Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.736.16ON96296247030.0
TDEL0G045306.16ON95893314560.0
TPHA0J003006.16ON98293914200.0
ZYRO0C07898g6.16ON97491713351e-168
KAFR0L003706.16ON96391813091e-164
NCAS0H008806.16ON100490012621e-157
CAGL0B03641g6.16ON98883712461e-155
Skud_5.286.16ON99893912461e-155
NDAI0D008706.16ON106992512511e-155
Suva_5.66.16ON999100212351e-153
Smik_5.266.16ON100290112191e-151
Ecym_30206.16ON94493412091e-150
Kwal_56.224036.16ON94391411991e-148
KLTH0C11330g6.16ON94194311551e-142
ACR010C6.16ON94592211511e-141
SAKL0E01078g6.16ON94866910851e-132
Kpol_1032.66.16ON100461710791e-130
KNAG0M011306.16ON95084510401e-125
YEL061C (CIN8)6.16ON100066110011e-119
KLLA0D01045g6.16ON9656909121e-107
TPHA0M002406.16ON9396419001e-105
TBLA0A072306.16ON10975437671e-85
ZYRO0B03234g7.387ON11385325559e-58
TDEL0C016007.387ON11055004872e-49
Ecym_46887.387ON11344254783e-48
TPHA0E008907.387ON12325104722e-47
KAFR0L017107.387ON11514554552e-45
ADR145C2.633ON6354233395e-32
SAKL0F12298g7.387ON11122563267e-30
Ecym_34152.633ON6624243211e-29
NCAS0E026407.387ON11022813222e-29
ACR228C7.387ON11292523151e-28
Suva_2.547.387ON11102443052e-27
Smik_2.537.387ON11132473043e-27
YBL063W (KIP1)7.387ON11112613043e-27
NDAI0E043007.387ON11862412991e-26
Skud_2.417.387ON11102382981e-26
KNAG0A078803.479ON7643742836e-25
TDEL0F036403.479ON7044352641e-22
Kpol_505.393.479ON6923792487e-21
TBLA0C053103.479ON6763712424e-20
TPHA0D012708.678ON6963892408e-20
CAGL0D04994g3.479ON6924252371e-19
Suva_16.4693.479ON7313712362e-19
NCAS0F034703.479ON6983792282e-18
Kpol_1013.78.678ON6204112254e-18
NDAI0B057703.479ON7633842246e-18
Skud_16.1278.678ON7064202237e-18
Smik_16.3883.479ON7293762212e-17
KLTH0D11286g8.678ON6783842165e-17
Suva_16.1558.678ON7044252122e-16
Skud_16.4353.479ON7293692122e-16
KLLA0D05951g8.678ON6681092094e-16
TBLA0D006407.387ON11421692095e-16
CAGL0I07029g3.528ON7053652067e-16
ACR145W8.678ON6851111961e-14
Ecym_23958.678ON6871121952e-14
SAKL0G05016g5.531ON5041791922e-14
Kpol_1004.255.531ON5061201904e-14
KLTH0G03850g5.531ON4731731871e-13
SAKL0H06490g8.678ON6571101871e-13
TDEL0A062408.678ON6371401862e-13
KAFR0F042103.528ON6721251862e-13
Smik_6.3528.678ON7151131862e-13
YPL155C (KIP2)8.678ON7061111853e-13
KAFR0H024108.678ON6581211843e-13
KAFR0B065903.479ON7061491844e-13
CAGL0M02189g8.678ON6721111834e-13
ZYRO0D12650g5.531ON4781691806e-13
KLLA0B00759g5.531ON4562821806e-13
KNAG0B005203.528ON7231181826e-13
TBLA0C039403.479ON7391891827e-13
Kwal_47.186085.531ON4791731808e-13
Suva_7.443.528ON8051141791e-12
Kwal_YGOB_55.211643.479ON6571581772e-12
AGR253W3.479ON7091771763e-12
Kwal_55.21164singletonOFF5881581763e-12
ZYRO0E08668g3.528ON7781341746e-12
SAKL0G18920g2.633ON6491781738e-12
ZYRO0F07414g8.678ON6541221728e-12
AER441C3.528ON8181131721e-11
KLLA0A01606g3.528ON7691111721e-11
YGL216W (KIP3)3.528ON8051091712e-11
NCAS0E005503.528ON7841091702e-11
SAKL0F01760g3.528ON8091111702e-11
NDAI0E02090singletonON6851151692e-11
KLLA0B10956g3.479ON6901621692e-11
KLTH0F14498g3.479ON7021671693e-11
Ecym_12003.528ON8331131683e-11
NDAI0I029603.528ON8681091683e-11
Smik_7.483.528ON8051081674e-11
KLTH0G01606g3.528ON8191111665e-11
ZYRO0B04290g3.479ON7311231657e-11
SAKL0F03168g3.479ON7061771649e-11
Skud_7.533.528ON8051091649e-11
Ecym_44073.479ON7111691622e-10
Kpol_1050.1033.479ON6971111612e-10
Kwal_47.190933.528ON8191111622e-10
TPHA0D032003.479ON7241841612e-10
TBLA0C049603.528ON8011131612e-10
Kwal_26.88068.678ON7151101612e-10
TPHA0D041903.479ON6721591593e-10
Ecym_40665.531ON4781791583e-10
YPR141C (KAR3)3.479ON7291341594e-10
TDEL0D059603.528ON7331091585e-10
KNAG0J017208.678ON6251071551e-09
TPHA0N016502.633ON6821881522e-09
YKL079W (SMY1)2.633ON6561621504e-09
Kpol_1019.112.633ON6471431495e-09
NCAS0C013508.678ON6551111487e-09
Kpol_423.83.528ON8061111461e-08
TPHA0D034803.528ON8471111442e-08
TBLA0C018808.678ON4681181396e-08
Skud_11.1482.633ON6561111398e-08
Suva_11.1452.633ON6571131372e-07
ZYRO0E01078g2.633ON6682051372e-07
Smik_11.1602.633ON6561151282e-06
TDEL0B072702.633ON6441431229e-06
NCAS0H031802.633ON6601621173e-05
KNAG0M025402.633ON5221131067e-04
TBLA0C008002.633ON6931311040.001
KAFR0C040202.633ON6671501030.001
NDAI0C004802.633ON598811010.003
CAGL0L05104g2.633ON6751661000.004
TDEL0F029801.149ON74066880.090
TBLA0A008202.633ON80354860.15
NCAS0C052002.633ON57264820.43
TPHA0N014502.597ON75077800.93
KNAG0H003602.633ON681112762.2
KLTH0D15884g4.311ON434104743.7
Suva_2.6781.61ON53186735.2
NDAI0A082303.211ON249970745.2
AFR352C1.474ON64276735.3
Kwal_27.126221.253ON176373735.5
CAGL0C03201g4.14ON310884727.6
Smik_2.2593.379ON29854709.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.73
         (962 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...  1816   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   565   0.0  
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   551   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   518   e-168
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   508   e-164
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   490   e-157
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   484   e-155
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   484   e-155
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   486   e-155
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   480   e-153
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   474   e-151
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   470   e-150
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   466   e-148
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   449   e-142
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   447   e-141
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   422   e-132
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   420   e-130
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   405   e-125
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   390   e-119
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   355   e-107
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   351   e-105
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   300   1e-85
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   218   9e-58
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   192   2e-49
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   188   3e-48
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   186   2e-47
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   179   2e-45
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   135   5e-32
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   130   7e-30
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   128   1e-29
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   128   2e-29
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   125   1e-28
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   122   2e-27
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   121   3e-27
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   121   3e-27
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   119   1e-26
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   119   1e-26
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   113   6e-25
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   106   1e-22
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   100   7e-21
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...    98   4e-20
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    97   8e-20
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    96   1e-19
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...    96   2e-19
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...    92   2e-18
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....    91   4e-18
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...    91   6e-18
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    91   7e-18
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    90   2e-17
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    88   5e-17
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    86   2e-16
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...    86   2e-16
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...    85   4e-16
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....    85   5e-16
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...    84   7e-16
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    80   1e-14
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    80   2e-14
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...    79   2e-14
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....    78   4e-14
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...    77   1e-13
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...    77   1e-13
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    76   2e-13
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...    76   2e-13
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    76   2e-13
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    76   3e-13
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...    75   3e-13
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...    75   4e-13
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    75   4e-13
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...    74   6e-13
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...    74   6e-13
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...    75   6e-13
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...    75   7e-13
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...    74   8e-13
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)    74   1e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    73   2e-12
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...    72   3e-12
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    72   3e-12
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...    72   6e-12
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...    71   8e-12
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...    71   8e-12
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...    71   1e-11
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...    71   1e-11
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...    70   2e-11
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...    70   2e-11
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...    70   2e-11
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    70   2e-11
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...    70   2e-11
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...    70   3e-11
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...    69   3e-11
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...    69   3e-11
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)    69   4e-11
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...    69   5e-11
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...    68   7e-11
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...    68   9e-11
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)    68   9e-11
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...    67   2e-10
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...    67   2e-10
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...    67   2e-10
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...    67   2e-10
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...    67   2e-10
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...    67   2e-10
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    66   3e-10
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...    65   3e-10
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...    66   4e-10
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...    65   5e-10
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    64   1e-09
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    63   2e-09
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    62   4e-09
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    62   5e-09
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...    62   7e-09
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...    61   1e-08
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...    60   2e-08
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    58   6e-08
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    58   8e-08
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    57   2e-07
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    57   2e-07
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    54   2e-06
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    52   9e-06
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     50   3e-05
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    45   7e-04
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    45   0.001
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    44   0.001
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    44   0.003
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    43   0.004
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    39   0.090
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    38   0.15 
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    36   0.43 
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    35   0.93 
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    34   2.2  
KLTH0D15884g Chr4 complement(1313964..1315268) [1305 bp, 434 aa]...    33   3.7  
Suva_2.678 Chr2 (1203476..1205071) [1596 bp, 531 aa] {ON} YDR501...    33   5.2  
NDAI0A08230 Chr1 (1882144..1889643) [7500 bp, 2499 aa] {ON} Anc_...    33   5.2  
AFR352C Chr6 complement(1073984..1075912) [1929 bp, 642 aa] {ON}...    33   5.3  
Kwal_27.12622 s27 (1304495..1309786) [5292 bp, 1763 aa] {ON} YJL...    33   5.5  
CAGL0C03201g Chr3 (311804..321130) [9327 bp, 3108 aa] {ON} simil...    32   7.6  
Smik_2.259 Chr2 (464023..464030,464121..465009) [897 bp, 298 aa]...    32   9.2  

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score = 1816 bits (4703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 904/962 (93%), Positives = 904/962 (93%)

Query: 1   MSLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKREFGM 60
           MSLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKREFGM
Sbjct: 1   MSLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKREFGM 60

Query: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120
           DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180
           RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180

Query: 181 VDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSNS 240
           VDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSNS
Sbjct: 181 VDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSNS 240

Query: 241 FNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300
           FNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST
Sbjct: 241 FNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300

Query: 301 IFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNS 360
           IFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKD              VNS
Sbjct: 301 IFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNS 360

Query: 361 LHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKC 420
           LHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKC
Sbjct: 361 LHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKC 420

Query: 421 YPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMD 480
           YPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMD
Sbjct: 421 YPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMD 480

Query: 481 LKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINS 540
           LKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINS
Sbjct: 481 LKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINS 540

Query: 541 TDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXX 600
           TDKLKETVNNMNVTIARYTDRESSVQTQMKTLF               RQF         
Sbjct: 541 TDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNL 600

Query: 601 XXXXXXXXAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSEN 660
                   AHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSEN
Sbjct: 601 EIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSEN 660

Query: 661 YNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDL 720
           YNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDL
Sbjct: 661 YNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDL 720

Query: 721 LESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNR 780
           LESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNR
Sbjct: 721 LESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNR 780

Query: 781 VIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKKNGILKD 840
           VIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAA            FISIMKKNGILKD
Sbjct: 781 VIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKD 840

Query: 841 TLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRN 900
           TLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRN
Sbjct: 841 TLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRN 900

Query: 901 RKSPVRQSVSPSRTSPQIQSLMNSDLLQFNEARSFAVKHSLDKAHDEDKIDEGSSKKRVH 960
           RKSPVRQSVSPSRTSPQIQSLMNSDLLQFNEARSFAVKHSLDKAHDEDKIDEGSSKKRVH
Sbjct: 901 RKSPVRQSVSPSRTSPQIQSLMNSDLLQFNEARSFAVKHSLDKAHDEDKIDEGSSKKRVH 960

Query: 961 RA 962
           RA
Sbjct: 961 RA 962

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/933 (37%), Positives = 542/933 (58%), Gaps = 52/933 (5%)

Query: 8   KDKVECNIKVVARFKGQIDNE---------KGDDV--RDQIIIEEPGLIKFKGKDDAVKR 56
           +D  E NI V  R +G+ + E            DV   +++ I   G +    + ++  +
Sbjct: 10  EDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINS--K 67

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
            + +D +F     Q  ++    +P+F DFI GYNC+ LVYG T +GKTYT++G+E  L  
Sbjct: 68  TYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYD 126

Query: 117 SEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIK 176
            E S  S G+IPR+L +LF+ L     D+VVKCS+VE+YNEELKDLL D       AS +
Sbjct: 127 GELSE-SAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEI---ASSR 182

Query: 177 KLRIVDSGSPNVKNGANSNCNT---RDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTL 233
           KLRI DS + +    + S  N+     N+   SS  +PTA   +K         K A ++
Sbjct: 183 KLRIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKR-------WKTAPSV 235

Query: 234 SISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQK 293
           + S  NS          Q++    YIQNL++FHITNAKEGI+LL +GLK+RQ+A++K   
Sbjct: 236 TQSHQNS----------QDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMND 285

Query: 294 YSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXX 353
           +SSR+ TIFTI LYKE  GEIFRVSK N VDLAG+E+  +    +QR K+          
Sbjct: 286 FSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLT 345

Query: 354 XXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGN 413
               +NSL +K   +PF++SKLT L++D+L GN+K+  I T+   K + +E   TL++  
Sbjct: 346 LGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAA 405

Query: 414 KVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDK 473
           K +++K  P LG  I K+ L+K+I+ ELAK+K+DLLSTKSKEG+YMS ++Y  LT DL+ 
Sbjct: 406 KAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLES 465

Query: 474 HKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRR 533
           +K E+ + K+ I+ L  Q+T L KDK+A  EVN++QRIKLQ+MRD++S +Y+  EKQ +R
Sbjct: 466 YKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKR 525

Query: 534 EHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXX 593
           E +L+ +   LK TV  M   I  +  RE  ++++M  LF               R    
Sbjct: 526 EQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQ 585

Query: 594 XXXXXXXXXXXXXXXAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRL 653
                             EI ++L+ ++ + D ++ DC++K+ +E+P  F    + VS +
Sbjct: 586 QIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEV 645

Query: 654 ENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDF 713
           E   +  + +L E LSDVSEEFNNL+QY+N+ FFKNNHEE+L +++++TYH +Q S+DD 
Sbjct: 646 EKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDL 705

Query: 714 LLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSN 773
             +F ++++++LE NK ++L+++K+AT +VI  EM  F PQK+KWE S + I K    + 
Sbjct: 706 FQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINF 765

Query: 774 EFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMK 833
            F+   +  +  ++ TL  + E++  T++++K +++E +  A            F  I+ 
Sbjct: 766 AFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILN 825

Query: 834 KNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQ-----SILKEIFDQ 888
           K  +L ++L  ++  T +   A DKL ++I +V  +E  +++ G +      IL+ + +Q
Sbjct: 826 KQSLLHESLKKSVIITSDHADAVDKLKEAIDHVV-SERGSSMEGERVEHVDGILRRMDEQ 884

Query: 889 ----LDQQRLTP-NMRNRKSPVRQSVSPSRTSP 916
               LD+  L P N +  KS   +  SP+R+SP
Sbjct: 885 NLLYLDRSPLRPANFKMNKS---ERNSPNRSSP 914

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/939 (37%), Positives = 529/939 (56%), Gaps = 51/939 (5%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKREF-------GMDHIFSS 66
           NI V  R +  ID EK            P +I     +D    E        G   I++ 
Sbjct: 9   NITVAVRCREPIDEEKHSG--------SPTIISIGDNEDGTSNEVIVLDESTGRKKIYTL 60

Query: 67  DVV------QEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSE-A 119
           D V      Q++L+ +++ P ++ F +GYN S + YG   SGK YTL GE   L ++  A
Sbjct: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120

Query: 120 SRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVD--------QHNSLL 171
              ++GV+PRVL  LF  L  N  DH++KCS+VEIYN+EL+DLL+D          N   
Sbjct: 121 ESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGAT 180

Query: 172 SASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTA----- 226
            ++ KKLRIVDS S  +++  +SN +TRDNSPLT+SK IPTA++RK+MG++SL       
Sbjct: 181 GSTGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPNNSIS 240

Query: 227 --LKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNR 284
                 N LS+SR+NSF++YS Q    E+  + YIQNL+E  IT  +EG+ ++ +GLKNR
Sbjct: 241 NNTANNNRLSLSRTNSFSDYSLQSS-HERLNSIYIQNLQEITITEIEEGMAIIKKGLKNR 299

Query: 285 QIAS----SKNQKYSSRASTIFTIVLYKEEE-GEIFRVSKWNFVDLAGAEHSHKIEGTNQ 339
           +IAS    S   ++S R+ +IF I LYKEEE  E+FR+SK +FV+ AG+E+       N 
Sbjct: 300 RIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKNG 359

Query: 340 RFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNK 399
            F                +N +    +   F DSKLT L+++  +G ++++FI  +   K
Sbjct: 360 AFN------SNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLK 413

Query: 400 DSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKE-GVY 458
             LD     L    K++ +K  P  G  I KE+LIK +SNEL K KSDLLS KS + G+Y
Sbjct: 414 KQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIY 473

Query: 459 MSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRD 518
           M  +HY  LTK L+ +K +I + K  I+EL ++   +R +KR FEE+NE QRIKLQ++R+
Sbjct: 474 MDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRE 533

Query: 519 SVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXXX 578
           ++S +   +EKQ +RE +L N   KL   + NM  ++ +Y+D+E  +Q ++K L+     
Sbjct: 534 TISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELV 593

Query: 579 XXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIKQILQISENEIDSLFLDCIKKMSEE 638
                                            EI +I   S++++  L  +   ++ + 
Sbjct: 594 KLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNSANQVLDT 653

Query: 639 SPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTY 698
           SPK F     ++  LE S   N+N  +ELLSD+SEEFNNL  YIN+ F K++HEEL+ TY
Sbjct: 654 SPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSHEELIDTY 713

Query: 699 VNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKW 758
           +N+TYH+VQ  S +F   F  LL+ Y+E N   L ++I S TSE++ENE+  F P+K+KW
Sbjct: 714 INRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNPEKKKW 773

Query: 759 E-KSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAAXX 817
           E  S E+IE    S  + K KN  I+ KL      TSE   + +S +K  +  +++ +  
Sbjct: 774 ELASNEIIENFNESITKNKNKNSEILAKLLSESTSTSELFINNMSSIKKNVEIVEEFSEI 833

