ V     ++E L D
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPD 187

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 62.4 bits (150), Expect = 4e-11
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 5/146 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K D+++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 N--QEAISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
              + A+ +A++   +R  C H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSDA 462
           ++RKIPG+P++ V      +E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 62.4 bits (150), Expect = 4e-11
 Identities = 40/145 (27%), Positives = 75/145 (51%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K D+++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C+H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RKIPG+P++ V     ++E L D
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPD 187

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.4 bits (150), Expect = 4e-11
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVASQDMDIRRK 387
            +   A+ +A++   +R  C+H  K   +    +  ++  K      Y+VA+ D  ++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCLVHRVLQHK-----CYIVATNDAGLKQR 163

Query: 388 LRKIPGVPIVHVSRAVMILEPLSD 459
           +RKIPG+P++ V     ++E L D
Sbjct: 164 IRKIPGIPLMSVGGHAYVIEKLPD 187

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.4 bits (150), Expect = 4e-11
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVASQDMDIRRK 387
            +   A+ +A++   +R  C+H  K   +    +  ++  K      Y+VA+ D  ++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCLVHRVLQHK-----CYIVATNDAGLKQR 163

Query: 388 LRKIPGVPIVHVSRAVMILEPLSD 459
           +RKIPG+P++ V     ++E L D
Sbjct: 164 IRKIPGIPLMSVGGHAYVIEKLPD 187

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.4 bits (150), Expect = 4e-11
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVASQDMDIRRK 387
            +   A+ +A++   +R  C+H  K   +    +  ++  K      Y+VA+ D  ++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCLVHRVLQHK-----CYIVATNDAGLKQR 163

Query: 388 LRKIPGVPIVHVSRAVMILEPLSD 459
           +RKIPG+P++ V     ++E L D
Sbjct: 164 IRKIPGIPLMSVGGHAYVIEKLPD 187

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 62.4 bits (150), Expect = 4e-11
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVASQDMDIRRK 387
            +   A+ +A++   +R  C+H  K   +    +  ++  K      Y+VA+ D  ++++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCLVHRVLQHK-----CYIVATNDAGLKQR 163

Query: 388 LRKIPGVPIVHVSRAVMILEPLSD 459
           +RKIPG+P++ V     ++E L D
Sbjct: 164 IRKIPGIPLMSVGGHAYVIEKLPD 187

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 62.0 bits (149), Expect = 5e-11
 Identities = 39/143 (27%), Positives = 75/143 (52%), Gaps = 3/143 (2%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRRKL 390
            +   A+ +A++   +R N   K   +  +C+ + V      +H+ Y+VA+ D  +++++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD-DCLVNRV-----LQHKCYIVATNDAALKQRI 164

Query: 391 RKIPGVPIVHVSRAVMILEPLSD 459
           RK+PG+P++ V     ++E L D
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPD 187

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 62.0 bits (149), Expect = 5e-11
 Identities = 38/143 (26%), Positives = 75/143 (52%), Gaps = 3/143 (2%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K D+++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRRKL 390
            +   A+ +A++   +R N   K   +  +C+ + V      +H+ Y+VA+ D  +++++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD-DCLVNRV-----LQHKCYIVATNDAGLKQRI 164

Query: 391 RKIPGVPIVHVSRAVMILEPLSD 459
           RK+PG+P++ V     ++E L D
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPD 187

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 61.6 bits (148), Expect = 7e-11
 Identities = 39/145 (26%), Positives = 72/145 (49%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K D++KG+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 220 NQEAISIA----KEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +  I++        +R  C+H         +CI + V      +H+ ++VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCFIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RKIPG+P++ V     ++E L D
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPD 187

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 61.6 bits (148), Expect = 7e-11
 Identities = 39/145 (26%), Positives = 75/145 (51%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C +  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C+H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RKIPG+P++ V     ++E L D
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPD 187

