Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.746.15ON25725712101e-170
KNAG0F028806.15ON2692197961e-106
NCAS0D026606.15ON2612197741e-103
NDAI0I022506.15ON2712257731e-103
KAFR0A050606.15ON2692157671e-102
KLLA0D01023g6.15ON2682167591e-101
Skud_15.1656.15ON2572457551e-100
Suva_15.1796.15ON2592217491e-100
SAKL0E01056g6.15ON2692297431e-98
Smik_15.1736.15ON2512127332e-97
ZYRO0C07920g6.15ON2932197372e-97
KLTH0C11352g6.15ON2682227301e-96
YOR004W (UTP23)6.15ON2542077263e-96
CAGL0E02673g6.15ON2632107273e-96
ACR011C6.15ON2532317221e-95
Kwal_56.223996.15ON2742227162e-94
TPHA0J002806.15ON2712527143e-94
TDEL0G045406.15ON2452137044e-93
Ecym_30196.15ON2662306465e-84
TBLA0A072906.15ON2591776222e-80
ZYRO0A06754g5.392ON1891461565e-12
KLTH0E02860g5.392ON1891461565e-12
TPHA0D023105.392ON1891461531e-11
Kpol_1055.185.392ON1891461522e-11
KLLA0A07018g5.392ON1891431503e-11
CAGL0M01056g5.392ON1891461485e-11
Kwal_55.200895.392ON1891461486e-11
Suva_2.5095.392ON1891461479e-11
Smik_4.5995.392ON1891461479e-11
YDR339C (FCF1)5.392ON1891461471e-10
Skud_4.6065.392ON1891461461e-10
TDEL0E023305.392ON1891461461e-10
NDAI0C045505.392ON1891461461e-10
NCAS0F030905.392ON1891461452e-10
KAFR0D042805.392ON1891461442e-10
KNAG0C052705.392ON1891461433e-10
Ecym_74695.392ON1891461423e-10
SAKL0G07766g5.392ON1891441424e-10
AEL102W5.392ON1891441415e-10
TBLA0H017505.392ON1891461407e-10
TPHA0F024306.31ON79856810.095
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.74
         (257 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   470   e-170
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   311   e-106
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   302   e-103
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   302   e-103
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   300   e-102
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   296   e-101
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   295   e-100
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   293   e-100
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   290   1e-98
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   286   2e-97
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   288   2e-97
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   285   1e-96
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   284   3e-96
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   284   3e-96
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   282   1e-95
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   280   2e-94
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   279   3e-94
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   275   4e-93
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   253   5e-84
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   244   2e-80
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    65   5e-12
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    65   5e-12
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    64   1e-11
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    63   2e-11
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    62   3e-11
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    62   5e-11
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    62   6e-11
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    61   9e-11
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    61   9e-11
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    61   1e-10
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    61   1e-10
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    61   1e-10
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    61   1e-10
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    60   2e-10
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    60   2e-10
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    60   3e-10
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    59   3e-10
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    59   4e-10
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    59   5e-10
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    59   7e-10
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    36   0.095

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  470 bits (1210), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/257 (89%), Positives = 231/257 (89%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 181 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETESXXXXXXXXXSNANS 240
           D                 GPKQPNPLSMKKRKSKPASNEVEAETES         SNANS
Sbjct: 181 DEPKSEKSEKTSESKKNKGPKQPNPLSMKKRKSKPASNEVEAETESKKKRRRKHRSNANS 240

Query: 241 NESEIKHSDNENASDGE 257
           NESEIKHSDNENASDGE
Sbjct: 241 NESEIKHSDNENASDGE 257

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  311 bits (796), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 177/219 (80%), Gaps = 8/219 (3%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVYNHTF+FREPYQ I+DD++VL   +SKFD+ K L+RT+QAEVK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALY T+N++AI +AK +ERRRCNHPPKDPKSP ECIES+VDIKG NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
            Q++D+RRKLR++PGVP++HVSRAVMI+EPLSDAS +IS+R+E+ KL+ GLND+K  AG+
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAK-AAGI 179

Query: 181 DXXXXXXXXXXXXXX-------XXXGPKQPNPLSMKKRK 212
                                    GPKQPNPLSMKK+K
Sbjct: 180 KAAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKK 218

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  302 bits (774), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/219 (65%), Positives = 174/219 (79%), Gaps = 1/219 (0%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVYNHTF+FREPYQ +VD+Q+V DC  S +D+ KGL RTLQAEVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALY+ ++Q AI +A+ FERRRCNH PKDPK+P+ECIES+V+I G NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA-G 179
           +QD+ IRRKLR++PGVP+VH+SRAVMI+EPLSDAS K+S+R E +KLYKGLND K+T   
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 180 LDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASN 218
                              GPK PNPLSMKK+K +P  N
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQEPKRN 219