Query: 818 XXXXXXXXXXFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITG 877
                     F+ I+ KN  LKD +  N  S+E SI +FD L ++++NVFKNE+  + + 
Sbjct: 834 FNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFKNEMKESYSN 893

Query: 878 YQSILKEIFDQLDQQRLTPNMRNRKSPVRQSVSPSRTSP 916
               LKEIF+Q++QQ+L  N  ++K   +Q++SPS+ SP
Sbjct: 894 DTLNLKEIFEQMEQQKLGVNSSSKKKAYKQNLSPSKISP 932

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  518 bits (1335), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 321/917 (35%), Positives = 528/917 (57%), Gaps = 65/917 (7%)

Query: 2   SLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV-- 54
           S + G +D  E NI V  R +G+  NE+    +  +++  P +     +     DD    
Sbjct: 4   SPAGGGEDAEELNITVAVRSRGR--NEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGIT 61

Query: 55  ----KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE 110
                + + +D +F     Q+ ++ +  +P+F DF+ GYNC+ LVYG T +GKTYT++G+
Sbjct: 62  AQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGD 121

Query: 111 EDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSL 170
           E   L+++    S G+IPR+L +LF+ L   + D+VVKCS+VE+YNEELKDLL D   S+
Sbjct: 122 EK--LYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD---SV 176

Query: 171 LSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAII-RKKMGRQSLTA--L 227
            ++S++KLRI DSGS +  N  +   N+R+NSP    K +   +I R++M    L++   
Sbjct: 177 ENSSMRKLRIYDSGSGSNSNSGSRK-NSRNNSP----KLVTDPMINRRRMRTVPLSSSLA 231

Query: 228 KQANTLSISRSNSFNEYSPQRHIQ----------------EKTGAPYIQNLEEFHITNAK 271
           KQ +     R         Q+  Q                +     YIQNL++FHIT+A+
Sbjct: 232 KQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSAR 291

Query: 272 EGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHS 331
           +G+QLL +GL+NRQ+A++K   +SSR+ TIFTI LY+E +GE+F+VSK N VDLAG+E+ 
Sbjct: 292 DGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENI 351

Query: 332 HKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIF 391
            +    +QR K+              +NSL +K + +PF++SKLT L++D+L GN+K+  
Sbjct: 352 SRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTAL 411

Query: 392 ILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLST 451
           I T+   K + +E   TL++ +K +++K  P L   I K+ L+K+I+ ELAKVKSDLLST
Sbjct: 412 IATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLST 471

Query: 452 KSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRI 511
           K +EGVYMS ++Y  +T DL+ +K EI + K++I+ L+ Q++ L KDK+A  EVNE+QRI
Sbjct: 472 KLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRI 531

Query: 512 KLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKT 571
           KLQ+M+D +S +   +E Q ++E +L++ T  LK T++     I  Y  RE  +  +M+ 
Sbjct: 532 KLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQM 591

Query: 572 LFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHE---------------EIKQI 616
           +                RQ                   HE               E+ ++
Sbjct: 592 IL--------GQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVEL 643

Query: 617 LQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFN 676
           L +++   + ++ D I+K+ EE+P +F +    V ++E + +  +  L E LSD+SE +N
Sbjct: 644 LGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYN 703

Query: 677 NLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNI 736
           NLKQY N+ FFKNNHEE+L ++++KTY Q+Q S+D  L KF  +++ +L+ NK+++++++
Sbjct: 704 NLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSL 763

Query: 737 KSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSES 796
           +SAT+E I+ EM  F PQ++KWE+S +LI      SN F    R  +  ++ T   +++ 
Sbjct: 764 QSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDV 823

Query: 797 LFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTSTEESIVAF 856
           +  ++S++K ++   + A+               I+ K+  L++ L  ++ S++  I AF
Sbjct: 824 ISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAF 883

Query: 857 DKLDDSIRNVFKNEIDT 873
           D+L + IRN   +E  T
Sbjct: 884 DELKERIRNTIASENST 900

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  508 bits (1309), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 326/918 (35%), Positives = 506/918 (55%), Gaps = 69/918 (7%)

Query: 4   SDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------------IKFKGK 50
           SD    + E NI V  R +G+  N++  D +  +++  P +             I F  +
Sbjct: 8   SDKQPQEEELNITVAVRCRGR--NQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQ 65

Query: 51  DDAVKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE 110
            ++  + + +D +F     Q  ++ +  +P+F DFI GYNC+ LVYG T +GKTYT++G+
Sbjct: 66  MNS--KTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD 123

Query: 111 EDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSL 170
           E   L++E    S G+IPR+L +LF+ L   N DH+VKCS+VE+YNEELKDLL    N+ 
Sbjct: 124 EK--LYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND 181

Query: 171 LSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQA 230
            + + KKLRI DS       G +S  N+R+NSP  S+ +  T  ++KK+  ++L  L+  
Sbjct: 182 -NGNFKKLRIFDSL------GRDSRSNSRNNSPKMSNNN--TTFLKKKLRNEAL--LRSR 230

Query: 231 NTLSISRS----------------------------NSFNEYSP----QRHIQ-EKTGAP 257
           N  S  RS                            +S N++SP    +  IQ ++T   
Sbjct: 231 NIASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGI 290

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRV 317
           YIQNL+EFHIT AKEGI+LL +GLK RQ+AS+K   +SSR+ TIFTI L+KE +GEIFR+
Sbjct: 291 YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRL 350

Query: 318 SKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTY 377
           SK N VDLAG+E+ ++    NQR K+              +NSL +K   +PF++SKLT 
Sbjct: 351 SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTR 410

Query: 378 LIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSI 437
           L++D+L GN+K+  I T+   K +L+E   TLE+ +K +++K  P LG  I K+ L+K+I
Sbjct: 411 LLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNI 470

Query: 438 SNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRK 497
           + EL K+KSDLLSTKSK+G+YM  +HY  LT DL  +K EI + K+ I+ L  Q+  L K
Sbjct: 471 TTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLK 530

Query: 498 DKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIAR 557
           DKR   E NE+QRIK+Q+M +S+  +Y  IE+QQ  E++L        +T + +   I  
Sbjct: 531 DKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDE 590

Query: 558 YTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIKQIL 617
             +RE+ V ++ KTL                  F                    E+  +L
Sbjct: 591 MKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLL 650

Query: 618 QISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNN 677
             + +  +  + +CI K   ++P LF     +V  L+  TS  Y+ +AE LSD+SEE+NN
Sbjct: 651 STARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNN 710

Query: 678 LKQYINEKFF---KNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQ 734
            KQ+I ++F+   K +  ELL  Y+N T   ++ SS+D +    +LL  +L  NK +++ 
Sbjct: 711 FKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIIN 770

Query: 735 NIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTS 794
           ++ + T+E++ NE++   P+  KWE+S ELI +S   +NEF       +  + D +K T+
Sbjct: 771 SLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTN 830

Query: 795 ESLFDTLSEMKS--KINELQKAAXXX-XXXXXXXXXFISIMKKNGILKDTLNINMTSTEE 851
           +S+ + + ++    K N++  +              F SI +KN  L + +      T E
Sbjct: 831 DSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNE 890

Query: 852 SIVAFDKLDDSIRNVFKN 869
           S+   ++LD SIR V K+
Sbjct: 891 SMKKLNELDTSIRTVLKD 908

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  490 bits (1262), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 309/900 (34%), Positives = 512/900 (56%), Gaps = 45/900 (5%)

Query: 11  VECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------IKFKGKDDAVK----REFG 59
            E NI V  R +G+  NE+  + +  +++  P +       I   G+         + + 
Sbjct: 27  TELNITVAVRCRGR--NEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYT 84

Query: 60  MDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEA 119
           +D +F     Q+ ++ +  +P+F+DF+ GYNC+ LVYG T +GKTYT++G+E   L+   
Sbjct: 85  VDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEK--LYQNG 142

Query: 120 SRLS--VGVIPRVLEELFDHL--------SCNNIDHVVKCSYVEIYNEELKDLLV----D 165
           + LS   G+IPR+L +LFD L        + +  D VVKCS+VE+YNE+LKDLL     D
Sbjct: 143 TMLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSND 202

Query: 166 QHNSLLSASIKKLRIVDSGSPNVKNGANSNCNTRDNS---PLTSSKSIPTA-----IIRK 217
           +         +KLRI DS + N  N  ++  +   +    P TSS  +P A      +RK
Sbjct: 203 EQQQQQQLGSRKLRIFDSTNNNNNNSNSNASSRASSRNNSPRTSS-ILPNANATNLAMRK 261

Query: 218 KMGRQSLTALKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLL 277
           K  R +  +  +A + + +R N+ +E S      E T   YIQNL+EFHITNAKEG+ LL
Sbjct: 262 KSIRYNYNSNNKAKSSNNTRPNTNDEPSSIAGPDENTNGIYIQNLQEFHITNAKEGLSLL 321

Query: 278 HRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGT 337
            +GLK+RQ+AS+K   +SSR+ TIFTI LYKE +  +FR+SK N VDLAG+E+ ++    
Sbjct: 322 QKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLVDLAGSENINRSGAM 381

Query: 338 NQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRF 397
           NQR K+              +NSL +K   +PF++SKLT L++D+L GN+K+  I T+  
Sbjct: 382 NQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLGGNTKTALIATISP 441

Query: 398 NKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGV 457
            K + +E   TLE+ +K +++K  P LG  I K+ L+K+I++ELAKVKSDL+STKSK+G+
Sbjct: 442 AKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKVKSDLMSTKSKDGI 501

Query: 458 YMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMR 517
           YMSHEHY  L  +L+  K E+ + K++I++L+ Q++ L KDKR+  EVNE+QRIKL +++
Sbjct: 502 YMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANEVNELQRIKLNNLK 561

Query: 518 DSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXX 577
           DS+S +   +E Q  +E  L+    +L+++   +N  +  Y  ++S ++TQ+  +     
Sbjct: 562 DSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQSQLKTQISNILNENL 621

Query: 578 XXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIKQILQISENEIDSLFLDCIKKMSE 637
                                            +EI  +L+ ++++ + ++ + I++  E
Sbjct: 622 FELKKILNSHKDAI--RQSEGNFDVEMNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLE 679

Query: 638 ESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKT 697
           ++P       + V+++E   +  YN + E LSD+SEE+NNLKQY++  FF+NNHE+LL  
Sbjct: 680 QTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLDNDFFQNNHEDLLNI 739

Query: 698 YVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEK 757
           ++N T   + +SS +   KF  +++++L  NK +++ N ++AT++VI  EM  F P++ K
Sbjct: 740 HINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDVITKEMELFKPKRNK 799

Query: 758 WEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKI-----NELQ 812
           WE+SIELI +    +N F       V K++  L  +S S+ + ++ +KS++     N+  
Sbjct: 800 WEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDS 859

Query: 813 KAAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEID 872
                          F  I++KN IL+      +  T++S++  D+L ++++    N +D
Sbjct: 860 DVKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYTDKSLLNIDELSETVKIALNNIVD 919

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  484 bits (1246), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 299/837 (35%), Positives = 478/837 (57%), Gaps = 49/837 (5%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEP--GL---IKFKGKDD---AVK---REFGM 60
           E NI V  R +G+  NE+    +  ++++ P  G+   +     DD   A K   + + +
Sbjct: 31  ELNILVAVRCRGR--NEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTV 88

Query: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120
           D +F     Q+ +Y +  +P+FQDFI GYNC+ LVYG T +GKTYT++G+E   LH+   
Sbjct: 89  DKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEK--LHNGEL 146

Query: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180
             + G+IPRVL ELFD L  N  D++VKCS+VE+YNEELKDLL D  N+  ++  KKLRI
Sbjct: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL-DSTNTATNSDNKKLRI 205

Query: 181 VDSGSPNVKNGANSNCNTRDNSPLTSSKSIP----TAIIRKKMGRQSLTA---------- 226
            DS   NV   + S  ++R +S   S +S P      ++R+K+GR + T           
Sbjct: 206 FDS---NVNGTSASGSSSRSSSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISNNNHN 262

Query: 227 -------LKQANTLSISRSNSFNEYSPQRHIQ---------EKTGAPYIQNLEEFHITNA 270
                    Q +T + + +N  N + P  +           +++ + YIQNLEEFHIT+A
Sbjct: 263 KFSRFKQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHITSA 322

Query: 271 KEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEH 330
            EG+QLL +GLK RQ+AS+K   +SSR+ +IFTI LYKE+ GE+FRVSK N VDLAG+E+
Sbjct: 323 MEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSEN 382

Query: 331 SHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSI 390
             +    NQR K+              +NSL +K   IPF++SKLT L++D+L GN+K+ 
Sbjct: 383 ISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTA 442

Query: 391 FILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLS 450
            I T+   K + +E   TLE+ +K +++K  P LG  I K+ L++SI++ELAK+KSDLLS
Sbjct: 443 LIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLS 502

Query: 451 TKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQR 510
           TKSKEGVYMSHEHY  L  D++ +K E+ + K+ I+ L  Q+  L++++ + ++ N   +
Sbjct: 503 TKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYK 562

Query: 511 IKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMK 570
             + S++D+V  + +++++Q  +E ++ +    ++     M  TI  +  ++  +Q  + 
Sbjct: 563 ANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSIS 622

Query: 571 TLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIKQILQISENEIDSLFLD 630
           T                                       +E+ ++++ +E E    + +
Sbjct: 623 TFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEASKSYGE 682

Query: 631 CIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNN 690
           C+K M +E+P+LF S    +  +     EN++ +AE LSDVSEE+NNLKQY+   FFKNN
Sbjct: 683 CVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNN 742

Query: 691 HEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNH 750
           HEELL  +V  TY Q++++S   +  F  +L+ +++ NK  +L+NI   T EVI NE+  
Sbjct: 743 HEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQM 802

Query: 751 FIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSK 807
           F  Q+ KWEKS  LI +    ++ F       + +++D +  + +++  T+S ++S+
Sbjct: 803 FGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQSR 859

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  484 bits (1246), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 316/939 (33%), Positives = 512/939 (54%), Gaps = 58/939 (6%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFK------GKDDAV-----KREFGM 60
           E NI V  R +G+  NE+   ++  +++  P +   K        D  +      + + +
Sbjct: 36  ELNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93

Query: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120
           D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E   L++   
Sbjct: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEK--LYNGEL 151

Query: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSAS-----I 175
             + G+IPRVL +LFD L     D+VVKCS++E+YNEELKDLL +  N   +       +
Sbjct: 152 NDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFM 211

Query: 176 KKLRIVDSGSPNVKNGANSNCNT-----------RDNSPLTS-------SKSIPTAI--- 214
           KKLRI DS + N     +++ +             D +P  +       +KS+P  I   
Sbjct: 212 KKLRIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQ 271

Query: 215 -IRKKMGRQSLTALKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEG 273
             ++ M  ++ ++    +  + S SN+  + SP     +  G  YIQNL+EFHITNA EG
Sbjct: 272 QQQQAMNSRNNSSSNSGSAANNSSSNTNGQRSPMTQNDQSNGI-YIQNLQEFHITNALEG 330

Query: 274 IQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHK 333
           + LL RGLK+RQ+AS+K   +SSR+ TIFTI LYK+ + E+FR+SK N VDLAG+E+ ++
Sbjct: 331 LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 390

Query: 334 IEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFIL 393
               NQR K+              +N+L ++   IPF++SKLT L++D+L GN+K+  I 
Sbjct: 391 SGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIA 450

Query: 394 TLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKS 453
           T+   K + +E   TLE+ +K +++K  P LG  + K+ L+K+I+ ELAK+KSDLLSTKS
Sbjct: 451 TISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKS 510

Query: 454 KEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKL 513
           KEG+YMS +HY  L  DL+ HK E+ + K+ I+ L  +++ L KDK    E  + Q  ++
Sbjct: 511 KEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQM 570

Query: 514 QSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLF 573
           +S++ +++ +   ++KQ + E ++    +KL++    M V +  Y  RE  +  + +T  
Sbjct: 571 ESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHI 630

Query: 574 XXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIKQILQISENEIDSLFLDCIK 633
                                                 E+  +++  + + + ++ DC+K
Sbjct: 631 SKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVK 690

Query: 634 KMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEE 693
           K+  ESPK F+  ++ +  +       Y N+AE LSD+SEE NNLKQY+   FFKNNH+E
Sbjct: 691 KILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQE 750

Query: 694 LLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIP 753
           LL  +++ TY  ++K ++ F+  F   L  +LE NK +++QN+ +ATS VI+ EM+ F P
Sbjct: 751 LLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEP 810

Query: 754 QKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQK 813
           ++ KWE S +LI K    +NEF       + +++ T+  +S S+ +++S MK ++ E + 
Sbjct: 811 RRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESEN 870

Query: 814 AAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKN---- 869
           A             F  ++ K+ ILKD +  ++TST   I   D + ++I ++  N    
Sbjct: 871 AISLLKNNTKFNDQFKQLISKHIILKDNIESSITSTHSHITNVDDIYNTIEDIMTNHGNK 930

Query: 870 EIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVRQS 908
           E  T      +ILKEI          PN+  R  P+R S
Sbjct: 931 ENATKDEMIDNILKEI----------PNLSKR-LPLRIS 958

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  486 bits (1251), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 307/925 (33%), Positives = 504/925 (54%), Gaps = 68/925 (7%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV------KREFGMDH 62
           NI V  R +G+  NE+   ++  +I+  P +     +     DD         + + +D 
Sbjct: 53  NITVAVRCRGR--NEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDK 110

Query: 63  IFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRL 122
           +F     Q+ ++ +  +P+F DFI GYNC+ LVYG T +GKTYT++G+E  L + E S  
Sbjct: 111 VFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYNGELSE- 168

Query: 123 SVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVD--QHNSLLSASIKKLRI 180
           S G+IPR+L +LFD L  N  D+VVKCS++E+YNE+LKDLL D     +   ++I KLRI
Sbjct: 169 SAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRI 228

Query: 181 VDSGSPNVKN----GANSNCNTRDNSPL--TSSKSIPTA---IIRKKMGRQSLTALKQAN 231
            DS + +  N     A+S  N+R+NSP    S+ ++ T     +R+K+     +  + +N
Sbjct: 229 FDSSTASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPENSN 288

Query: 232 TLSISRSNSFNEYSPQRHIQE--------------KTGAP-------------------Y 258
             + + S+S    +    +                +T  P                   Y
Sbjct: 289 IFTSNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNGIY 348

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVS 318
           IQNL+EFHI+NAKEG+ LL +GLK RQ+AS+K   +SSR+ TIFTI LYKE +G +FR+S
Sbjct: 349 IQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLS 408

Query: 319 KWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYL 378
           K N VDLAG+E+ ++    NQR K+              +NSL ++ + IPF++SKLT L
Sbjct: 409 KMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRL 468

Query: 379 IKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSIS 438
           ++D+L GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  I+K+ L+K+I+
Sbjct: 469 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNIT 528

Query: 439 NELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKD 498
            EL++VKSDLLSTKSKEG+YMS EHY  L  +LD HK E  + K++I+ L+ Q+  L KD
Sbjct: 529 TELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKD 588