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 61.6 bits (148), Expect = 7e-11
 Identities = 40/145 (27%), Positives = 75/145 (51%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C +  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C+H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RKIPG+P++ V     ++E L D
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPD 187

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 61.2 bits (147), Expect = 9e-11
 Identities = 39/145 (26%), Positives = 75/145 (51%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 220 NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
            +   A+ +A++   +R  C+H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD---DCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RK+PG+P++ V     ++E L D
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPD 187

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 60.5 bits (145), Expect = 2e-10
 Identities = 40/145 (27%), Positives = 75/145 (51%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 219
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C +  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 220 N--QEAISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 384
              + A+ +A++   +R  C+H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSD 459
           ++RKIPG+P++ V     ++E L D
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPD 187

>Kwal_56.22400 s56 complement(111071..111226) [156 bp, 51 aa] {OFF}
           [contig 185] FULL
          Length = 51

 Score = 56.2 bits (134), Expect = 3e-10
 Identities = 30/50 (60%), Positives = 34/50 (68%)
 Frame = -2

Query: 203 ACIQHCVIITLTSACNVRFKPFRISNFD*QQSKTNWSSTIA*YGSLNLKV 54
           A +QHCVI+ LTSAC VR +PF  SN     S T WSST   YGSLNLK+
Sbjct: 2   AWMQHCVIMGLTSACRVRLRPFTRSNAALCVSHTIWSSTRTWYGSLNLKL 51

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 37.7 bits (86), Expect = 0.027
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = +1

Query: 34  QMLVYNHTFKFREPYQAIVDDQLVLDCCQ--SKFDILKGLKRTLQAEVKVMITQCCMQAL 207
           Q L Y+H  KF + ++  ++  ++L+ C   S  D+LK  K   +AEVK M TQ C    
Sbjct: 145 QNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVCGAIN 204

Query: 208 YKTDN 222
           Y   N
Sbjct: 205 YMHSN 209

>ZYRO0B09306g Chr2 (730191..733388) [3198 bp, 1065 aa] {ON} highly
           similar to uniprot|P47047 Saccharomyces cerevisiae
           YJL050W MTR4 Dead-box family ATP dependent helicase
           required for mRNA export from the nucleus co- factor of
           the exosome complex required for 3' end formation of
           5.8S rRNA
          Length = 1065

 Score = 32.0 bits (71), Expect = 1.9
 Identities = 24/112 (21%), Positives = 48/112 (42%)
 Frame = +1

Query: 205 LYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVASQDMDIRR 384
           L+   N+E + + +  E  +     +D K PLE    + D + S+K       +  +  +
Sbjct: 6   LFDVFNEEPVQLPEVSEVPKIEDDKEDNKRPLETETDVEDGQKSSKKAKGDKKKLSEEDK 65

Query: 385 KLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 540
           K   +P V       A   ++P +     ++E+LEK+   K ++  +H   L
Sbjct: 66  KKAVVPVVTDAFEQEASREVDPSAGLMNNVNEQLEKEGRLKLMHQVRHQVAL 117

>TPHA0F00740 Chr6 (169745..171448) [1704 bp, 567 aa] {ON} Anc_4.125
           YAR002W
          Length = 567

 Score = 31.2 bits (69), Expect = 3.1
 Identities = 14/49 (28%), Positives = 26/49 (53%)
 Frame = +1

Query: 610 NPLSMKKRKSKPASNEVEAETESXXXXXXXXXSNANSNESEIKHSDNEN 756
           NP ++K  + K  SN ++   E          S + +N++ I+H++NEN
Sbjct: 407 NPSTLKNEEKKVESNSIKTLFEMKPVVNPSLPSLSKNNDATIEHNNNEN 455

>TPHA0P01660 Chr16 complement(345369..347477) [2109 bp, 702 aa] {ON}
           Anc_2.32 YDL233W
          Length = 702

 Score = 30.4 bits (67), Expect = 5.7
 Identities = 14/48 (29%), Positives = 27/48 (56%)
 Frame = +2