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  302 bits (773), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 175/225 (77%), Gaps = 7/225 (3%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVYNHTFKFR PYQ +VD+Q+VLDC  S +D+ KGLK TLQ+EVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALY+ +NQ+AI +A+ FERRRCNH PK+PK+ +ECIES+V+I G NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHT--- 177
           SQD+  RRKLR++PGVP++H+SRAVMI+EPLSD S ++S R E +KLYKGLND K T   
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 178 AGLDXXXXXXXXXXXXXXXXX--GPKQPNPLSMKKRKSKPASNEV 220
           + +D                   GPK PNPLSMKK+K+  ASN +
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKT--ASNSM 223

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  300 bits (767), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 173/215 (80%), Gaps = 5/215 (2%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+++V     S FD++KGLKRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALY+T +Q AI +AK FERRRCNHPPK+PK+P+EC+ S+V++ G NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD+DIRR+LR++PGVP+VH+SR+VMI+EPLSD S KIS R+E++KLYKGLND K+ AGL
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKY-AGL 179

Query: 181 ----DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKR 211
               +                 GPK PNPLS++K+
Sbjct: 180 KLDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 173/216 (80%), Gaps = 4/216 (1%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQMLVYNHTFKFR+PYQ +VDDQLVL+   S FD +KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQ+LY+T+NQ AI   K+FERRRCNH PK+PKS LEC+ S+VD+ G NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           +QD++IRR+LRKIPGVP+V+++R+VM++EPLS+AS K+S  +E+ KLYKGLND K  AG+
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKF-AGI 179

Query: 181 ---DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKS 213
              +                 GPK+PNPLSMKK+K+
Sbjct: 180 ARDENDEAGAENQENKPKKRKGPKEPNPLSMKKKKT 215

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  295 bits (755), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 182/245 (74%), Gaps = 1/245 (0%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLV +C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP ECIES+VD+ G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD+ +RRKLR +PGVP++H++R+VMI+EPLS AS K S++ E+ KL+KGLND  +    
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP-NVEKT 179

Query: 181 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETESXXXXXXXXXSNANS 240
           +                 GPK PNPLS+KK+K+   SNE + E ++           +++
Sbjct: 180 EKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPSNETKGEDDAFKEKKRRRKHKSST 239

Query: 241 NESEI 245
           N+S I
Sbjct: 240 NKSAI 244

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  293 bits (749), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 139/221 (62%), Positives = 172/221 (77%), Gaps = 2/221 (0%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLV +C  S FD+  GLKRTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP ECIES+V++ G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD+D+RRKLR +PGVP++H++R+VMI+EPLS AS K S   E+ KLYKGLND  +    
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP-NIEKA 179

Query: 181 DXXXXXXXXXXXXXXXXXGPKQPNPLSM-KKRKSKPASNEV 220
           +                 GPK PNPLSM KK+K+ P+ +EV
Sbjct: 180 EAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKTGPSDDEV 220

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  290 bits (743), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 177/229 (77%), Gaps = 6/229 (2%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQMLVYNHTFKFREPYQ +VDDQ+V+   +S FD+ KGLKRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALY T +Q AI +AK +ERRRCNHPPK+ K+ LECIES+V+  G NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           +QD+DIRRKLR++PGVP+++++R+VM++EPLS+AS ++S+  E++KL+KGLND KH AGL
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKH-AGL 179

Query: 181 DXXXXX----XXXXXXXXXXXXGPKQPNPLSMK-KRKSKPASNEVEAET 224
                                 GPK+PNPLS+K KR  +  + +  AET
Sbjct: 180 AHDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKRDQREENTKAPAET 228

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  286 bits (733), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 167/212 (78%), Gaps = 1/212 (0%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLVL+C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCC+QALY+T N+ AI +AK+FERRRCNH  KDPKSP +CIES+VDI G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD+ +RRKLR +PGVP++H++R+VM++EPLS AS K S+  E+ KLYKGLND  +   +
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDP-NVDKV 179

Query: 181 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRK 212
                             GPK PNPLS+KK+K
Sbjct: 180 QEISEGSGKESVTKKRKFGPKAPNPLSVKKKK 211

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  288 bits (737), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 135/219 (61%), Positives = 171/219 (78%), Gaps = 5/219 (2%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSY+KQMLVYN+ F+FREPYQ ++DDQLV DC +S +D++ GLKRTLQAEVK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALY T NQ+AI + K FERRRCNHPPK+ K P ECI+S+V++ GSNKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD+ +RRKLRK+PGVP++H+SR+VM++EPLS+AS +++E  E++KL KGLND K  AGL
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPK-LAGL 179