Query: 499 KRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARY 558
           KR   EVNE+QRIKL   +DS++M+   IE Q  +E  L++S  KL+ + +     I  Y
Sbjct: 589 KRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENY 648

Query: 559 TDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIKQILQ 618
             ++  V+++++ +                 +                     E+ ++L 
Sbjct: 649 ECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEVIKMLG 708

Query: 619 ISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNL 678
            ++ + +  +   I+   +++P+ F    +D++ +      ++  +A+ LSD+SEE+NNL
Sbjct: 709 TTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNL 768

Query: 679 KQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKS 738
           KQY+NE  F+NNHE+L+  ++N T   +  S+D     F D++  +LE N++++L + K+
Sbjct: 769 KQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKA 828

Query: 739 ATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLF 798
           AT EVI  EM  FIP+K+KWE+SI+LI +    +N F+ +    +   +  +  +   ++
Sbjct: 829 ATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASINQMY 888

Query: 799 DTLSEMKSKINELQKAAXXXXXXXXX------XXXFISIMKKNGILKDTLNINMTSTEES 852
           D  + +K++++                        F  + +KN I +D +  ++     S
Sbjct: 889 DNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKCAVAS 948

Query: 853 IVAFDKLDDSIRNVFKNEIDTNITG 877
           +   + L+DSI+   +   DT I G
Sbjct: 949 VNNLNHLEDSIKMAVR---DTRIKG 970

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  480 bits (1235), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 326/1002 (32%), Positives = 538/1002 (53%), Gaps = 77/1002 (7%)

Query: 6   GVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------IKFKGKDDAV---- 54
           GV ++ E NI V  R +G+  NE+   ++  +++  P +       I   G D  +    
Sbjct: 29  GVPNE-ELNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSEEVSINTTG-DTGITAQM 84

Query: 55  -KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDS 113
             + + +D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E  
Sbjct: 85  NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-K 143

Query: 114 LLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLL-----VDQHN 168
           L + E S  + G+IPRVL +LFD L     D+VVKCS++E+YNEELKDLL        +N
Sbjct: 144 LYNGELSD-AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNN 202

Query: 169 SLLSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSK----SIPTAIIRKKMGRQSL 224
                 +KKLRI DS + N     +++ +  ++   +       +   A++RK++  +SL
Sbjct: 203 GFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSL 262

Query: 225 -TALKQANTLSISRS-------------------NSFNEYSPQRHIQEKTGAPYIQNLEE 264
              +KQ +    + S                   N+ N         +++   YIQNL+E
Sbjct: 263 PNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQE 322

Query: 265 FHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVD 324
           FHITNA EG+ LL RGLK+RQ+AS+K   +SSR+ TIFTI LYK+ + E+FR+SK N VD
Sbjct: 323 FHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVD 382

Query: 325 LAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLE 384
           LAG+E+ ++    NQR K+              +N+L +K   IPF++SKLT L++D+L 
Sbjct: 383 LAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLG 442

Query: 385 GNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKV 444
           GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  I K+ L+K+I+ ELAK+
Sbjct: 443 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKI 502

Query: 445 KSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEE 504
           KSDLLSTKSKEG+YMS +HY  L  DL+ +K E+ + K+ I+ L+ +++ L KDK   ++
Sbjct: 503 KSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKD 562

Query: 505 VNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESS 564
             + Q  +++S++ +++ +   ++KQ + E ++    +KL++    M + +  Y  RE  
Sbjct: 563 TIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELD 622

Query: 565 VQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIKQILQISENEI 624
           +  + +T                                        E+  +++  + + 
Sbjct: 623 LNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKA 682

Query: 625 DSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINE 684
           + ++ DC+KK+  ESPK F+  ++ +  +       YNN+AE LSD+SEE NNLKQY+  
Sbjct: 683 ELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKN 742

Query: 685 KFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVI 744
            FFKNNH+ELL  +++ TY  ++K + +F+  F + L  +LE NK +++QN+ +ATS VI
Sbjct: 743 HFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVI 802

Query: 745 ENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEM 804
             EM+ F P++ KWE S +LI K    +NEF       + ++++T+  +S S+  ++S M
Sbjct: 803 NQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVM 862

Query: 805 KSKINELQKAAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIR 864
           K ++ E + A             F  ++ K+ ILKD +  ++TST   I   D + D+I 
Sbjct: 863 KGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTIE 922

Query: 865 NVFKN----EIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVRQSVSPSRTSPQIQS 920
           N+ KN    E         +ILKEI          P++  R  P+R S +   ++  I S
Sbjct: 923 NIMKNYGNKENAVKNEMIDNILKEI----------PSLSKR-VPLRLSNTNGNSAQNILS 971

Query: 921 LMNSDLLQFNEARSFAVKHSLDKAHDEDKIDEGSSKKRVHRA 962
                            KH++D  +  ++I +G   +++ + 
Sbjct: 972 ---------------PKKHAIDDENPSNEITDGEESRKIQKT 998

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  474 bits (1219), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 304/901 (33%), Positives = 500/901 (55%), Gaps = 47/901 (5%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFK------GKDDAV-----KREFGM 60
           E NI V  R +G+  NE+   ++  +++  P +   K        D  +      + + +
Sbjct: 34  ELNITVAVRCRGR--NEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91

Query: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120
           D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E  L + E S
Sbjct: 92  DKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYNGELS 150

Query: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSAS-----I 175
             S G+IPRVL +LFD L     D+VVKCS++E+YNEELKDLL +  NS  +       +
Sbjct: 151 D-SAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFM 209

Query: 176 KKLRIVDSGSPNVKNGANSNCNT-----------RDNSPLTS-------SKSIPTAIIRK 217
           KKLRI DS + N     +++ +             D +P  +       +KS+P  I ++
Sbjct: 210 KKLRIFDSSTANNTTSNSASSSRSSSRNSSPRSLNDLTPKAALLRRRLRTKSLPNTIKQQ 269

Query: 218 KMGRQSLTALKQANTLSISR------SNSFNEYSPQRH---IQEKTGAPYIQNLEEFHIT 268
           +  +Q  T   + N+ S S       S+  N  + QR+     +++   YIQNL+EFHIT
Sbjct: 270 QQHQQQQTMNSRNNSSSNSGSATNNISSDTNNNNGQRNSLAPNDQSNGIYIQNLQEFHIT 329

Query: 269 NAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGA 328
           NA EG++LL +GLK+RQ+AS+K   +SSR+ TIFTI LYK+ + E+FR+SK N VDLAG+
Sbjct: 330 NAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGS 389

Query: 329 EHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSK 388
           E+ ++    NQR K+              +N+L +K   IPF++SKLT L++D+L GN+K
Sbjct: 390 ENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTK 449

Query: 389 SIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDL 448
           +  I T+   K + +E   TLE+ +K +++K  P LG  I K+ L+K+I+ ELAK+KSDL
Sbjct: 450 TALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDL 509

Query: 449 LSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEV 508
           LSTKSKEG+YM+ +HY  L  DL+ +K E+ + K+ I+ L  +++ L K+K   +E  + 
Sbjct: 510 LSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSLLVKEKLKSKETIQS 569

Query: 509 QRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQ 568
           Q  +++S++ ++  + T ++KQ + E ++     KL++    M + +  Y  RE  +  +
Sbjct: 570 QNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMALQDYKRRELDLNKK 629

Query: 569 MKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIKQILQISENEIDSLF 628
            +T                                        E+  +++  + + + ++
Sbjct: 630 FETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVLTLMETMQEKAELMY 689

Query: 629 LDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFK 688
            DC+KK+  ESPK F++ ++ +  +       Y N+AE LSD+SEE NNLKQY    FF+
Sbjct: 690 KDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEENNNLKQYFTNHFFR 749

Query: 689 NNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEM 748
           NNH+ELL  +V+ TY +++K ++ F+  F   L  +LE NK ++++N+ + TS VI+ EM
Sbjct: 750 NNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLIMKNLTTTTSAVIDQEM 809

Query: 749 NHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKI 808
           + F P++ KWE S +LI +    +NEF       + +++ T+  +S S+  ++S MK ++
Sbjct: 810 SLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDTSSNSMNKSISVMKGQV 869

Query: 809 NELQKAAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFK 868
            E + A             F  ++ K+ ILKD +  ++TST   I   D + ++I  +  
Sbjct: 870 EESENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITSTNSHITNIDDIYNTIEKIMN 929

Query: 869 N 869
           N
Sbjct: 930 N 930

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  470 bits (1209), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 304/934 (32%), Positives = 509/934 (54%), Gaps = 62/934 (6%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEP-------------GLIKFKGKDDAVKREF 58
           E NI V  R +G+  NE+    +  +++  P             G I   GK ++  R +
Sbjct: 20  ELNITVAVRCRGR--NEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNS--RTY 75

Query: 59  GMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSE 118
            +D +F     Q+ ++ +  +P+F DFI GYNC+ LVYG T +GKTYT++G+E  L   E
Sbjct: 76  TVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYDGE 134

Query: 119 ASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKL 178
            S  S G+IPRVL  LFD L     DH+VKCSY+E+YNEELKDLL D  +       K+L
Sbjct: 135 LSD-SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDY-----SKRL 188

Query: 179 RIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSI-SR 237
           RI DS +       NS   +++NSP            +++ G  S  A ++   +    +
Sbjct: 189 RIFDSNTI-----TNSRAGSQNNSP------------KEQDGTSSSMAKRRYTHIPTKPK 231

Query: 238 SNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSR 297
             S N    ++ + E++ A YIQNL+EFHITNA+EGI +L +GLK+RQ+AS+K   +SSR
Sbjct: 232 RPSLN----KQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSR 287

Query: 298 ASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXX 357
           + TIFTI+LYK  EGE+FR+SK N VDLAG+E+  +    NQR K+              
Sbjct: 288 SHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV 347

Query: 358 VNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRS 417
           +NSL +K   IPF++SKLT L++D+L GN+K+  I T+   K + DE   TLE+  K ++
Sbjct: 348 INSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKN 407

Query: 418 LKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVE 477
           +K  P LG  + K+ L+KSIS+EL+K+KSD LSTK+KEG+YMSHEHY  +  DL+ ++ E
Sbjct: 408 IKNRPQLGSFMMKDILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTE 467

Query: 478 IMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDL 537
           I + K+ ++  + Q++ L KDK+A +++NE+Q +K+  +++++  +   IE+Q R E DL
Sbjct: 468 IQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDL 527

Query: 538 INSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXX 597
           +++  KLKE ++ M  ++  Y   E  +Q  +K +                 Q       
Sbjct: 528 VSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMD----QHLETVKT 583

Query: 598 XXXXXXXXXXXAHEEIKQILQISENEIDSLFLD-C--IKKMSEESPKL-FSSFIQDVSRL 653
                        +EI+ I   + + + S   D C  I K+ ++ P   +  F + +  L
Sbjct: 584 RMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDL 643

Query: 654 ENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDF 713
           +         L   L++++EE NN+K+Y++E F KNN++E+L   + K YH+ + +SD  
Sbjct: 644 DTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDAL 703

Query: 714 LLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSN 773
           +     ++ES++E +++++L ++K A SE+I+ E+  F P KE+W  S E I +   +  
Sbjct: 704 ISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQ 763

Query: 774 EFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMK 833
           +F+ K+  ++  L++    +  +  D   +++  +   +                  I  
Sbjct: 764 QFENKSTKLLTNLKELADNSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDIND 823

Query: 834 KNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQR 893
           K+ +L+D    N+   +ES   F+++D SI+ + + E+   +   + I + + ++++ + 
Sbjct: 824 KHKMLEDHFENNIKYFKESSKGFEEMDCSIKKIIR-EMSPEVGDIKQI-EALLERVNSRS 881

Query: 894 LTPNMRNRKSPVRQSV------SPSRTSPQIQSL 921
             P     K+P+R  +      + SR+   I+SL
Sbjct: 882 FGPIASTGKTPMRPELKNPIPKTRSRSMSPIKSL 915

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  466 bits (1199), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 312/914 (34%), Positives = 497/914 (54%), Gaps = 42/914 (4%)

Query: 7   VKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------IKFKGKDDAV----- 54
           + D  E NI V  R +G+  NEK    R  +++  P +       I   G D  +     
Sbjct: 1   MSDDEELNITVAVRCRGR--NEKEVKARSSVVVAVPDVTGTNEVSINTTG-DTGITAQIN 57

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
            + + +D +F     Q  ++    +P+FQDFI GYNC+ LVYG T +GKTYT++G+E  L
Sbjct: 58  SKTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RL 116

Query: 115 LHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSAS 174
              E S    G+IPRVL +LFD LS    D+++KCS++E+YNEELKDLL +  +S +   
Sbjct: 117 YDGELSE-GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMP-- 173

Query: 175 IKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLS 234
            KKLRI DS S      +NS  ++R+NSP  +  S             S    ++    S
Sbjct: 174 -KKLRIFDSVS---NVSSNSRASSRNNSPKPNEGS-------------SFGTRRKTRAPS 216

Query: 235 ISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKY 294
           I R        P     E + A +IQNL+EFHI +AKEGI+LL RGL++RQ+AS+K    
Sbjct: 217 IHRPTKSPVSKPVSPC-EPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDV 275

Query: 295 SSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXX 354
           SSR+ TIFTI+LYK+  GE FRVSK N VDLAG+E+  +    NQR K+           
Sbjct: 276 SSRSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 335

Query: 355 XXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNK 414
              +NSL +K   IPF++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K
Sbjct: 336 GRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATK 395

Query: 415 VRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKH 474
            +++K  P +G  I K+ L+KS++ EL K+KSDLLSTKSK+G+YMS E+Y  LT +L+ +
Sbjct: 396 AKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENY 455

Query: 475 KVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRRE 534
           K E+ + K+ +++++ Q++ L K+KR   EVNE Q++KL+ + +++  +Y  I++Q + E
Sbjct: 456 KTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNE 515

Query: 535 HDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXX 594
            +L N   +L   ++ M  ++  Y D+     T+M+ +                 +    
Sbjct: 516 QELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKIN 575

Query: 595 XXXXXXXXXXXXXXAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLE 654
                            E+ +I     +    +F + IKK+++++P  F      V  + 
Sbjct: 576 VDENGDDVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESIT 635

Query: 655 NSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFL 714
           +  S   +NL   LS +SEE+NNLK Y+NE FFKNN +E L  +V++TYHQ++ S++   
Sbjct: 636 SVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIF 695

Query: 715 LKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNE 774
           LK  ++L   L+ NK  ++Q+++ A SEV+  EM    P K+ WE S+E I +    +N 
Sbjct: 696 LKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNV 755

Query: 775 FKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKK 834
           F+ K  V V ++  T+    ++   T  + KS++  ++ A               SI KK
Sbjct: 756 FENKIGVTVNEIFKTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKK 815

Query: 835 NGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQS--ILKEIFDQLDQQ 892
           + +LK  +  +    + +   F ++D+SI+++   +    I   QS   +  + +QL+ +
Sbjct: 816 HNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQ---TIPQPQSENPIDGLLEQLNDK 872

Query: 893 RLTPNMRNRKSPVR 906
            L P   + K+P+R
Sbjct: 873 SLKPLGPSGKTPMR 886

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  449 bits (1155), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 301/943 (31%), Positives = 503/943 (53%), Gaps = 59/943 (6%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------IKFKGKDDAV-----KREFG 59
           E NI V  R +G+  NEK    +  +++  P +       I   G D  +      + + 
Sbjct: 6   ELNITVAVRCRGR--NEKEVKAKSSVVVAVPDVTGTNEVSINTTG-DTGITAQINSKTYT 62

Query: 60  MDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEA 119
           +D +F     Q  ++    +P+FQDFI GYNC+ LVYG T +GKTYT++G+E  L   E 
Sbjct: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLYDGEL 121

Query: 120 SRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLR 179
           S    G+IPRVL +LFD L  +N D+++KCS++E+YNEELKDLL +  +S +    +KLR
Sbjct: 122 SE-GAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMP---RKLR 177

Query: 180 IVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSN 239
           I DS +    N + S+       P   S    T+  ++++   ++    ++ T+  + S+
Sbjct: 178 IFDSVT--NPNSSRSSSRNSSPKPPEGS----TSGTKRRIRPNTMYKPSRSPTVKPTLSS 231

Query: 240 SFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAS 299
             N             A +IQNL+EFHI +AKEGI+LL RGL++RQ+AS+K    SSR+ 
Sbjct: 232 ELN------------SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSH 279

Query: 300 TIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVN 359
           TIFTI+LY++  GE FRVSK N VDLAG+E+  +    NQR K+              +N
Sbjct: 280 TIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN 339

Query: 360 SLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           SL +K + IPF++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K +++K
Sbjct: 340 SLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399

Query: 420 CYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIM 479
             P +G  I K+ L+K+++ EL K++SDLL+TKSK+G+YMS E+Y  LT +L+ +K E+ 
Sbjct: 400 NKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQ 459

Query: 480 DLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLIN 539
           + K+ I+ L+ Q+  L K+KR   EVNE QR+K++ + +++  +Y  I++Q + E +L N
Sbjct: 460 ECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSN 519

Query: 540 STDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXX 599
              +L   +  M  ++  Y D+    QT+M+ +                 +         
Sbjct: 520 VVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGF 579

Query: 600 XXXXXXXXXAHE--EIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENST 657
                      E   I   +  S  EI   F++   K++E++P         V  + +  
Sbjct: 580 DVDANIDTLTKELNRIYDFINTSTIEICRKFMN---KITEQTPTYLQDIRNQVESITHVV 636

Query: 658 SENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKF 717
               ++L   LS +SEE+N+LK Y+NE FFKNN ++ L  +V++TYHQ++ S++   LK 
Sbjct: 637 GSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKL 696

Query: 718 NDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKT 777
            +++   LE NK +++Q++K+A SEV+  EM    P K+ WE S+E I +    ++ F+ 
Sbjct: 697 REMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFE- 755

Query: 778 KNRVIVGKLQDTLKGTSESLF---DTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKK 834
             + I   ++D  +  +E L      + +    ++  Q A+               I KK
Sbjct: 756 --KDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKK 813

Query: 835 NGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRL 894
           + +LK  +  + +  E +   F ++DDSI+ +  ++  +       I + + +QL+ + L
Sbjct: 814 HNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENRI-EGLLEQLNGKPL 872

Query: 895 TPNMRNRKSPVRQSVSPSRTSPQIQSLMNSDLLQFNEARSFAV 937
            P   + K+P+R +            + +SD L     RS+++
Sbjct: 873 KPLGPSGKTPMRITQG---------CIASSDQLSLPRKRSYSI 906

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  447 bits (1151), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 294/922 (31%), Positives = 498/922 (54%), Gaps = 55/922 (5%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDD---AVK---REFGM 60
           E NI V  R +G+  NE+    +  +++  P +     +     D+   A K   R + +
Sbjct: 20  ELNITVAVRCRGR--NEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77

Query: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120
           D +F     Q  ++ +  +P+F DF+ GYNC+ LVYG T +GKTYT++G+E   L+    
Sbjct: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEK--LYDGQL 135