Query: 605 NQIH*V*RKENQSQLVMKLKLKLNQRKKEEESIDRMLTLMNQRLNIQI 748
           +Q+H   R  NQS   MK  + LNQ ++ ++ ++   ++ N  +N Q+
Sbjct: 32  DQMHGFDRNRNQSTGPMKQNMNLNQMQQRQQFVNYFKSMQNMMMNQQL 79

>KLTH0E08360g Chr5 complement(762740..766468) [3729 bp, 1242 aa] {ON}
            similar to uniprot|P39702 Saccharomyces cerevisiae
            YAL002W VPS8 involved in vacuolar protein sorting
            required for localization and trafficking of the CPY
            sorting receptor Vps8p is a membrane-associated
            hydrophilic protein which contains a C-terminal cysteine-
            rich region that conforms to the H2 variant of the RING
            finger Zn2 binding motif.
          Length = 1242

 Score = 30.4 bits (67), Expect = 6.1
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +1

Query: 10   RRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILK-GLKRTLQAEVKVMIT 186
            ++ + +R   L+Y H   F    +   +      C  S  DILK GL+ +L  + K    
Sbjct: 819  KKKRFHRPLFLIYKHQGAFAHMLELCANSDQADVCANSLLDILKFGLENSLHDKAKKQSL 878

Query: 187  QCCMQALYKTDNQEAISIAKE 249
               ++A +KT  ++ +S   E
Sbjct: 879  YGAIKANFKTIIEQDVSTVIE 899

>NDAI0A05380 Chr1 complement(1212670..1217562) [4893 bp, 1630 aa] {ON}
            Anc_3.321
          Length = 1630

 Score = 30.4 bits (67), Expect = 6.2
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 6/54 (11%)
 Frame = -1

Query: 369  ILRSHNISVLVGTFYIYNTFNTFQWRF------GILWRMITTTSFKLFSNTNCL 226
            IL+ + I+ ++ T   Y T +  +WRF        LW   T T++   S  NCL
Sbjct: 1563 ILKKNQITEIIQTMVDYTTSSRTRWRFQSIRIINRLWETRTITNYDDLSMFNCL 1616

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score = 30.0 bits (66), Expect = 7.4
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 634 FFSSYLMDLVV*VPYSSYFHWFFPIFPILVHLNQLCVLNHSNLY 503
           FF+SYL   +  V Y  Y  W+   F +L  LNQ+ + NH  +Y
Sbjct: 540 FFASYLAMPIWLVFYFGYMCWYKD-FTVLTDLNQVDLDNHRKVY 582

>Smik_3.193 Chr3 complement(287624..288718) [1095 bp, 364 aa] {ON}
           YCR095C (REAL)
          Length = 364

 Score = 29.6 bits (65), Expect = 8.7
 Identities = 18/43 (41%), Positives = 25/43 (58%)
 Frame = +2

Query: 602 NNQIH*V*RKENQSQLVMKLKLKLNQRKKEEESIDRMLTLMNQ 730
           NN+IH +  K N  +LV   K+  +   KE E   R+LTL+NQ
Sbjct: 228 NNRIHSIEYKGNSGKLV---KVNEDDLSKEPEVPQRLLTLINQ 267

>Kpol_495.19 s495 (53075..54898) [1824 bp, 607 aa] {ON}
           (53075..54898) [1824 nt, 608 aa]
          Length = 607

 Score = 29.6 bits (65), Expect = 9.8
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = -1

Query: 330 FYIYNTFNTFQWRFGIL 280
           F++ N FN F WR+GIL
Sbjct: 361 FFVANKFNKFSWRYGIL 377

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,342,520
Number of extensions: 1317789
Number of successful extensions: 4798
Number of sequences better than 10.0: 50
Number of HSP's gapped: 4746
Number of HSP's successfully gapped: 50
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 33 (17.3 bits)