Query: 181 DXXXXX----XXXXXXXXXXXXGPKQPNPLSMKKRKSKP 215
                                 GPK PNPLS++K++ KP
Sbjct: 180 KTTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQKKP 218

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  285 bits (730), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 173/222 (77%), Gaps = 4/222 (1%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQMLVYNH FKFREPYQ +VDDQ+V D  ++ FD++KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCC+QA+Y+T NQ+AI +AK FERRRCNHPPK+ K P+EC++S+V + G+NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD  IR+KLR++PGVP+++++R+VM++EPLS AS   S   EK+KL+KGLND K+ AGL
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKY-AGL 179

Query: 181 ---DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKSKPASNE 219
              +                 GPK PNPLS+KK+K+ P S +
Sbjct: 180 PAEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKD 221

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  284 bits (726), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 163/207 (78%), Gaps = 1/207 (0%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+QLVL+C  S F++  GLKRTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCC+QALY+T N  AI++AK+FERRRCNH  KDPKSP ECIES+V+I G+NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD+D+RRKLR +PGVP++H++R+VM++EPLS AS K S+  E+ KLYKGLND  +   L
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDP-NIEKL 179

Query: 181 DXXXXXXXXXXXXXXXXXGPKQPNPLS 207
                             GPK PNPLS
Sbjct: 180 QESGDGSGKESITKKRKLGPKAPNPLS 206

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  284 bits (727), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 132/210 (62%), Positives = 161/210 (76%), Gaps = 2/210 (0%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVYNHTFKFREPYQ ++DDQ+V+D   SK+D++K LKRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALY+T N+ AI + KEFERRRC H P +  SP ECI ++VD+KG NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA-- 178
            QD++IRR LRK+PGVP++H+SR+VMI+EPLSDAS K+S   E+ KL++GLND K+    
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 179 GLDXXXXXXXXXXXXXXXXXGPKQPNPLSM 208
           G                   GPKQPNPLSM
Sbjct: 181 GEHEEEEQSKEQTVAKKRKIGPKQPNPLSM 210

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  282 bits (722), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 172/231 (74%), Gaps = 6/231 (2%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAK+Y+KQMLVYNHTFKFREPYQ +VDDQ+VL+  +S FD+LKGLKRTLQAEVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQ LY T NQ+AI+  K +ERRRCNH  K+PK P+EC++S+V + G N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD+ IRR LRK+PGVP+V+++RAVM++EPLS  S ++S   EK KL+KGLND K+T   
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 DXXXXXXX--XXXXXXXXXXGPKQPNPLSMKKRKSK---PASNEVEAETES 226
           +                   GPK PNPLSMKKRK K   P S+  E + ++
Sbjct: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKADA 230

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  280 bits (716), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 168/222 (75%), Gaps = 10/222 (4%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAKSYRKQMLVYNH FKFREPYQ +VDDQ+V D  ++ FD++KGLKRTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCC+QA+Y+T++QEAI +AK FERRRCNHPPK+ K PLEC++S+V++ G NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           +Q+ +IR  LRK+PGVP+V ++R+VM++EPLS AS  +S   E++KL+KGLND K  AGL
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKF-AGL 179

Query: 181 DXXXXXXXXXXXX---------XXXXXGPKQPNPLSMKKRKS 213
                                      GPK PNPLS+KK+K+
Sbjct: 180 PLTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKT 221

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  279 bits (714), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 136/252 (53%), Positives = 179/252 (71%), Gaps = 8/252 (3%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAE-VKV 59
           MRQ+RAKSY+KQM+VYNHTFKFREPYQ +VD+Q+V D  +S +++ + L++TLQAE +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVV 119
           MITQCCMQ LY T NQE I  AK FERRRCNH  KDPK PLECIESIV+I G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAG 179
           A+Q+M++RRKLR++PGVPI+H+SR+VMI+EP+SD+S++++ + E+ KLYKGLND K++  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 ---LDXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKS----KPASNEVEAETESXXXXXX 232
               +                 G K+PNPLS KK+      KPA+   +A  +       
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKKVKVEIPKPAATTTDAANKKRRRKHR 240

Query: 233 XXXSNANSNESE 244
              ++ N NE E
Sbjct: 241 SNKNSENGNEGE 252

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  275 bits (704), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 140/213 (65%), Positives = 169/213 (79%), Gaps = 8/213 (3%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAK+YRKQMLVYNHTFKFREPYQ +VD+Q+VLDC  S FD++KGL+RTLQAEVKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCCMQALY+T+ Q AI +AK FERRRCNHPPK+PK P+EC+ESIV + G NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           SQD+D RR LR+ PGVP+VH  R+VM++EPLSDAS K+S   E +KL+KGLND ++ AG+
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRN-AGI 179