Query: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180
             S G+IPR++ +LFD L   + D +VKCSY+E+YNEELKDLL + H+S      K+LRI
Sbjct: 136 SDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDS-----SKRLRI 190

Query: 181 VDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSNS 240
            DS S N  +   S+ +     P  +         R+   RQ    +K AN +S ++   
Sbjct: 191 FDSSSMN-HSSRASSQSNSPREPEVAHNGFS----RR---RQRPPPVK-ANRMSATK--- 238

Query: 241 FNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300
                  + + E     Y+QN++EFHI NA+EGI +L +GLK+RQ+AS+K   +SSR+ T
Sbjct: 239 -------QQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHT 291

Query: 301 IFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNS 360
           IFTI+LYK  +GE+FRVSK N VDLAG+E+  +    NQR K+              +NS
Sbjct: 292 IFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS 351

Query: 361 LHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKC 420
           L +K   IPF++SKLT L++D+L GN+K+  I T+   K + DE   TLE+  K +++K 
Sbjct: 352 LADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKN 411

Query: 421 YPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMD 480
            P LG  + K+ L+K+IS+ELAK+KSD LSTKSK+G+YMSHEHY  +  DL+  + EI +
Sbjct: 412 RPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQE 471

Query: 481 LKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINS 540
            K+ I+ L  Q+  L KDK+A +EV E+Q  K++ ++ ++  +Y  IE+Q   E +L  +
Sbjct: 472 SKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATT 531

Query: 541 TDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXX 600
             KLKE ++ M  ++  Y   E  +Q  +K +                 +          
Sbjct: 532 IHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNL 591

Query: 601 XXXXXXXXAHEEIKQILQISENEIDSL------FLDCIKKMSEESPKLF-SSFIQDVSRL 653
                     E I  I  I ++ + S+        D + K+ +E+P ++   F + VS L
Sbjct: 592 SIK-------ENINNITTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSL 644

Query: 654 ENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDF 713
           ++  S   N L   L+++SEE N+L++Y+++  FKN+ +E+L   +   Y +V+  SD  
Sbjct: 645 KSELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQL 704

Query: 714 LLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSN 773
           L K   ++ +++E ++++++ ++K   +E+I+NE + F P +++W  S + I +   S  
Sbjct: 705 LSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQ 764

Query: 774 EFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMK 833
            F+ K+   + KL++    + +S  D +++ K + +                     I  
Sbjct: 765 NFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISD 824

Query: 834 KNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQR 893
           K+ +L+D  + N+   +ES   F+ +D SI+ +  +E+   +   +S+ + + ++++ + 
Sbjct: 825 KHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKII-HEMSPEVGDIKSV-ETLMERINART 882

Query: 894 LTPNMRNRKSPVRQSVSPSRTS 915
            +P     K+P RQ +  + TS
Sbjct: 883 FSPVRPTGKTPSRQVLKNAITS 904

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  422 bits (1085), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/669 (34%), Positives = 390/669 (58%), Gaps = 2/669 (0%)

Query: 247 QRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVL 306
           Q+ + E++ A YIQNL+EFHITNAK+GI LL RGLK+RQ+AS+K   +SSR+ TIFTI+L
Sbjct: 251 QQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIML 310

Query: 307 YKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKES 366
           YK   GE+FRVSK N VDLAG+E+  +    NQR K+              +NSL +K +
Sbjct: 311 YKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 370

Query: 367 VIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGP 426
            IPF++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K +++K  P LG 
Sbjct: 371 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGT 430

Query: 427 SINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVID 486
            + K+ L+K+I+ ELAK+KSD LSTKSK+G+YM+ +HY  LT DL+ +K E+ + K+ I+
Sbjct: 431 LVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIE 490

Query: 487 ELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKE 546
           ++N Q+  L KDKRA  EV+E+QRIK++ + D ++ +Y  ++KQ + E DL+ +   LK+
Sbjct: 491 KMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKD 550

Query: 547 TVNNMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXX 606
            +  +  ++    D +   +++M+ +                                  
Sbjct: 551 AIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNI 610

Query: 607 XXAHEEIKQILQ-ISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLA 665
               EE+ Q+L+ I    +D +   C++K+ E +PK F S  +D+  +        N L 
Sbjct: 611 DIIQEELSQVLESICSTSVD-VCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELV 669

Query: 666 ELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYL 725
           + L D+SEE+NN ++Y+NE  FKNNHEE L  +V+KTYH ++KS+ +   KF ++++S+L
Sbjct: 670 KNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHL 729

Query: 726 EGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGK 785
           E NKS++++++K+A+ EV+  E+  F P K+KWE S+E I K    +N F +  +  + +
Sbjct: 730 EENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRR 789

Query: 786 LQDTLKGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKKNGILKDTLNIN 845
           L+  ++G+ E   +T  ++K  + +    +               + +K+  L+D +   
Sbjct: 790 LEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERT 849

Query: 846 MTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPV 905
            +  E +   F+ +D  IR +   ++ T++ G   ++  + +QL +  L P     ++P 
Sbjct: 850 SSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPIGSASRTPS 909

Query: 906 RQSVSPSRT 914
            +SVSP +T
Sbjct: 910 SRSVSPMKT 918

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  420 bits (1079), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 238/617 (38%), Positives = 378/617 (61%), Gaps = 2/617 (0%)

Query: 252 EKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE 311
           +K    YIQNL+EFHIT+AKEGI+LL RGL+ RQ+AS+K   +SSR+ TIFTI LYKE +
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 312 GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFK 371
           G+IFR+SK N VDLAG+E+  +    NQR K+              +NSL +K   IPF+
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE 431
           +SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K +S+K  P LG  I K+
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 432 TLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQ 491
            L+K+I++ELAKVK+DLLSTKS++GVYMS  HY  LT DL+ +K E+ + K+VID L  Q
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 492 STTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNM 551
           +  L KDK+A  EV+ +Q+IKLQSM+DS+S ++ +IEKQ R+E  L++   KLK     M
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 552 NVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHE 611
             TI  +++RE   Q +MK +F                +                    +
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 612 EIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYN-NLAELLSD 670
           E+K I+  ++ E + ++ DC++++ +ESP L  S   D+ +++   S+ YN  L+  +S+
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQ-KISDLYNEQLSISISE 716

Query: 671 VSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKS 730
           ++ E N+LKQY+N  FFK++HEE+L  ++ KTY  ++++S   + +    LE YLE +++
Sbjct: 717 LNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRN 776

Query: 731 VLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTL 790
           +++ ++K+ TS+++++EM  F P+K+KWE S E+I K    +N++      ++  ++ ++
Sbjct: 777 IIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSV 836

Query: 791 KGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTSTE 850
             TS+ + D +S+M+   +   ++             F  +M+KN  L+  LN ++T  E
Sbjct: 837 TSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNE 896

Query: 851 ESIVAFDKLDDSIRNVF 867
            SI AFDKL +SI + F
Sbjct: 897 SSINAFDKLSESIHSAF 913

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  405 bits (1040), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 267/845 (31%), Positives = 448/845 (53%), Gaps = 73/845 (8%)

Query: 56  REFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLL 115
           + + +D ++  D  Q+ ++ D  +P+F DF+ GYNC+ LVYG T +GKTYT++G+ +   
Sbjct: 77  KTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGA 136

Query: 116 HSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSL----- 170
             + +    G+ PR+L +LF+   C   D+VVKCS+VE+YNE+L+DLL +  +       
Sbjct: 137 EGDVNG-QAGIAPRILVKLFE---CLQDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTE 192

Query: 171 --------LSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQ 222
                   L+AS KKLRI DS             N+R NSP+T++ + PT   R    ++
Sbjct: 193 NSSKQPESLNAS-KKLRIFDSN------------NSRSNSPVTNTNN-PTHKARSDYLKK 238

Query: 223 SLTALKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLK 282
            L + ++ +   +S + +      + H+       YIQNL++FHI+ AKEG+QLL RGL+
Sbjct: 239 KLKSNRKKSLDDMSLNAN---AGGKTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQ 295

Query: 283 NRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFK 342
            RQ+A++K    SSR+ TIFTI LYK+ + +++R+SK N VDLAG+E+ +K    N R K
Sbjct: 296 RRQVATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAK 355

Query: 343 DXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSL 402
           +              +NSL +K + IPF++SKLT L++D+L GN+K++ I T+   K + 
Sbjct: 356 ESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415

Query: 403 DEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHE 462
           +E   TLE+ +K +++K  P LG  I K+ L+K +S EL K+++DL  TKSKEG+Y+S +
Sbjct: 416 EETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQK 475

Query: 463 HYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSM 522
           +Y  +  DLD  K E+ +LK+  D L +++  L K+K++  E  +  + +L ++R  +  
Sbjct: 476 NYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKS 535

Query: 523 MYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFXXXXXXXXX 582
           +                 T+KL +T N  N  ++      + +QT++K+L          
Sbjct: 536 V-----------------TNKLAQT-NTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHET 577

Query: 583 XXXXXXRQFXXXXXXXXXXXXXXXXX-----------------AHEEIKQILQISENEID 625
                 R                                       E+  +L+ ++   +
Sbjct: 578 SKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIHTHIDSIRGEVMNLLETTKENAE 637

Query: 626 SLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEK 685
           +L+  CI  + +E+PK+F     +V  +   T E+Y  +A   SD+SEEFN  KQY++ +
Sbjct: 638 TLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQ 697

Query: 686 FFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIE 745
           FF+NNH E+++T+ +     +QK SDD L    + +++YL  N  ++  +I     +VI 
Sbjct: 698 FFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVIN 757

Query: 746 NEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMK 805
            EM+ F P+K KWE+SI+LI +S   SN+F+      V  +   ++ ++ES+  ++S +K
Sbjct: 758 KEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIK 817

Query: 806 SKI--NELQKAAXXXXXXXXXXXXFISIMKK-NGILKDTLNINMTSTEESIVAFDKLDDS 862
             I  N++  +             F +I +K N IL         + +ES+     LD S
Sbjct: 818 KHIIENDIN-SQEQINSNELLTNSFKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRS 876

Query: 863 IRNVF 867
           IR + 
Sbjct: 877 IRTLI 881

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  390 bits (1001), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 230/661 (34%), Positives = 379/661 (57%), Gaps = 15/661 (2%)

Query: 252 EKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE 311
           ++T   YIQNL+EFHITNA EG+ LL +GLK+RQ+AS+K   +SSR+ TIFTI LYK+ +
Sbjct: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370

Query: 312 GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFK 371
            E+FR+SK N VDLAG+E+ ++    NQR K+              +N+L +K   IPF+
Sbjct: 371 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 430

Query: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE 431
           +SKLT L++D+L GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  I K+
Sbjct: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD 490

Query: 432 TLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQ 491
            L+K+I+ ELAK+KSDLLSTKSKEG+YMS +HY  L  DL+ +K E+ + K+ I+ L  +
Sbjct: 491 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSK 550

Query: 492 STTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNM 551
           +  L KDK   +E  + Q  +++S++ ++  +   ++KQ + E ++ +  +KL++    M
Sbjct: 551 NALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVM 610

Query: 552 NVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHE 611
            + +  Y  RE  +  + +                                         
Sbjct: 611 QMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKN 670

Query: 612 EIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDV 671
           E+  +++  + + + ++ DC+KK+  ESPK F+  I+ +  +     + Y N+AE LSD+
Sbjct: 671 EVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDI 730

Query: 672 SEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSV 731
           SEE NN+KQY+   FFKNNH+ELL  +V+ TY  ++K +++F+  F  +L  +L+ NK +
Sbjct: 731 SEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKL 790

Query: 732 LLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLK 791
           ++QN+ +ATS VI+ EM+ F P++ KWE S +LI      +NEF       + +++ T+ 
Sbjct: 791 IMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVD 850

Query: 792 GTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTSTEE 851
            +S S+ +++S MK ++ E + A             F  ++ K+ +LKD +  ++TST  
Sbjct: 851 TSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHS 910

Query: 852 SIVAFDKLDDSIRNVFKN----EIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVRQ 907
            I   D + ++I N+ KN    E  T     ++ILKEI          PN+ ++K P+R 
Sbjct: 911 HITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEI----------PNL-SKKMPLRL 959

Query: 908 S 908
           S
Sbjct: 960 S 960

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  355 bits (912), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 218/690 (31%), Positives = 380/690 (55%), Gaps = 17/690 (2%)

Query: 250 IQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKE 309
           + E++ A YIQ+L+EFHIT+AKEG++LL +GL +RQ+AS+K    SSR+ TIFT+ LYK 
Sbjct: 262 VNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKN 321

Query: 310 EEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIP 369
             GE FRVSK N VDLAG+E+  +    NQR K+              +NSL +K + IP
Sbjct: 322 FNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIP 381

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSIN 429
           F++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K +++K  P LG  + 
Sbjct: 382 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMM 441

Query: 430 KETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELN 489
           K+ L+K+IS+ELAK+KSD LSTKSKEG+YMSH HY+ +  D++ +K EI + ++ I++L+
Sbjct: 442 KDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLS 501

Query: 490 EQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVN 549
            Q+  L KDK++ ++  E QR+++++++ S+  +Y  I+ + + E +L N   KLK+ V 
Sbjct: 502 SQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVR 561

Query: 550 NMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXA 609
           NM   +  + D E  +Q+ ++ +                                     
Sbjct: 562 NMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNV 621

Query: 610 HEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLS 669
            + ++ +L+  + +   +  +  +K+  + PK F+S + +++ + +   E+ + L E LS
Sbjct: 622 KDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLS 681

Query: 670 DVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNK 729
            ++ E NNLK Y++  FF+NNH+E+L  + +KTYHQ+  SS   + K  +++  ++E N+
Sbjct: 682 QITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNR 741

Query: 730 SVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDT 789
           ++L+  +K+AT+EVI  EM+HF P ++ WE+S   I      SN+FK      +  L+  
Sbjct: 742 TLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSH 801

Query: 790 LKGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTST 849
           ++ T         ++K  +   Q                  I  K+ +L+D L  N++  
Sbjct: 802 MESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFI 861

Query: 850 EESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVR--- 906
             S   F  +D S++ +    +    T  +++  ++   +D   + P   + K+P+R   
Sbjct: 862 HASSEGFKAIDSSLKRIMNFRMPEGKT--ETLADDLIKHIDSSSVAPVASSGKTPLRPLL 919

Query: 907 ----------QSVSPSRTSPQIQSLMNSDL 926
                     +SVSP+++S    +++NS L
Sbjct: 920 KSETKQRSLSKSVSPAKSSH--ATIINSPL 947

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  351 bits (900), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 212/641 (33%), Positives = 350/641 (54%)

Query: 250 IQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKE 309
           IQ    + YIQNLEEFHI NA+EGIQLL +GLK RQ+AS+K    SSR+ TIFTI LYKE
Sbjct: 231 IQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKE 290

Query: 310 EEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIP 369
            +GEIF++SK N VDLAG+E+  +    NQR K+              +NS+ +K   IP
Sbjct: 291 HKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIP 350

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSIN 429
           F++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K +S+K  P LG  I 
Sbjct: 351 FRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIM 410

Query: 430 KETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELN 489
           K+  +K ++NELAK+K DL STK K+GVYM+  HY  LT DL+ +K EI +  +++  L 
Sbjct: 411 KDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLE 470

Query: 490 EQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVN 549
            Q+  L KDK+A  EVN++Q + L  M +++S + T +E Q ++E  L+      +E   
Sbjct: 471 LQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSL 530

Query: 550 NMNVTIARYTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXA 609
            M   I  Y+++E  +Q+ MK++F                                    
Sbjct: 531 KMKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLI 590

Query: 610 HEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLS 669
            +++  I+  S+     LFL+  +++ +E+P +   F  DV + +      + NL E L 
Sbjct: 591 KDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLE 650

Query: 670 DVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNK 729
            + ++++ L +Y +  FFK+NH  ++  +VN T   ++KS  D   +F   +E++ E N+
Sbjct: 651 SIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNE 710

Query: 730 SVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDT 789
            ++L+N+K+ +S++I+NEMN F   K +W+ S + I    + +N +  +    +  ++  
Sbjct: 711 KLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGK 770

Query: 790 LKGTSESLFDTLSEMKSKINELQKAAXXXXXXXXXXXXFISIMKKNGILKDTLNINMTST 849
           L+ + E +   ++++KS ++ L                +  I+ K   L D L I++ ST
Sbjct: 771 LQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNST 830

Query: 850 EESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLD 890
           + S++ FD++  SI+  F N   TN+     +   +F  +D
Sbjct: 831 QNSLLVFDEICKSIQFAFANYSKTNLQESALLKGRLFADID 871

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  300 bits (767), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 179/543 (32%), Positives = 304/543 (55%), Gaps = 18/543 (3%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRV 317
           YIQNL+EF+I NA +GI+LL +GL++R++AS+K    SSR+ TIFTI LYKE  G ++RV
Sbjct: 335 YIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRV 394

Query: 318 SKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTY 377
           SK N VDLAG+E+ +K    +QR K+              +NSL +K   IPF++SKLT 
Sbjct: 395 SKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTR 454

Query: 378 LIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSI 437
           L++D+L GN+K++ I T+   K ++DE   TLE+ +K +++K  P LG  I K+ L+K+I
Sbjct: 455 LLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNI 514

Query: 438 SNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRK 497
           + EL K+KSDL+ST+ K+GVYMS +HY  L  DL+ +K E+ + K+  + L  Q+ +L K
Sbjct: 515 TTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNGSLLK 574

Query: 498 DKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIAR 557
           DK+A  E+NE+QRI+++   + +  +Y  +++  +RE  L+    +LK    +M  TI  
Sbjct: 575 DKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSMQSTIEN 634

Query: 558 YTDRESSVQTQMKTLFXXXXXXXXXXXXXXXRQFXXXXXXXXXXXXXXXXXAHEEIK--- 614
           Y +R+  ++   K +                                    + E I    
Sbjct: 635 YRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIEAIDSSN 694

Query: 615 -------------QILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENY 661
                        +IL+  + +   ++  CI+++  + P + + F  +++ ++   ++ +
Sbjct: 695 FQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQYNDQF 754

Query: 662 NNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLL 721
           N + E LSD+SEE+NN K+Y+N  F +NN+E +LK ++     Q++  S++ LL  N  +
Sbjct: 755 NKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNLLLNINKQI 814

Query: 722 ESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKT--KN 779
             +   N  +  + + +  +++++ E     P KEKW KSIE+I  +   +N F     N
Sbjct: 815 NEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTFHNDMNN 874

Query: 780 RVI 782
           R++
Sbjct: 875 RIL 877

 Score =  125 bits (314), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 107/185 (57%), Gaps = 19/185 (10%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV------KREFGM 60
           E NI V  R +G+  NE+    +  +++  P +     +     D+         + + +
Sbjct: 10  ELNITVAVRCRGR--NEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67

Query: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120
           D +F     Q+ ++ +  +P+F+DFI GYNC+ LVYG T +GKTYT++G+E  L   E S
Sbjct: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE-KLYDGELS 126

Query: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180
             S G+IPRVL +LF+     N D+++KCS+VE+YNE+LKDLL D     +  + KKLRI
Sbjct: 127 D-SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDS----VDNTYKKLRI 181

Query: 181 VDSGS 185
            DS S
Sbjct: 182 FDSMS 186

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  218 bits (555), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 152/532 (28%), Positives = 271/532 (50%), Gaps = 69/532 (12%)

Query: 8   KDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAV----------KRE 57
           + ++  NIKV  R + +  N++  D +  +++   G    KGK   +          K+ 
Sbjct: 38  RHQIGSNIKVYVRCRSR--NQREIDEKSSVVVSTMGR---KGKSVILSNPSSPLSHPKKT 92

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE------- 110
           +  D +F +D  QE ++ +  K   Q+ + GYNC+   YG+TG+GKTYT+SG+       
Sbjct: 93  YMFDEVFGADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDL 152

Query: 111 --EDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHN 168
             +D +L  E +    G+IPRVL  LF  LS    +H VK S++E+YNE LKDLL D   
Sbjct: 153 DSQDKILLGEHA----GIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADN-- 206

Query: 169 SLLSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALK 228
               +    +RI D+ + N    +N     + N     + ++  A +       S ++  
Sbjct: 207 ---DSDEDNIRIFDNNNSNAHGASNGMSQVKMNKSKVRAPTLSGATVSSSASNSSTSSSS 263

Query: 229 QANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIAS 288
            ++++++                        + +EE +I +A EG+QLL +G   R++A+
Sbjct: 264 SSSSITV------------------------KGMEERYIKSAYEGLQLLTKGSLKRKVAA 299

Query: 289 SKNQKYSSRASTIFTIVLYKEE----EGEIF-RVSKWNFVDLAGAEHSHKIEGTNQRFKD 343
           +K    SSR+ TIFTIV +        GE + ++ K N VDLAG+E+ ++    N R ++
Sbjct: 300 TKCNDLSSRSHTIFTIVTHVARTDPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQE 359

Query: 344 XXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLD 403
                         +N+L E  S IP++ SKLT L++D+L G +K+  I T+   + S+D
Sbjct: 360 AGLINKSLLTLGRVINALVEHSSHIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMD 419

Query: 404 EMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEH 463
           E + TLE+  + +S+K  P +  S++K++ I     E+ +++ +L +++ +EG+Y++ E 
Sbjct: 420 ETVSTLEYATRAKSIKNTPQVNQSLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQ 479

Query: 464 YDVLTKD---LDKHKVEIMDLKKVIDELNE---QSTTLRKDK-RAFEEVNEV 508
           YD+   +   +++ KV I ++ + I    E   + T L K+  R F+E  +V
Sbjct: 480 YDLYESNSLLVEEQKVVIQNMGEQIKRFKEKYVEQTKLSKEAHRQFQESQKV 531

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  192 bits (487), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 138/500 (27%), Positives = 251/500 (50%), Gaps = 76/500 (15%)

Query: 10  KVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPG-------LIKFKGKDDAVKREFGMDH 62
           +V  N++V  R + +  NE+  + +  ++I   G       L    G     KR +  D 
Sbjct: 37  RVSSNMRVYVRCRSR--NEQEIEEKSSVVISTLGAKGREVILSNGAGSLSHSKRTYTFDQ 94

Query: 63  IFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE---------EDS 113
           +F ++  QE ++ +  K    + + GYNC+   YG+TG+GKTYT+SG+         +D 
Sbjct: 95  VFGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDK 154

Query: 114 LLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSA 173
           +L  E S    G+IPRVL +LF  LS    ++ VK S++E+YNE+LKDLL +        
Sbjct: 155 ILLGEHS----GIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEE--- 207

Query: 174 SIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTL 233
             + +RI D       N +  NCN          K++   +  K  G    T+   +++ 
Sbjct: 208 --ENIRIFD-------NNSGFNCN----------KNVKQLV--KLDGSSHRTSSASSSSS 246

Query: 234 SISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQK 293
           SI                       ++ +EEF+I +A EG++LL  G   R++A++K   
Sbjct: 247 SI----------------------MVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCND 284

Query: 294 YSSRASTIFTIVLYKEEEGEI-----FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXX 348
            SSR+ T+FTI         +      ++ K N VDLAG+E+ ++    N+R ++     
Sbjct: 285 LSSRSHTVFTITTNVARTDPVSNEQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLIN 344

Query: 349 XXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIET 408
                    +N+L +    IP+++SKLT L++D+L G +K+  I T+   K S+DE + T
Sbjct: 345 KSLLTLGRVINALVDNSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVST 404

Query: 409 LEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLT 468
           LE+  + +S+K  P +  S++K + +    +E+ +++ +L +++ KEG+Y++ + + +  
Sbjct: 405 LEYATRAKSIKNTPQVNQSMSKNSCLGEYIHEIERLRQELKASRQKEGMYITEDQFQLYE 464

Query: 469 KD---LDKHKVEIMDLKKVI 485
            +   +++ KV I +++  I
Sbjct: 465 SNSILVEEQKVRIQNMEDQI 484

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  188 bits (478), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 126/425 (29%), Positives = 214/425 (50%), Gaps = 71/425 (16%)

Query: 56  REFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE----- 110
           + +  D +F  +  QE L+    +    + + GYNC+   YG+TG+GKTYT+SG+     
Sbjct: 100 KTYTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVG 159

Query: 111 ---EDS--LLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVD 165
              ED   +L SE +    G+IPRVL ELF  L   + D+ VK S++E+YNE+L+DLLV+
Sbjct: 160 ASLEDPNYVLLSEHA----GIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVE 215

Query: 166 QHNSLLSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLT 225
               L          +D G   +  G         NSP T                    
Sbjct: 216 DKEPL----------IDEGG--IGGGVA-------NSPET-------------------- 236

Query: 226 ALKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQ 285
            ++  + L + RSNS               +  ++ +EE +I +A+EG++LL  G   R+
Sbjct: 237 -IRIYDNLKLDRSNSSGH------------SIMVKGMEEMYIRSAQEGLKLLMEGSLKRK 283

Query: 286 IASSKNQKYSSRASTIFTIV-----LYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQR 340
           +A+++    SSR+ TIFTI      ++     +  ++ K N VDLAG+E+ ++    N+R
Sbjct: 284 VAATRCNDLSSRSHTIFTITTNVTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKR 343

Query: 341 FKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKD 400
            ++              +N+L +    IP+++SKLT L++D+L G +K+  I T+   K 
Sbjct: 344 AQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKT 403

Query: 401 SLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMS 460
           S++E   TLE+  + +S+K  P +   + KE+ I     E+ K++ +L +  +KEG+Y++
Sbjct: 404 SMEETASTLEYATRAKSIKNTPQINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYIT 463

Query: 461 HEHYD 465
            E Y+
Sbjct: 464 EEKYE 468

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  186 bits (472), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 144/510 (28%), Positives = 245/510 (48%), Gaps = 84/510 (16%)

Query: 56  REFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE----- 110
           R +  D +F  +  QE L+    K    + + GYNC+   YG+TG+GKTYT+SG+     
Sbjct: 129 RTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYGQTGTGKTYTMSGDLNILG 188

Query: 111 ----EDSLLHSEASRLSVGVIPRVLEELFDHLSCN------------------------- 141
               +D +L  E +    G+IPRVL  LF  LS N                         
Sbjct: 189 NLDSKDKILLGEHA----GIIPRVLVYLFKELSKNDTITNTKVNNNKNNNNNSNNKNEEQ 244

Query: 142 ----NIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRIVDSGSP--NVKNGANSN 195
               N ++ VK S++E+YNE+L DLL +     L+++ K +      S   ++ NG N N
Sbjct: 245 INLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDKLINQTSGNSTPYSITNGLNVN 304

Query: 196 CNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSNSFNEYSPQRHIQEKTG 255
                               + K+   +L      N   +S  N        +      G
Sbjct: 305 D-------------------KFKIKNNNLHDFDGKNVRIMSNQN--------KSASNCNG 337

Query: 256 APY-IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVL----YKEE 310
           +   ++ +EE +I +A EG+QLL  G   R++AS+K    SSR+ TIFTI+         
Sbjct: 338 SSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPV 397

Query: 311 EGEIF-RVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIP 369
            G+ F +  K N VDLAG+E+ ++    N+R ++              +N+L ++   IP
Sbjct: 398 TGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIP 457

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSIN 429
           +++SKLT L++D+L G +K+  I T+   K SL+E + TLE+  + +S+K  P +  S++
Sbjct: 458 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLS 517

Query: 430 KETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELN 489
           K+T I    NE+ +++++L   ++KEG+Y++ +  D+     + + + I + K  ID + 
Sbjct: 518 KDTFIHEYINEIDRLRNELKLARTKEGIYITQDQLDL----YESNSILITEQKAKIDNME 573

Query: 490 EQSTTLRKDKRAFEEVNEVQRIKLQSMRDS 519
           +Q   +++ K  + E  E  RI L  +  S
Sbjct: 574 DQ---IKRFKAKYVEETESNRILLNKLEQS 600

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  179 bits (455), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/455 (28%), Positives = 233/455 (51%), Gaps = 79/455 (17%)

Query: 54  VKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE--- 110
            K+ +  D +F  +  QE ++  + +    + + GYNC+   YG+TG+GKTYT+SG+   
Sbjct: 104 TKKTYIFDQVFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINI 163

Query: 111 ------EDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLV 164
                 +D +L  E +    G+IPRVL  LF +L+  + ++ VK S++E+YNE LKDLL 
Sbjct: 164 LGDLESQDKILLGEHA----GIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLL- 218

Query: 165 DQHNSLLSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSL 224
               S    + + +RI D+  P+             NS +  S                 
Sbjct: 219 ----SQSKETEESIRIFDNHIPS------------GNSKIQKS----------------- 245

Query: 225 TALKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNR 284
                      SR+N+++             +  ++ +EE +I +A EG+QLL  G   R
Sbjct: 246 -----------SRNNTYS-------------SIMVKGMEEIYIKSAHEGLQLLTEGSLKR 281

Query: 285 QIASSKNQKYSSRASTIFTIVLYKEE----EGEIF-RVSKWNFVDLAGAEHSHKIEGTNQ 339
           ++AS+K    SSR+ TIFTI     +     GE + ++ K N VDLAG+E+  +    N 
Sbjct: 282 KVASTKCNDLSSRSHTIFTITTNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENM 341

Query: 340 RFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNK 399
           R ++              +N+L +    IP+++SKLT L++D+L G +K+  I T+   K
Sbjct: 342 RAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAK 401

Query: 400 DSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYM 459
            S++E I TLE+  + +S+K  P +  S++K+  I     E+ +++ +L +++ K+GVY+
Sbjct: 402 ISMEETISTLEYATRAKSIKNTPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYI 461

Query: 460 SHEHYDVLTKD---LDKHKVEIMDLKKVIDELNEQ 491
           + E +D+   +   +D+ K +I+++++ I +  E+
Sbjct: 462 TQEQFDLYESNGILVDEQKAKIVNMEEQIKKFKEK 496

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  135 bits (339), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 113/423 (26%), Positives = 185/423 (43%), Gaps = 93/423 (21%)

Query: 5   DGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKREFGMDHIF 64
           +G  DK    +KVV R +   +          ++  + G ++F G  D   R F  D++F
Sbjct: 17  EGADDK----MKVVVRLRPLPEGGSA-----AVVAADEGTVEFAGAADEA-RAFRFDYVF 66

Query: 65  SSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSV 124
            +D  QE+++    + M   F  GYN + L YG+TGSGK+YT+ G      H        
Sbjct: 67  GTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPPG---HR------- 116

Query: 125 GVIPRVLEELFDHLS----CNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180
           G+IPR+ +++F+ +     C +I++VV  S++EIY E++ DLL +  N            
Sbjct: 117 GLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLGESIN------------ 164

Query: 181 VDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSNS 240
                             + +SP  +S             R SLT         +  SN+
Sbjct: 165 ------------------KASSPKKNSDK-----------RASLT---------VHESNT 186

Query: 241 FNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300
           F                Y++      +++  E +  +H G   R   S+     SSR+  
Sbjct: 187 F--------------GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHA 232

Query: 301 IFTIVLYKEE--EGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXV 358
           I  I L K +  EG I + S    VDLAG+E   K        ++              +
Sbjct: 233 IVKINLLKRDNLEGNIQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVI 291

Query: 359 NSLHEKE--SVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVR 416
           N+L +KE  + IP++DS+LT L++D+L GNSK+  IL    +K +  E + TL FG++ +
Sbjct: 292 NALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAK 351

Query: 417 SLK 419
            +K
Sbjct: 352 HIK 354

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  130 bits (326), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 148/256 (57%), Gaps = 10/256 (3%)

Query: 241 FNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300
           F+   P+++ Q  + +  ++ +EE +I +A+EG++LL  G   RQ+AS+K    SSR+ T
Sbjct: 237 FDNIKPEKNTQ-GSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHT 295

Query: 301 IFTIVLYKEE----EGEIF-RVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXX 355
           +FTI     +     GE + +  K N VDLAG+E+ ++    N+R ++            
Sbjct: 296 VFTITTNVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLG 355

Query: 356 XXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKV 415
             +N+L +    IP+++SKLT L++D+L G +K+  I T+   K S++E + TLE+  + 
Sbjct: 356 RVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRA 415

Query: 416 RSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHK 475
           +S+K  P +  S+ K++ I    +E+ +++ +L +T++K+G+Y++ E YD+     + + 
Sbjct: 416 KSIKNTPQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKYDL----YESNC 471

Query: 476 VEIMDLKKVIDELNEQ 491
           + + + K  ID L EQ
Sbjct: 472 ILVGEQKARIDNLEEQ 487

 Score = 98.2 bits (243), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 101/195 (51%), Gaps = 28/195 (14%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKD--------------DAVKREFG 59
           NIKV  R + +   E G+  +  ++I   G    +G+D                VK+ + 
Sbjct: 54  NIKVYVRCRSRNKREIGE--KSSVVISTMGA---QGRDVILSNPSSSSSGSLTNVKKTYT 108

Query: 60  MDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLL---- 115
            D +F ++  QE ++    K    + + GYNC+   YG+TG+GKTYT+SG+ + L     
Sbjct: 109 FDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTH 168

Query: 116 -HSEASRL---SVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLL 171
            H ++S L     G+IPRVL +LF  L   + D+ VK S++E+YNE LKDLL D  N   
Sbjct: 169 NHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADS-NKED 227

Query: 172 SASIKKLRIVDSGSP 186
             + + +RI D+  P
Sbjct: 228 DNNAESIRIFDNIKP 242

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 119/424 (28%), Positives = 188/424 (44%), Gaps = 93/424 (21%)

Query: 14  NIKVVARFKGQIDNEKGDDVR----DQIIIEEPGLIKFKGKDDAVK-----REFGMDHIF 64
           N+KV+ R K     EK  +V     D+  +E P      G  + V+     R F  D++F
Sbjct: 34  NVKVMVRLKPIDAPEKQYNVAVVALDESTVEFPNNDTSPGSTNGVQGESPSRSFHFDYVF 93

Query: 65  SSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSV 124
            ++  Q+ +Y    + M   F  GYN + L YG+TGSGK+YT+ G  D+           
Sbjct: 94  GTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPIDNR---------- 143

Query: 125 GVIPRVLEELFDHL----SCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180
           G+IPR+  E+F+ +    S  +I++VV  S++EIY E++ DLL +  N   SAS KK   
Sbjct: 144 GLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGESINK--SASPKK--- 198

Query: 181 VDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSNS 240
                                   TS K            R SLT         I  S++
Sbjct: 199 ------------------------TSEK------------RTSLT---------IHESST 213

Query: 241 FNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300
           F                Y+Q+     +++  E +  +H G   R  +S+     SSR+  
Sbjct: 214 F--------------GVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHA 259

Query: 301 IFTIVLYKEE--EGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXV 358
           I  I L K +  EG I + S    VDLAG+E   K        ++              +
Sbjct: 260 IVKINLLKRDNLEGSIQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVI 318

Query: 359 NSLHEKE---SVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKV 415
           N+L +K+   + IP++DS+LT L++D+L GNSK+  IL    +K +  E + TL FG++ 
Sbjct: 319 NALTQKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRA 378

Query: 416 RSLK 419
           + ++
Sbjct: 379 KQIE 382

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 159/281 (56%), Gaps = 11/281 (3%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVL----YKEEEGEI 314
           ++ +EE +I +A +G+QLL  G   R++A++K    SSR+ T+FTI           GE 
Sbjct: 244 VKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPVSGEQ 303

Query: 315 F-RVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDS 373
           + +  K N VDLAG+E+ ++    N+R ++              +N+L +    IP+++S
Sbjct: 304 YVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIPYRES 363

Query: 374 KLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETL 433
           KLT L++D+L G +K+  I T+   K S+DE I TLE+  + +S+K  P +  S++K++ 
Sbjct: 364 KLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMSKDSC 423

Query: 434 IKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKD---LDKHKVEIMDLKKVIDELNE 490
           I    +E+ +++ +L +++ K+G+ ++ + +D+   +   +D+ K +I ++++ I    +
Sbjct: 424 INEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQIQRFKD 483

Query: 491 ---QSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIE 528
              + T L K+  +  + NE+Q I+L+S R  +  +  N +
Sbjct: 484 KYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQ 524

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (59%), Gaps = 7/121 (5%)

Query: 54  VKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDS 113
            KR +  D +F ++  QE ++ D+ K    + + GYNC+   YG+TG+GKTYT+SG+ + 
Sbjct: 106 AKRTYTFDRVFGAESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNI 165

Query: 114 L---LHSEASRL---SVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQH 167
           L   L S    L     G+IPRVL ELF  L  N   + VK S++E+YNE LKDLL  + 
Sbjct: 166 LGGDLDSNTMVLLGEHAGIIPRVLVELFRWLDGNE-GYSVKVSFLELYNERLKDLLASEQ 224

Query: 168 N 168
           +
Sbjct: 225 S 225

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  125 bits (315), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 142/252 (56%), Gaps = 12/252 (4%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIV-----LYKEEEG 312
           +++ +EE +I +A+EG++LL  G   R++A++K    SSR+ TIFTI      ++     
Sbjct: 252 FVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTKIHPISGE 311

Query: 313 EIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKD 372
           +  +V K N VDLAG+E+ ++    N+R ++              +N+L +    IP+++
Sbjct: 312 QYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRE 371

Query: 373 SKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKET 432
           SKLT L++D+L G +K+  I T+   K S++E + TLE+  + +S+K  P +   + KE+
Sbjct: 372 SKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAKES 431

Query: 433 LIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQS 492
            I     E+ +++ +L ++ SKEG+Y++ E ++      + + + + + +  ID L EQ 
Sbjct: 432 CIIEYIQEIERLRKELRASHSKEGIYITQEKFET----YESNSILVEEQQAKIDNLQEQ- 486

Query: 493 TTLRKDKRAFEE 504
             LR+ K  F E
Sbjct: 487 --LRRLKEKFLE 496

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 102/205 (49%), Gaps = 38/205 (18%)