Query: 181 DXXXXXXXXXXXXXXXXXGPKQPNPLSMKKRKS 213
                               KQPNPLS+KKRK+
Sbjct: 180 KTENPQTSIKKRT-------KQPNPLSVKKRKT 205

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  253 bits (646), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 170/230 (73%), Gaps = 10/230 (4%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60
           MRQ+RAK+Y+KQMLVYNHTFKFR+PYQ +VDDQLVL+  +S FD+LKGLKRTLQAEVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120
           ITQCC+Q LY++ NQ AI+ AK +ERRRCNH  K+PK P ECI S+VDI G N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180
           +QD++IRR LR++PGVP+++++R+VM++EPLS  S ++S+++E +KL KGLND K+    
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 DXXXXXXX-----XXXXXXXXXXGPKQPNPLSMKKRKSKPASNEVEAETE 225
           +                      GPK+PNPLS+K    KP  N+ +  +E
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIK----KPRVNKAQLPSE 225

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  244 bits (622), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 144/177 (81%), Gaps = 2/177 (1%)

Query: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAE--VK 58
           MRQ+RAKSY+KQ++VYNHTFKFREPYQ I+DD LV +  ++K++++KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  VMITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYV 118
            MITQCC+ ALYK+++QE+ISI K FERRRCNH  K+P SP EC+ SIVD+ G NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSK 175
           VA+QD+++RRKLRKIPGVP++H  R+VM++EPLSDAS + +E +E  KL  GLN +K
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    R PYQ ++D   +    Q K DI+KG+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD---DCLVNRV-----MQHKCYIVATNDAPLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+  TL A+   MIT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD---DCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RK+PG+P++ V     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L +      R PYQ ++D   +    Q K DI+KG+   L A+   +IT C M  L K  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCYIVATNDQGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI+KG+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +CI + V      +H+ Y+VA+ D+ +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCYIVATNDVGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RK+PG+P++ V     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 74/143 (51%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI+KG+   L A+  ++IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +CI     +    +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPL 151
           ++RK+PG+P++ V     ++E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI+KG+   L A+   +IT C +  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K D+++G+  TL A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD---DCLVNRV-----LQHKCYIVATNDAALKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RK+PG+P++ V     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 61.2 bits (147), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +C+     +    +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 61.2 bits (147), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +C+     +    +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +C+     +    +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +C+     +    +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K D+++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V      +E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K D+++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K D++KG+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +CI + V      +H+ ++VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCFIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C +  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C +  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +C+ + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD---DCLVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RK+PG+P++ V     ++E L D 
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPDV 188

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 75/144 (52%), Gaps = 9/144 (6%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRRKL 130
            +   A+ +A++   +R N   K   +  +C+ + V      +H+ Y+VA+ D  +++++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD-DCLVNRV-----LQHKCYIVATNDAALKQRI 164

Query: 131 RKIPGVPIVHVSRAVMILEPLSDA 154
           RK+PG+P++ V     ++E L D 
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 58.9 bits (141), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 75/144 (52%), Gaps = 9/144 (6%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K D+++G+   L A+   +IT C M  L K  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  NQE--AISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRRKL 130
            +   A+ +A++   +R N   K   +  +C+ + V      +H+ Y+VA+ D  +++++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD-DCLVNRV-----LQHKCYIVATNDAGLKQRI 164

Query: 131 RKIPGVPIVHVSRAVMILEPLSDA 154
           RK+PG+P++ V     ++E L D 
Sbjct: 165 RKVPGIPLMSVGGHSYVIEKLPDV 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 58.5 bits (140), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVMITQCCMQALYKTD 73
           L + +    + PYQ ++D   +    Q K DI++G+   L A+   +IT C +  L K  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 74  NQE--AISIAKE--FERRRCNHPPKDPKSPLECIESIVDIKGSNKHR-YVVASQDMDIRR 128
            +   A+ +A++   +R  C+H         +CI + V      +H+ Y+VA+ D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD---DCIVNRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 KLRKIPGVPIVHVSRAVMILEPLSDA 154
           ++RKIPG+P++ V     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 12  QMLVYNHTFKFREPYQAIVDDQLVLDCC--QSKFDILKGLKRTLQAEVKVMITQCC 65
           Q L Y+H  KF + ++  ++  ++L+ C   S  D+LK  K   +AEVK M TQ C
Sbjct: 145 QNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVC 200

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,531,384
Number of extensions: 917944
Number of successful extensions: 2503
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2485
Number of HSP's successfully gapped: 47
Length of query: 257
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 150
Effective length of database: 41,212,137
Effective search space: 6181820550
Effective search space used: 6181820550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)