Query: 12  ECNIKVVARFKGQIDNE-----------KGDDVRDQIIIEEPGLIKFKGKDDAVKREFGM 60
           E NIKV  R + + + E            G++ R ++I+  PG            + +  
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNGR-EVILTNPG--------TGSNKTYTF 102

Query: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120
           D +F  +  QE ++    +    + I GYNC+   YG+TG+GKTYT+SG+   +  SE  
Sbjct: 103 DRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDD 162

Query: 121 R----LS--VGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVD-------QH 167
                LS   G+IPRVL ELF  L   + D+ VK S++E+YNE+L+DLLVD        H
Sbjct: 163 PNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSLEDH 222

Query: 168 NSLLSASIKKLRIVDS-----GSPN 187
           N    A  + +RI DS      SPN
Sbjct: 223 NFNGMAPPESIRIYDSLKTDRTSPN 247

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 143/244 (58%), Gaps = 11/244 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLY-----KEEEGE 313
           ++ ++E  I +A EG+ LL +G   R++A++K    SSR+ T+FTI         +E G+
Sbjct: 243 VKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQDSKEHGQ 302

Query: 314 ---IFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPF 370
                ++ K N VDLAG+E+ ++    N+R ++              +N+L +  + IP+
Sbjct: 303 NKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHIPY 362

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINK 430
           ++SKLT L++D+L G +K+  I T+   K S++E   TLE+  + +S+K  P +  S++K
Sbjct: 363 RESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQVNQSLSK 422

Query: 431 ETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKD---LDKHKVEIMDLKKVIDE 487
           +T +K    E+ K+++DL ++++K+G++++ +  D+   +   +D+  ++I +L++ I +
Sbjct: 423 DTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHNLREQIKK 482

Query: 488 LNEQ 491
             E+
Sbjct: 483 FKEK 486

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 107/195 (54%), Gaps = 25/195 (12%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPG-----LIKFKGKDDAV---KREFGMDHI 63
           E NI V  R + +  N +  D +  ++I   G     +I   G   +    K+ +  D +
Sbjct: 50  ESNIHVYVRCRSR--NRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQV 107

Query: 64  FSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE---------EDSL 114
           F ++  QE ++  + K   ++ ++GYNC+   YG+TG+GKTYT+SG+          D+L
Sbjct: 108 FGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNL 167

Query: 115 LHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSA- 173
           L  E +    G+IPRVL +LF  LS  N ++ VK S++E+YNE LKDLL D  +   +A 
Sbjct: 168 LLGEHA----GIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTAN 223

Query: 174 -SIKKLRIVDSGSPN 187
            S K++RI D+ + N
Sbjct: 224 DSKKQIRIFDNNNNN 238

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 142/247 (57%), Gaps = 11/247 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGE----- 313
           ++ ++E  I +A EG+ LL +G   R++A++K    SSR+ T+FTI     E+       
Sbjct: 243 VKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQ 302

Query: 314 ---IFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPF 370
                ++ K N VDLAG+E+ ++    N+R ++              +N+L +  + IP+
Sbjct: 303 NKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHIPY 362

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINK 430
           ++SKLT L++D+L G +K+  I T+   K S++E   TLE+  + +S+K  P +  S++K
Sbjct: 363 RESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQSLSK 422

Query: 431 ETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKD---LDKHKVEIMDLKKVIDE 487
           +T +K    E+ K+K+DL ++++K+G++++ +  D+   +   +D+  ++I +L++ I +
Sbjct: 423 DTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHNLREQIKK 482

Query: 488 LNEQSTT 494
             E+  T
Sbjct: 483 FKEKYLT 489

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 90/166 (54%), Gaps = 23/166 (13%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPG-----LIKFKGKDDAV---KREFGMDHI 63
           + NI V  R + +  N++  D +  ++I   G     +I   G   +    K+ +  D +
Sbjct: 50  DSNIHVYVRCRSR--NKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQV 107

Query: 64  FSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE---------EDSL 114
           F ++  QE ++  + K   ++ ++GYNC+   YG+TG+GKTYT+SG+          D L
Sbjct: 108 FGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKL 167

Query: 115 LHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELK 160
           L  E +    G+IPRVL +LF  LS  N ++ VK S++E+YNE LK
Sbjct: 168 LLGEHA----GIIPRVLVDLFKELSTLNREYSVKISFLELYNENLK 209

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 148/261 (56%), Gaps = 16/261 (6%)

Query: 246 PQRHIQ-----EKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300
           P+R I+         +  ++ ++E  I +A EG+ LL +G   R++A++K    SSR+ T
Sbjct: 225 PKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHT 284

Query: 301 IFTIVLYKEEE-----GE---IFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXX 352
           +FTI     E+     G+     ++ K N VDLAG+E+ ++    N+R ++         
Sbjct: 285 VFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLL 344

Query: 353 XXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFG 412
                +N+L +  + IP+++SKLT L++D+L G +K+  I T+   K S++E   TLE+ 
Sbjct: 345 TLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYA 404

Query: 413 NKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKD-- 470
            + +S+K  P +  S++K+T +K    E+ K+++DL ++++K+G++++ +  D+   +  
Sbjct: 405 TRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSI 464

Query: 471 -LDKHKVEIMDLKKVIDELNE 490
            +D+  ++I +L++ I +  E
Sbjct: 465 LIDEQNLKIHNLREQIKKFKE 485

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (61%), Gaps = 13/115 (11%)

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE---- 110
           K+ +  D +F ++  QE ++  + K   ++ ++GYNC+   YG+TG+GKTYT+SG+    
Sbjct: 99  KKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL 158

Query: 111 -----EDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELK 160
                 D+LL  E +    G+IPRVL +LF  LS  N ++ VK S++E+YNE LK
Sbjct: 159 GDVQSTDNLLLGEHA----GIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLK 209

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  119 bits (299), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 140/241 (58%), Gaps = 8/241 (3%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEE----EGEI 314
           ++ +EE +I +A EG+QLL  G   R++AS+K    SSR+ T+FTI     +     GE 
Sbjct: 291 VKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDPISGEQ 350

Query: 315 F-RVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDS 373
           + +  K N VDLAG+E+ ++    N+R ++              +N+L +    IP+++S
Sbjct: 351 YIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRES 410

Query: 374 KLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETL 433
           KLT L++D+L G +K+  I T+   K S++E + TLE+  + +S+K  P +  S++K+T 
Sbjct: 411 KLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSMSKDTC 470

Query: 434 IKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKD---LDKHKVEIMDLKKVIDELNE 490
           I    +E+ +++ +L +++ K+G+ ++ +  D+   +   +D+ K +I ++++ I +  E
Sbjct: 471 INEYVSEIERLRLELKTSRQKDGICITQDQLDLYESNGILVDEQKTKIHNMEEQIQKFKE 530

Query: 491 Q 491
           +
Sbjct: 531 K 531

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 72/115 (62%), Gaps = 6/115 (5%)

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
           K+ +  D +F ++  QE ++ D+ K    + ++GYNC+   YG+TG+GKTYT+SG+ + L
Sbjct: 154 KKSYSFDRVFGAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNIL 213

Query: 115 LHSEASRL-----SVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLV 164
            + E+  +       G+IPRVL  LF  L+  N D+ VK S++E+YNE LKDL  
Sbjct: 214 GNLESKDMILLGEHAGIIPRVLVNLFKMLALEN-DYSVKISFLELYNERLKDLFA 267

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 139/238 (58%), Gaps = 11/238 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE-----GE 313
           ++ ++E  I +A EG+ LL +G   R++A++K    SSR+ T+FTI     E+     G+
Sbjct: 242 VKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQ 301

Query: 314 ---IFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPF 370
                ++ K N VDLAG+E+ ++    N+R ++              +N+L +  + IP+
Sbjct: 302 NKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHIPY 361

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINK 430
           ++SKLT L++D+L G +K+  I T+   K S++E   TLE+  + +S+K  P +  S++K
Sbjct: 362 RESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSK 421

Query: 431 ETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKD---LDKHKVEIMDLKKVI 485
           +T +K    E+ K+++DL ++++K+G++++ +  D+   +   +D+  ++I +L+  I
Sbjct: 422 DTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHNLRGQI 479

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 108/195 (55%), Gaps = 25/195 (12%)

Query: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPG-----LIKFKGKDDAV---KREFGMDHI 63
           + NI V  R + +  N++  D +  ++I   G     +I   G   +    K+ +  D +
Sbjct: 49  DSNIHVYVRCRSR--NKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQV 106

Query: 64  FSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE---------EDSL 114
           F ++  QE ++  + K   ++ ++GYNC+   YG+TG+GKTYT+SG+          D+L
Sbjct: 107 FGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNL 166

Query: 115 LHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQH--NSLLS 172
           L  E +    G+IPRVL +LF  LS  N ++ VK +++E+YNE LKDLL D    +  ++
Sbjct: 167 LLGEHA----GIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVN 222

Query: 173 ASIKKLRIVDSGSPN 187
            S +++RI D+ + N
Sbjct: 223 DSKRQIRIFDNNNNN 237

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 98/374 (26%), Positives = 165/374 (44%), Gaps = 99/374 (26%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D IF +    ++++ + +  + Q  ++GYN     YG+TGSGKTYT+    D     
Sbjct: 472 FKFDKIFDTGESNDEVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTYTMLHPND----- 525

Query: 118 EASRLSVGVIPRVLEELFD---HLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSAS 174
                  GVIP  +  +FD   +L     ++ + C +VEIYNE + DLL           
Sbjct: 526 -------GVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL----------- 567

Query: 175 IKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLS 234
               R  ++G+P V  G    C+ R +  L               G+ ++T    A T  
Sbjct: 568 ----RSNENGTPWVNAGK---CDVRHDHDL---------------GKTTIT---NATTC- 601

Query: 235 ISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGI-QLLHRGLKNRQIASSKNQK 293
                                           +  +KE + ++L R  K R  AS+ + +
Sbjct: 602 --------------------------------VLESKESVDKVLKRATKLRSTASTLSNE 629

Query: 294 YSSRASTIFTIVLY------KEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXX 347
           +SSR+ +IF I L+      KEE   +      N VDLAG+E  H  + T +R ++    
Sbjct: 630 HSSRSHSIFIIELHGVNHKTKEESCGVL-----NLVDLAGSERVHSSQVTGERLRETQNI 684

Query: 348 XXXXXXXXXXVNSLHEKESV--IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEM 405
                     + +L++K +   IPF++SKLTYL++ +L GNSK++  + +  +   ++E 
Sbjct: 685 NRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMFVNISPSSSHINET 744

Query: 406 IETLEFGNKVRSLK 419
           I +L F +KV + +
Sbjct: 745 INSLRFASKVNATR 758

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 114/435 (26%), Positives = 175/435 (40%), Gaps = 121/435 (27%)

Query: 14  NIKVVARFKGQIDNEKG-----------DDVRDQII-IEEPGLIKFKGKDDAVKREFGMD 61
           NI+V  R +  +  E             DD  +Q+I + + G     G    +   F  D
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNGY----GSGPQI---FKFD 406

Query: 62  HIFSS-----DVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
            IF+      DV QE      +  + Q  ++GYN     YG+TGSGKTYT+    D    
Sbjct: 407 RIFNEKETNYDVFQE------IGQLVQSSLDGYNVCIFAYGQTGSGKTYTMLNPTD---- 456

Query: 117 SEASRLSVGVIPRVLEELFD---HLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSA 173
                   G+IP  +  +F+   +L      + V C +VEIYNE + DLL  +     SA
Sbjct: 457 --------GIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLLRREEKPAGSA 508

Query: 174 SIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTL 233
           S                G ++N NT+                                 L
Sbjct: 509 S----------------GDDTNSNTK---------------------------------L 519

Query: 234 SISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQK 293
            I            RH QE T    I N+    +T+     +LL R  K R  AS+   +
Sbjct: 520 EI------------RHNQE-TKETTITNVTTVPLTSKNTVDELLKRANKLRSTASTACNE 566

Query: 294 YSSRASTIFTI------VLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXX 347
            SSR+ +IF +      VL  E    I      N VDLAG+E  +  +   +R ++    
Sbjct: 567 RSSRSHSIFIVHLSGENVLTGERSHGIL-----NLVDLAGSERINTSQVIGERLRETQSI 621

Query: 348 XXXXXXXXXXVNSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDE 404
                     +++L   ++    IPF++SKLTYL++ +L GNSK++  + +  N +  +E
Sbjct: 622 NKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNE 681

Query: 405 MIETLEFGNKVRSLK 419
            + +L F +KV S K
Sbjct: 682 TLNSLRFASKVNSTK 696

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 95/379 (25%), Positives = 169/379 (44%), Gaps = 90/379 (23%)

Query: 50  KDDAVKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSG 109
           KD    ++F  D IF    V + ++ D +  + Q  ++GYN     YG+TGSGKT+T+  
Sbjct: 389 KDHRCIQKFQFDRIFDQHEVNKDVF-DEIGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLN 447

Query: 110 EEDSLLHSEASRLSVGVIPRVLEELFDH---LSCNNIDHVVKCSYVEIYNEELKDLLVDQ 166
             D            G+IP  ++ +FD    L     ++ V C +VEIYNE + DLL ++
Sbjct: 448 PND------------GMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLREE 495

Query: 167 HNSLLSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTA 226
            ++ L        I ++G  ++++ ++          +T+  +I T+I++ K     L  
Sbjct: 496 TSAELD------EITNNGRHDIRHDSDKR--------ITTITNIKTSILKSKDSVDFL-- 539

Query: 227 LKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLH-RGLKNRQ 285
           +K+A  L  + + + NE S + H                        I ++H RG  N  
Sbjct: 540 IKKATKLRATATTAANERSSRSH-----------------------SIFIIHLRGSNNIT 576

Query: 286 IASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAE--HSHKIEGTNQRFKD 343
             SS            + I+               N VDLAG+E  +S ++EG   R ++
Sbjct: 577 GESS------------YGIL---------------NLVDLAGSERLNSSQVEGA--RLRE 607

Query: 344 XXXXXXXXXXXXXXVNSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKD 400
                         +++L   ++    IPF++SKLTYL++ +L GNSK++  + +   + 
Sbjct: 608 TQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPTQQ 667

Query: 401 SLDEMIETLEFGNKVRSLK 419
            + E + +L F +KV + K
Sbjct: 668 QIQETLNSLRFASKVNTTK 686

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 93/371 (25%), Positives = 155/371 (41%), Gaps = 90/371 (24%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           ++  D +FS     ++++ + +  + Q  ++G+N     YG+TGSGKT+T+   +D    
Sbjct: 382 KYSFDKVFSQTDTNQEIFKE-VSELIQSSLDGFNVCIFAYGQTGSGKTFTMLNPKD---- 436

Query: 117 SEASRLSVGVIPRVLEELFDHL---SCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSA 173
                   G+IP   + +FD +   + N   + V C ++EIYN+E+ DLL          
Sbjct: 437 --------GIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRS-------- 480

Query: 174 SIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTA-LKQANT 232
                   D    N  NG     +  D S  T  +++ T  +  K   +S+ A LK A  
Sbjct: 481 --------DDNKSNSSNGPRHKIHHDDASKTTVVENLETITLTSK---ESVDAVLKNAMK 529

Query: 233 LSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQ 292
           L  + S S NE S + H                                           
Sbjct: 530 LRATASTSSNERSSRSH------------------------------------------- 546

Query: 293 KYSSRASTIFTIVLYKEEEG-EIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXX 351
                  +IF I ++   EG    R    N +DLAG+E     +  ++R K+        
Sbjct: 547 -------SIFIIKIHGINEGLGEERNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSL 599

Query: 352 XXXXXXVNSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIET 408
                 +NSL   ++    I F+DSKLTYL++ +L GNSK++ ++ +  + D ++E I++
Sbjct: 600 SFLGNVMNSLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKS 659

Query: 409 LEFGNKVRSLK 419
           L F  KV S K
Sbjct: 660 LNFAKKVNSTK 670

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 95/389 (24%), Positives = 154/389 (39%), Gaps = 90/389 (23%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF +D IF  DV   ++Y +  KP+      GYN +   YG TGSGKT+T+SG ++    
Sbjct: 108 EFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGTQE---- 163

Query: 117 SEASRLSVGVIPRVLEELFDHLSCNNI----DHVVKCSYVEIYNEELKDLLVDQHNSLLS 172
                   G+IP  +  LF+ ++  N+     + +  SY+EIYNE+L DLL         
Sbjct: 164 ------DTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLL--------- 208

Query: 173 ASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANT 232
                    D+    V  G +SN  T            P                     
Sbjct: 209 ---------DTNVEGVNFGYSSNLQT------------PPRF------------------ 229

Query: 233 LSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQ 292
                 NSFN     R   +      +  L E   ++  + ++ +  G KN++I+ ++  
Sbjct: 230 -----GNSFNSAQDLRIRDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYN 284

Query: 293 KYSSRASTIFTIVLYKEE-EGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXX 351
             SSR+ +I  + L   + E  I   S  +  DLAG+E   K     +R K+        
Sbjct: 285 SRSSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSL 341

Query: 352 XXXXXXVNSL-------------------HEKESVIPFKDSKLTYLIKDTLEGNSKSIFI 392
                 +  L                   +   S IP++DSKLT +++  L GNS    I
Sbjct: 342 LALGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTI 401

Query: 393 LTLRFNKDSLDEMIETLEFGNKVRSLKCY 421
            T+    D+  E + TL F ++ +++  +
Sbjct: 402 CTVDIRSDASSETLNTLRFASRAKNVSLH 430

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 101/425 (23%), Positives = 179/425 (42%), Gaps = 106/425 (24%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIE-------EPGLIKFKGKDDAVKREFGMDHIFSS 66
           NI+V  R +  + +E  DD  + I ++       + G+   +G    +   F  D IF  
Sbjct: 350 NIRVYCRIRPPLPHE--DDNIEHIKVQPFDDDNGDQGMTINRGNSQVIP--FKFDKIFDQ 405

Query: 67  DVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGV 126
               ++++ + +  + Q  ++GYN     YG+TGSGKTYT+    D            G+
Sbjct: 406 QETNDEIFKE-VGQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPGD------------GI 452

Query: 127 IPRVLEELF---DHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRIVDS 183
           +P  +  +F   D L+     + V C ++EIYNE + DLL                   S
Sbjct: 453 VPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL------------------RS 494

Query: 184 GSPNVKN---GANSNCNTRDNSPLTSS--KSIPTAIIRKKMGRQSL-TALKQANTLSISR 237
           G+P+ +N    A+S    R +  L ++   +I T ++     R ++   LK+AN L  + 
Sbjct: 495 GAPSQENNDRNADSKHEIRHDQELKTTYITNITTCVLD---SRDTVDKVLKRANKLRSTA 551

Query: 238 SNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSR 297
           S + NE+S + H      + +I +LE                          KN+    +
Sbjct: 552 STAANEHSSRSH------SIFIIHLE-------------------------GKNEGTGEK 580

Query: 298 ASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXX 357
           +  I                   N VDLAG+E  +      +R ++              
Sbjct: 581 SQGIL------------------NLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDV 622

Query: 358 VNSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNK 414
           +++L+  +     IPF++SKLTYL++ +L G+SK++  + +      L+E I +L F +K
Sbjct: 623 IHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASK 682

Query: 415 VRSLK 419
           V + K
Sbjct: 683 VNNTK 687

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 155/371 (41%), Gaps = 90/371 (24%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  D IF      E ++ + +  + Q  ++GYN     YG+TGSGKT+T+    D    
Sbjct: 435 EFKFDKIFDQRNTNEDVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD---- 489

Query: 117 SEASRLSVGVIPRVLEELFDH---LSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSA 173
                   G+IP  +  +F+    L     D+ V C ++EIYNE + DLL +++N     
Sbjct: 490 --------GIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRNENN----- 536

Query: 174 SIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLT--ALKQAN 231
                          K+  N+N          +  ++ T +   K+  + +    LK+AN
Sbjct: 537 ---------------KDDTNTNLKHEIRHDQETKTTMITNVTSCKLESEEMVDRVLKRAN 581

Query: 232 TLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKN 291
            L  + S + NE+S + H      + +I +L      NAK G                  
Sbjct: 582 KLRSTASTASNEHSSRSH------SIFIIHLSGL---NAKTGA----------------- 615

Query: 292 QKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXX 351
           Q Y +                        N VDLAG+E  +  +    R ++        
Sbjct: 616 QSYGT-----------------------LNLVDLAGSERINISQVVGDRLRETQNINKSL 652

Query: 352 XXXXXXVNSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIET 408
                 +++L + +S    IPF++SKLTYL++ +L G+SK++  + +  +   ++E + +
Sbjct: 653 SCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNS 712

Query: 409 LEFGNKVRSLK 419
           L F +KV S +
Sbjct: 713 LRFASKVNSTR 723

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/379 (25%), Positives = 160/379 (42%), Gaps = 96/379 (25%)

Query: 54  VKREFGMDHIFS-----SDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLS 108
           + + F  D IF+     +DV +E      +  + Q  ++GYN     YG+TGSGKTYT+ 
Sbjct: 400 IPQRFKFDKIFNQTDTNADVFKE------VGQLVQSSLDGYNVCIFAYGQTGSGKTYTML 453

Query: 109 GEEDSLLHSEASRLSVGVIPRVLEELFD---HLSCNNIDHVVKCSYVEIYNEELKDLLVD 165
             +D            G+IP  ++ +F+   +L      + + C +VEIYNE + DL   
Sbjct: 454 RPKD------------GIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDL--- 498

Query: 166 QHNSLLSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLT 225
               L S+S    R +DS  P  K+    +   R+        +  T I+ + +  +   
Sbjct: 499 ----LRSSSNDDTRNIDSNIP-TKHEIRHDQENRN--------TTITNIVTRNLDSEETA 545

Query: 226 --ALKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKN 283
              LK+AN L  + S   NE+S + H                        I ++H     
Sbjct: 546 DNILKRANKLRSTASTGSNEHSSRSH-----------------------SIFIIH----- 577

Query: 284 RQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKD 343
                        R S   T     EE   I      N VDLAG+E  +  + T  R ++
Sbjct: 578 ------------LRGSNSLT----GEESYGIL-----NLVDLAGSERINSSQVTGDRLRE 616

Query: 344 XXXXXXXXXXXXXXVNSL---HEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKD 400
                         +++L    + +  IPF++SKLTYL++ +L GNSK++  + +  + +
Sbjct: 617 TQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSAN 676

Query: 401 SLDEMIETLEFGNKVRSLK 419
            ++E I +L F +KV S K
Sbjct: 677 HINETINSLRFASKVNSTK 695

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 99/411 (24%), Positives = 165/411 (40%), Gaps = 102/411 (24%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           E+  D++F  D     +Y  + KP+     +G+N +   YG TGSGKTYT+SG +     
Sbjct: 103 EYTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSGVDG---- 158

Query: 117 SEASRLSVGVIP----RVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLS 172
                 + G+IP     +  ++FD     N  +    SY+EIYNE++ DLL         
Sbjct: 159 ------NAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETDF----- 207

Query: 173 ASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANT 232
                                      D  PL SS ++P   IR                
Sbjct: 208 ---------------------------DPKPLRSSIAVPELKIRD--------------- 225

Query: 233 LSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQ 292
                        P   ++       +  L E    + +E +  +  G K+R+ +S+   
Sbjct: 226 ------------DPNYGVR-------VIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFN 266

Query: 293 KYSSRASTIFTIVLYKEE--EGEIFRVSKWNFVDLAG-----AEHSHKIEGTNQRFKDXX 345
             SSR+  I  I L   +   GE+   S  +  DLAG     A+H  + EG+   F +  
Sbjct: 267 TRSSRSHAIILIRLISSDLSSGEVV-TSTLSLCDLAGSERVTAQHERRQEGS---FINKS 322

Query: 346 XXXXXXXXXXXXVNSLHEKESV----IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDS 401
                           +  ESV    IP++DSKLT +++  L GNS    I T+  + D+
Sbjct: 323 LLALGTVISKLSAEVNNSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDA 382

Query: 402 LDEMIETLEFGNKVRSLKCYPLLGPSIN-------KETLIKSISNELAKVK 445
            +E + TL F ++ +++  + +   SI+       K+ +I+S+  +L + K
Sbjct: 383 TNESVNTLRFASRAKNVSLHVVKKSSISAYDANDQKDRIIESLVQQLQEQK 433

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 90/384 (23%), Positives = 167/384 (43%), Gaps = 84/384 (21%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D IF+ +   + ++ + +  + Q  ++GYN     YG+TGSGKTYT+   +D     
Sbjct: 453 FKFDKIFNQNETNDDVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTYTMLHPKD----- 506

Query: 118 EASRLSVGVIPRVLEELF---DHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSAS 174
                  G+IP  +  +F   ++L      + ++C +VEIYNE + DLL ++H++  +  
Sbjct: 507 -------GIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDN--NGK 557

Query: 175 IKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLS 234
           +  L      SP+  N           +  T   +I T  +  K+   ++  L++AN L 
Sbjct: 558 VNDLL----ASPSQSNSTKHEIRHDPETQTTKVTNITTCKLDSKITVDNI--LRRANKLR 611

Query: 235 ISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKY 294
            + S   NE+S + H                        I ++H            N+  
Sbjct: 612 STASTLSNEHSSRSH-----------------------SIFIIH--------LKGTNEIT 640

Query: 295 SSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXX 354
             ++  I  +V                  DLAG+E  +  + T +R ++           
Sbjct: 641 GEKSYGILNLV------------------DLAGSERINSSQVTGERLRETQNINRSLSCL 682

Query: 355 XXXVNSL--------HEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMI 406
              +++L        + K+  IPF++SKLTYL++ +L GNSK++  + +  + + ++E +
Sbjct: 683 GDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIGNSKTLMFVNISPSINYVNETL 742

Query: 407 ETLEFGNKVRSLKCYPLLGPSINK 430
            +L F +KV S K   + G +I+K
Sbjct: 743 NSLRFASKVNSAK---MGGATISK 763

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 104/420 (24%), Positives = 168/420 (40%), Gaps = 108/420 (25%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+F+S     ++Y  + KPM    + G+N +   YG TGSGKT+T+SG E  L  
Sbjct: 162 EFKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQEL-- 219

Query: 117 SEASRLSVGVIPRVLEELFDHLSCNNIDHVVK----CSYVEIYNEELKDLLVDQHNSLLS 172
                   G+IP  +  LF ++   ++D   K     SY+EIYNE + DLL         
Sbjct: 220 --------GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLL--------- 262

Query: 173 ASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANT 232
                    +SG                   L  S S P    R  MG+ +  A+     
Sbjct: 263 ---------ESG-------------------LEESGSRPGTPSRSYMGKSNSNAM--GVE 292

Query: 233 LSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQ 292
           L I R +S            K G   I  L E    + +E ++ +  G K+R+I  +   
Sbjct: 293 LKI-RDDS------------KYGVKVI-GLTERRCESTEELLRWIGIGDKSRKIGETDYN 338

Query: 293 KYSSRASTIFTIVLYKEE-EGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXX 351
             SSR+  I  I L   +      R S  +  DLAG+E   +  G  +R K+        
Sbjct: 339 TRSSRSHAIVLIRLTSTDVNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSL 395

Query: 352 XXXXXXVNSLHEKESV-------------------------------IPFKDSKLTYLIK 380
                 ++ L   ++                                IP++DSKLT L++
Sbjct: 396 LALGTVISKLSADKTTSVDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQ 455

Query: 381 DTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNE 440
             L G+S    I T+    D+  E + TL F ++ +++  +      ++K+++I + +N+
Sbjct: 456 PALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALH------VSKKSIINNGNND 509

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 90/376 (23%), Positives = 158/376 (42%), Gaps = 99/376 (26%)

Query: 57  EFGMDHIF-----SSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEE 111
           EF  D IF     ++DV +E      +  + Q  ++GYN     YG+TGSGKT+T+    
Sbjct: 435 EFKFDKIFDQKDTNADVFKE------VGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPG 488

Query: 112 DSLLHSEASRLSVGVIPRVLEELFDH---LSCNNIDHVVKCSYVEIYNEELKDLLVDQHN 168
           D            G+IP  +  +F+    L     D+ V C ++EIYNE + DL      
Sbjct: 489 D------------GIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDL------ 530

Query: 169 SLLSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLT--A 226
            L S +I +    D  S ++K+    +  T+         ++ T +   K+  + +    
Sbjct: 531 -LRSDNINR----DDTSSSLKHEIRHDQETKT--------TVITNVTTCKLESEKMVDMI 577

Query: 227 LKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQI 286
           LK+AN L  + S + NE+S + H                        I ++H    N + 
Sbjct: 578 LKKANKLRSTASTASNEHSSRSH-----------------------SIFIIHLSGSNTKT 614

Query: 287 ASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXX 346
            +   Q Y +                        N VDLAG+E  +  +    R ++   
Sbjct: 615 GA---QSYGT-----------------------LNLVDLAGSERINISQVVGDRLRETQN 648

Query: 347 XXXXXXXXXXXVNSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLD 403
                      +++L + +S    IPF++SKLTYL++ +L G+SK++  + +  +   ++
Sbjct: 649 INKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHIN 708

Query: 404 EMIETLEFGNKVRSLK 419
           E + +L F +KV S +
Sbjct: 709 ETLNSLRFASKVNSTR 724

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 93/384 (24%), Positives = 149/384 (38%), Gaps = 94/384 (24%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  D +FS       +Y +  KPM      GYN +   YG TGSGKT+T+SG  D    
Sbjct: 139 EFWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTRDE--- 195

Query: 117 SEASRLSVGVIPRVLEELFDHL---SCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSA 173
                   G+I   +E++F  +   S NN  + V+ SY+EIYNE++ D        LL+ 
Sbjct: 196 -------AGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYD--------LLNY 240

Query: 174 SIKKLRIVDSGSPNVKN--GANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQAN 231
              K      GS   KN  GA +    RD++                             
Sbjct: 241 PSAKSPGGTYGSFQSKNVPGAGAELPVRDDA----------------------------- 271

Query: 232 TLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKN 291
                           RH     G      L E  + ++++ ++ +  G  NR+   +  
Sbjct: 272 ----------------RHGVRVVG------LTEQQVHSSEDVLRKIELGNSNRRTGETDY 309

Query: 292 QKYSSRASTIFTI-VLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXX 350
              SSR+  I TI V   E        S  +  DLAG+E   +  G ++R K+       
Sbjct: 310 NTRSSRSHAIVTIKVTCTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKS 366

Query: 351 XXXXXXXVNSLHE----------------KESVIPFKDSKLTYLIKDTLEGNSKSIFILT 394
                  ++ L                    S +P++DSKLT +++  L G+S    I T
Sbjct: 367 LLALGTVISKLSAVSGASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICT 426

Query: 395 LRFNKDSLDEMIETLEFGNKVRSL 418
           +    D++ E + T+ F ++ +++
Sbjct: 427 IDTKPDAMSETVNTIRFASRAKNV 450

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 107/425 (25%), Positives = 171/425 (40%), Gaps = 118/425 (27%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+F+S     ++Y  + KPM    + G+N +   YG TGSGKT+T+SG E  L  
Sbjct: 162 EFEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQEL-- 219

Query: 117 SEASRLSVGVIPRVLEELFDH---LSCNN---IDHVVKCSYVEIYNEELKDLLVDQHNSL 170
                   G+IP  +  LF +   LS N     D ++  SY+EIYNE + DLL       
Sbjct: 220 --------GLIPLSVSYLFSNVMELSMNGDKKFDVII--SYLEIYNERIYDLL------- 262

Query: 171 LSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQA 230
                      +SG                   L  S S P+   R  MG          
Sbjct: 263 -----------ESG-------------------LEESLSRPSTPSRLYMG---------- 282

Query: 231 NTLSISRSNSFNEYSPQRHIQEKT--GAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIAS 288
                 + NS N  S +  I++ T  G   I  L E    +++E ++ +  G K+R+I  
Sbjct: 283 ------KGNS-NGLSAELKIRDDTQYGVKVI-GLTERRCESSEELLKWIAIGDKSRKIGE 334

Query: 289 SKNQKYSSRASTIFTIVLYKEE-EGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXX 347
           +     SSR+  I  I L   + E    R S  +  DLAG+E +    G  +R K+    
Sbjct: 335 TDYNARSSRSHAIVLIRLTSTDLESGTSRSSTLSLCDLAGSERA---TGQQERRKEGSFI 391

Query: 348 XXXXXXXXXXVNSLHEKESVIP--------------------------------FKDSKL 375
                     ++ L   + + P                                ++DSKL
Sbjct: 392 NKSLLALGTVISKL-SADKINPTGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKL 450

Query: 376 TYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIK 435
           T L++  L G+S    I T+    D+  E I TL F ++ +++  +      ++K+++I 
Sbjct: 451 TRLLQPALSGDSIVTTICTVDTRNDAAAETINTLRFASRAKNVALH------VSKKSIIS 504

Query: 436 SISNE 440
           + +N+
Sbjct: 505 NGNND 509

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 155/369 (42%), Gaps = 85/369 (23%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  D IF      E ++ + +  + Q  ++GYN     YG+TGSGKT+T+    D    
Sbjct: 435 EFKFDKIFDQQNTNEDVFKE-VGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD---- 489

Query: 117 SEASRLSVGVIPRVLEELF---DHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSA 173
                   G+IP  +  +F   + L     D+ V C ++EIYNE + DLL +        
Sbjct: 490 --------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRND------- 534

Query: 174 SIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTL 233
           SI K    D  + N K+    +  T+     T+  +  T+   +   R  +  LK+AN L
Sbjct: 535 SIGK----DDTNTNSKHEIRHDQETK-----TTMITNVTSCQLESEERVDM-ILKKANKL 584

Query: 234 SISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQK 293
             + S + NE+S + H                        I ++H         S  N K
Sbjct: 585 RSTASTASNEHSSRSH-----------------------SIFMIH--------LSGSNAK 613

Query: 294 YSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXX 353
             +++     +V                  DLAG+E  +  +    R ++          
Sbjct: 614 TGAQSYGTLNLV------------------DLAGSERINISQVVGDRLRETQNINKSLSC 655

Query: 354 XXXXVNSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLE 410
               +++L + +S    IPF++SKLTYL++ +L G+SK++  + +  +   ++E + +L 
Sbjct: 656 LGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLR 715

Query: 411 FGNKVRSLK 419
           F +KV S +
Sbjct: 716 FASKVNSTR 724

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+FS ++  +++Y     PM      G+NC+   YG TGSGKTYT+SG       
Sbjct: 105 EFNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSG------- 157

Query: 117 SEASRLSVGVIPRVLEELFDHLSCN--NIDHVVKCSYVEIYNEELKDLL 163
              S+   G+IP  ++ +FD ++         V+ SY+EIYNE + DLL
Sbjct: 158 ---SKSGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLL 203

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 80/169 (47%), Gaps = 13/169 (7%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE--GEIFR 316
           +  L E ++++ KE ++ +  G  NR+   +     SSR+  +  I ++  +E  GE   
Sbjct: 238 VVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGEQV- 296

Query: 317 VSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV-------IP 369
           +S  +  DLAG+E +    G  +R K+              ++ L  + S        IP
Sbjct: 297 MSTLSLCDLAGSERA---TGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVGHIP 353

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           ++DSKLT +++  L G+S    I T+    ++  E I T+ F ++ +++
Sbjct: 354 YRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 91/169 (53%), Gaps = 23/169 (13%)

Query: 13  CNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAV-----KREFGMDHIFSSD 67
            NIKV  R + +  N+K  D +  +++   G     G    +     K ++  D++F  +
Sbjct: 8   SNIKVYVRCRSR--NQKEIDEKSSVVVSTLGQ---NGNQIIISNSTNKNKYIFDNVFGVE 62

Query: 68  VVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL--LHSEASRL--- 122
             QE ++        Q+ I+GYNC+   YG+TG+GKTYT+SG+ + +  L+S  + L   
Sbjct: 63  SDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNILLGE 122

Query: 123 SVGVIPRVLEELFDHL--SCNNI------DHVVKCSYVEIYNEELKDLL 163
             G+IPRVL +LF  L  S +N        + VK S++E+YNE LKDLL
Sbjct: 123 HAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL 171

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 110/227 (48%), Gaps = 31/227 (13%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIV-----LYKEEEGE 313
           ++ ++E  I NA EG+ LL +G   R++ S+K    SSR+ TIFTI      L  +   E
Sbjct: 210 VKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQTNKE 269

Query: 314 IFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKES------- 366
             ++ K N VDLAG+E+  K  G  +R ++              +N+L +K +       
Sbjct: 270 YIKIGKLNLVDLAGSENITK-SGL-KRSQETGLINKSLLTLGRVINALSDKTNNTHGSNN 327

Query: 367 -----------------VIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETL 409
                             IP+++SKLT L++D+L G +K+  I T+   K  LDE I TL
Sbjct: 328 DNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETISTL 387

Query: 410 EFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEG 456
           E+  +  S+K  P +  S N    I    N++ ++K +L ++  K G
Sbjct: 388 EYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIG 434

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 90/365 (24%), Positives = 163/365 (44%), Gaps = 77/365 (21%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D +F +D  Q ++Y  +   +    ++G+N +   YG TG GKTYT+SG  +    
Sbjct: 155 KFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTPE---- 210

Query: 117 SEASRLSVGVIPRVLEELFDHLS--CNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSAS 174
                 + G++ + +EELF  +    +     +  S++EIYNE ++DLL  +  S     
Sbjct: 211 ------NPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLLKPETPS----- 259

Query: 175 IKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLS 234
            +KL I +     +     +  N   + P T+ + +   +IR    R   T+  +AN +S
Sbjct: 260 -QKLIIREDTDNKI-----TVANLSQHFP-TTVQEVMDLVIRGNFNRT--TSPTEANEVS 310

Query: 235 ISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKY 294
            SRS++      Q HI +K   P   +++E H       I L      + + A++KN   
Sbjct: 311 -SRSHAV----LQIHIVQKNRTP---DIKEEHTFGTLSIIDL----AGSERAAATKN--- 355

Query: 295 SSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXX 354
             R + +        E   I R    + + L    ++  I G ++R +            
Sbjct: 356 --RGARL-------HEGANINR----SLLALGNCINALCINGNDERPR------------ 390

Query: 355 XXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNK 414
                  H     +P++DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+
Sbjct: 391 ------CH-----VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANR 439

Query: 415 VRSLK 419
            + +K
Sbjct: 440 AKEIK 444

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 14/111 (12%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+F+  V  +++Y     P+      GYN +   YG TGSGKT+T+SG +     
Sbjct: 145 EFQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ---- 200

Query: 117 SEASRLSVGVIPRVLEELFDHLSCN----NIDHVVKCSYVEIYNEELKDLL 163
                   G+IP+ +  +FD +S      ++ + VK SY+EIYNE++ DLL
Sbjct: 201 ------EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLL 245

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 75/171 (43%), Gaps = 12/171 (7%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVL--YKEEEGEIFR 316
           + +L E  +++ ++ ++ +  G +NR+   +     SSR+  I  + L  Y  + G    
Sbjct: 277 VVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGS-EA 335

Query: 317 VSKWNFVDLAGAEHS-----HKIEGT--NQRFKDXXXXXXXXXXXXXXVNSLHEKESV-- 367
            S  +  DLAG+E +      + EG   N+                   N L    +   
Sbjct: 336 TSTLSLCDLAGSERAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQPSPAAGH 395

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           IP++DSKLT +++  L G+S    I T+    +S  E   T+ F ++ +++
Sbjct: 396 IPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNI 446

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 63/112 (56%), Gaps = 15/112 (13%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+F+ +V   ++Y+   +P+      GYN +   YG TGSGKT+T+SG       
Sbjct: 144 EFQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSG------- 196

Query: 117 SEASRLSVGVIPRVLEELFDHL---SCNNIDHV--VKCSYVEIYNEELKDLL 163
              ++   G+IP  +  +FD +   +  + +H   VK SY+EIYNE++ DLL
Sbjct: 197 ---TKQDPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLL 245

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           IP++DSKLT +++  L G+S    I T+    +S  E   T+ F ++ +++
Sbjct: 401 IPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRAKNI 451

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 88/179 (49%), Gaps = 31/179 (17%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIK--------FKGKDDAVKREFGMDHIF- 64
           NIKV  R +  +  E G  +  Q+      +I+           ++    + F  DH F 
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQHISTSSLLATEEFTQGKIFTFDHCFK 63

Query: 65  -----SSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDS-LLHSE 118
                S D  QE +Y    +      ++GYN   L YG+TGSGK++T+ G E S   H+ 
Sbjct: 64  YSENASHD--QEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNN 121

Query: 119 ASRL-------SVGVIPRVLEELFDHLS-CNNIDHVVK------CSYVEIYNEELKDLL 163
            + L       ++G+IPRV  +LFD  + CN+ +  +K      CSY+EIYNE+++DLL
Sbjct: 122 QTALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL 180

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 99/200 (49%), Gaps = 12/200 (6%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEE---EGEI 314
           +++ L EF +   +E ++ + +G + R +  +     SSR+  IFTI + + E    G++
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 315 F-RVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEK--ESVIPFK 371
             R S    VDLAG+E          R K+              V+ L +K    +IP++
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPS---I 428
           DS LT+++K+ L GNSK++ I  +  +    +E I TL +    + +K    +  S    
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACV--SPCDYEETISTLRYATTAKEVKNTARVNSSESLK 375

Query: 429 NKETLIKSISNELAKVKSDL 448
           NKE L+ ++ N+L +++ +L
Sbjct: 376 NKEQLV-TMRNQLEELQKEL 394

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 64/120 (53%), Gaps = 20/120 (16%)

Query: 70  QEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPR 129
           Q + Y  S+    +D +NGYNC  L YG+TGSGKTYT+ G        E+   + GVIPR
Sbjct: 73  QSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMG--------ESKNDTRGVIPR 124

Query: 130 VLEELFDHLSCNNI----------DHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLR 179
             E+LF  +    I          ++ V CS  EIYNE++ DLL  + N + S S  ++R
Sbjct: 125 FCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLL--EMNEVQSCSKYRVR 182

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 91/201 (45%), Gaps = 22/201 (10%)

Query: 239 NSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRA 298
           N     S  R  + +  + YI+N+ E  ++N  + I+ +  G +NR   S+     SSR+
Sbjct: 171 NEVQSCSKYRVRENRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRS 230

Query: 299 STIFTIVLYKEE-----EGEIFRVSKWNFVDLAGAEHSHKIEGT-NQRFKDXXXXXXXXX 352
             I +I + + +        I   S   FVDLAG+E S   +   N R K+         
Sbjct: 231 HAIVSITIKRTDIDLNTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLS 290

Query: 353 XXXXXVNSLHEKES--------------VIPFKDSKLTYLIKDTLEGNSKSIFILTLRFN 398
                + SL ++E               V+PF++S LT+++KD L GNSK+  I  +  +
Sbjct: 291 TLRRVLTSLKKREELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACI--S 348

Query: 399 KDSLDEMIETLEFGNKVRSLK 419
             + +E   TL + +  +++K
Sbjct: 349 PTNFEESASTLRYADIAQTIK 369

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 92/173 (53%), Gaps = 8/173 (4%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE---GEI 314
           +++ L+EF + +  E +  L +G + + + ++   + SSR+ TIFTI + ++E    G +
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 315 F-RVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKES--VIPFK 371
             R S    +DLAG+E ++    T +R K+              +  L +K+   +IP++
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLL 424
           D+ LT+++K++L GNSK+  I  +  +    +E + TL +    RS+K +  L
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACV--SPCDFEETMSTLRYATLARSVKTFAQL 339

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 83/160 (51%), Gaps = 20/160 (12%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKR-EFGMDHIFSSDVV--Q 70
           NIKV  R +  ++ E  + V  Q++ E    ++ + K +  +  EF +   +S  +   Q
Sbjct: 4   NIKVSVRLRKPLERESAERVIAQVVSENLIKVEQRAKREETRNFEFDLCCTYSESLEEDQ 63

Query: 71  EQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRV 130
            QLY    +      ++GYN     YG+TGSGK++T++G  +            G++PR+
Sbjct: 64  AQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAE----------LPGIVPRM 113

Query: 131 LEELFD--HLSCNNIDHV-----VKCSYVEIYNEELKDLL 163
            +ELF+   +  ++ D       ++CSY+EIYNE ++DLL
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (54%), Gaps = 13/110 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+F        +Y ++ +PM +    G+N +   YG TGSGKT+T+SG  +    
Sbjct: 146 EFSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGTSN---- 201

Query: 117 SEASRLSVGVIPRVLEELFDHL---SCNNIDHVVKCSYVEIYNEELKDLL 163
                   G+IP  + ++F ++   S NN    VK SY+EIYNE++ DLL
Sbjct: 202 ------EPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLL 245

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 73/168 (43%), Gaps = 13/168 (7%)

Query: 261 NLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEE-EGEIFRVSK 319
            L E  +  +++ ++ +  G  NR+   +     SSR+  I  I L   + +  +   S 
Sbjct: 277 GLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGLETTST 336

Query: 320 WNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV---------IPF 370
            +  DLAG+E   +     +R K+              ++ L  + +          IP+
Sbjct: 337 LSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGGGHHIPY 393

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           +DSKLT +++  L G+     I T+  + +S  E I T+ F ++ +++
Sbjct: 394 RDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 70/140 (50%), Gaps = 16/140 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  D +F ++     +Y  S +PM    + G+N +   YG TGSGKT+T++G ED    
Sbjct: 111 EFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTED---- 166

Query: 117 SEASRLSVGVIPRVLEELF----DHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLS 172
                   G+IP  +  LF    +H       + V  SY+EIYNE++ DLL  +  +  +
Sbjct: 167 ------EAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESENKFN 220

Query: 173 ASIKKLRIVDSGSPNVKNGA 192
           ++  ++ +  SG+P    G 
Sbjct: 221 STPSRMFL--SGTPRSSGGP 238

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 6/87 (6%)

Query: 363 EKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYP 422
           E  + IP++DSKLT +++  L GNS    I T+    ++  E + T+ F ++ +++    
Sbjct: 373 EPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFASRAKNVTLQV 432

Query: 423 LLGPSIN------KETLIKSISNELAK 443
              P++       K+  I++++ +L K
Sbjct: 433 AKRPAVGTGSYNEKDQTIENLTQQLEK 459

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 64/125 (51%), Gaps = 19/125 (15%)

Query: 45  IKFKGKDDAVKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKT 104
           +KF  K    K  F  D +F  D  QEQ++ D+ +P+    ++G+N +   YG TG GKT
Sbjct: 81  VKFNKKRSETK--FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKT 138

Query: 105 YTLSG-EEDSLLHSEASRLSVGVIPRVLEELFDHL-----SCNNIDHVVKCSYVEIYNEE 158
           YT++G  ED            G+I R + ELF  +       N     +  SY+EIYNE 
Sbjct: 139 YTINGTSEDP-----------GIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNET 187

Query: 159 LKDLL 163
           ++DLL
Sbjct: 188 IRDLL 192

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 86/169 (50%), Gaps = 8/169 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYK-----EEEGE 313
           + NL      N ++ I L+ RG  NR  + ++  + SSR+ ++  I + +     ++ G 
Sbjct: 213 VTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLKNFDDIGS 272

Query: 314 IFRV-SKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL--HEKESVIPF 370
             ++ S  + +DLAG+E +   +    R  +              +N+L  ++K   IP+
Sbjct: 273 TNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINKKSCHIPY 332

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 333 RDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIK 381

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 61/113 (53%), Gaps = 18/113 (15%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+F+S     ++Y  + KPM    + G+N +   YG TGSGKT+T+SG E  L  
Sbjct: 162 EFKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQEL-- 219

Query: 117 SEASRLSVGVIPRVLEELFDHL---SCNN---IDHVVKCSYVEIYNEELKDLL 163
                   G+IP  +  LF ++   S N     D V+  SY+EIYNE + DLL
Sbjct: 220 --------GLIPLSVSYLFTNIMEQSMNGDKKFDVVI--SYLEIYNERIYDLL 262

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%)

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCY 421
           IP++DSKLT L++  L G+S    I T+    D+  E + TL F ++ +++  +
Sbjct: 449 IPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVSLH 502

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 60/111 (54%), Gaps = 14/111 (12%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+F+S     ++Y  + KPM    + G+N +   YG TGSGKT+T+SG E  L  
Sbjct: 162 EFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQEL-- 219

Query: 117 SEASRLSVGVIPRVLEELFDHLSCNNIDHVVK----CSYVEIYNEELKDLL 163
                   G+IP  +  LF ++   +++   K     SY+EIYNE + DLL
Sbjct: 220 --------GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLL 262

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 43/73 (58%), Gaps = 6/73 (8%)

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPS 427
           IP++DSKLT L++  L G+S    I T+    D+  E + TL F ++ +++  +      
Sbjct: 443 IPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALH------ 496

Query: 428 INKETLIKSISNE 440
           ++K+++I + +N+
Sbjct: 497 VSKKSIISNGNND 509

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 12/121 (9%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           E+  DH+FS  V   ++Y  +  P+      G+N +   YG TGSGKTYT+ G+ ++   
Sbjct: 132 EYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMGDNEN--- 188

Query: 117 SEASRLSVGVIPRVLEELFDHL--SCNNIDHVVKCSYVEIYNEELKDLL-VDQHNSLLSA 173
                   G++P  +  LF+ +  S N+  + V  SY+EIYNE++ DLL  D+ N LL+ 
Sbjct: 189 ------PDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTNHLLTP 242

Query: 174 S 174
           S
Sbjct: 243 S 243

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           IP++DSKLT L++  L GNS    I T+    ++  E I TL F ++ +++
Sbjct: 400 IPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLRFASRAKNV 450

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 85/149 (57%), Gaps = 4/149 (2%)

Query: 275 QLLHRGLKNRQIASSKNQKYSSRASTIFTIVLY-KEEEGEIFRVSKWNFVDLAGAEHSHK 333
           ++LHR  K R  AS+K+ ++SSR+ +IF I L+ K  +         N VDLAG+E  + 
Sbjct: 554 KVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGILNLVDLAGSERINS 613

Query: 334 IEGTNQRFKDXXXXXXXXXXXXXXVNSLH---EKESVIPFKDSKLTYLIKDTLEGNSKSI 390
            + + +R ++              +++L+    KE  IPF++SKLT+L+K +L GNSK++
Sbjct: 614 SQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTL 673

Query: 391 FILTLRFNKDSLDEMIETLEFGNKVRSLK 419
             + +  + + ++E I +L F +KV S K
Sbjct: 674 MFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 15/92 (16%)

Query: 81  MFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRVLEELF---DH 137
           + Q  ++GYN     YG+TGSGKT+T+    D            G+IP  +  +F   D+
Sbjct: 443 LVQSALDGYNVCIFAYGQTGSGKTFTMLNPSD------------GIIPSTVRHIFTWIDN 490

Query: 138 LSCNNIDHVVKCSYVEIYNEELKDLLVDQHNS 169
           L     ++ + C +VEIYNE + DLL ++  S
Sbjct: 491 LKERGWEYQINCQFVEIYNENIIDLLREKQTS 522

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 58/111 (52%), Gaps = 14/111 (12%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  DH+FS+      +Y  + +P+    I GYN +   YG TGSGKT+T+SG E+    
Sbjct: 132 DFTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTEE---- 187

Query: 117 SEASRLSVGVIPRVLEELFDHL----SCNNIDHVVKCSYVEIYNEELKDLL 163
                   G+IP  +  LF  L    +  N    V  SY+EIYNE++ DLL
Sbjct: 188 ------EKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLL 232

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 80/187 (42%), Gaps = 31/187 (16%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEE--EGEIFR 316
           +  L +     ++E +  +++G KNR+ + ++    SSR+  I  I L  ++   GE   
Sbjct: 271 VVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQ-N 329

Query: 317 VSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL--------HEKESV- 367
           +   +  DLAG+E      G N+R K+              ++ L        H   +  
Sbjct: 330 IRTLSLCDLAGSERG---VGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAAN 386

Query: 368 ----------------IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEF 411
                           IP++DSKLT L++  L G+S  + + T+    +S  E + TL F
Sbjct: 387 SQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRF 446

Query: 412 GNKVRSL 418
            ++ +++
Sbjct: 447 ASRSKNV 453

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 78/169 (46%), Gaps = 33/169 (19%)

Query: 15  IKVVARFKGQIDN------EKGDDVRDQIIIEEPGLIKFKGKDDAVKREFGMDHIFSS-- 66
           IKVV R K    N        GD +   +I ++    +         +EF  DH F S  
Sbjct: 5   IKVVVRVKKPQGNLPIVCKVHGDTI--SLINDDKKAFRLSSPQKNAAKEFRYDHCFGSTD 62

Query: 67  --DVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSV 124
             D  Q  +Y   ++      + GYN   L YG+TGSGKT+T+ GE+           + 
Sbjct: 63  SVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGEKG----------NE 112

Query: 125 GVIPRVLEELFD--HLSCNN--------IDHVVKCSYVEIYNEELKDLL 163
           G++PR   ELF+  H+ C+          D  VKCS+ EIYNE++ DLL
Sbjct: 113 GIVPRFCRELFEVFHM-CHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 85/173 (49%), Gaps = 11/173 (6%)

Query: 256 APYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEE----E 311
           + +++ LEE  + N +E I  +H+G +NR + S+   + SSR+  IF I + ++E     
Sbjct: 177 STFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKT 236

Query: 312 GEIFRV-SKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHE----KES 366
           G +    S    VDLAG+E         +  ++              ++ L E    +  
Sbjct: 237 GTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQ 296

Query: 367 VIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +IP+++S LT+++K+ L GNS +  +  +  + ++  E + TL + +  + +K
Sbjct: 297 MIPYRESALTWILKENLGGNSNTCLVACV--SPENYYESLSTLRYASLTKKVK 347

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 138/282 (48%), Gaps = 19/282 (6%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRV 317
           ++Q++  F +   +E ++ L  G   R +AS++    SSR+  IFT+ + ++E     R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 318 SKWNFVDLAGAEHSHKIEGTN--QRFKDXXXXXXXXXXXXXXVNSLHE-KESVIPFKDSK 374
           S    VDLAG+E ++   G +  +R K+              ++ L +  + +IP++DS 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 375 LTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLG---PSINKE 431
           LT+++K+ L GNSK+  I  +  +   L+E + TL +    + +K    +    P+IN++
Sbjct: 269 LTWVLKENLGGNSKTCMIACI--SPIDLEESLSTLRYATTAKEIKLRATMNEIVPNINED 326

Query: 432 TLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHK---VEIMDLKKVIDEL 488
             +K+     A  + +L   KS+     S   Y++ ++    H+   V    + K+ D L
Sbjct: 327 --MKAAVEAAASSRKELEMLKSEMSSLQS--EYNIKSEQWKTHEKLLVRFNHITKLNDYL 382

Query: 489 NEQSTTLRKDKRAFEEVNEVQRIKLQSMRDS----VSMMYTN 526
             Q T      ++ +  N++ R+++ +++ +    V  +++N
Sbjct: 383 ENQLTNEITKSQSLQNENKLSRLEMSNVQTALLGVVGALFSN 424

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 70/154 (45%), Gaps = 24/154 (15%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQII-IEEPGLIKFKGKDDAVKREFGMDHIFSSDVVQEQ 72
           N++VV R +  +  +    V++Q I   EP L           R F  DHIF +   Q  
Sbjct: 4   NVQVVIRLR-PVHTKTNFKVQNQTISTVEPPL-----------RSFNFDHIFDTSSSQTD 51

Query: 73  LYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRVLE 132
           +  +         + GYN     YG+TGSGKTYT+ G             + G+IP +  
Sbjct: 52  IPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGTNS----------NPGIIPLLCR 101

Query: 133 ELFDHLSCNNID-HVVKCSYVEIYNEELKDLLVD 165
           +LFD L  +      V  +Y EIYNE+L DLL D
Sbjct: 102 DLFDALELDKTTVSSVSITYFEIYNEKLIDLLGD 135

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 16/118 (13%)

Query: 49  GKDDAVKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLS 108
           G  D  K  F  D +F +DV QE +Y  +   +    ++G+N +   YG TG GKTYT+S
Sbjct: 136 GSADETK--FVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVS 193

Query: 109 GEEDSLLHSEASRLSVGVIPRVLEELF---DHLSCNNIDHVVKCSYVEIYNEELKDLL 163
           G          +R + G+I R +EELF   D L+    D  +  S++EIYNE + DLL
Sbjct: 194 G----------TRENPGIIFRTMEELFVKMDALAGTK-DFELTVSFLEIYNETIHDLL 240

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 82/173 (47%), Gaps = 15/173 (8%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKE------EEG 312
           + NL      + ++ + L+ RG  NR  + ++    SSR+  +  I + +       +E 
Sbjct: 261 VSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNKLVDLKEH 320

Query: 313 EIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL------HEKES 366
           + F     + +DLAG+E +   +   +R  +              +N+L      H  + 
Sbjct: 321 QTF--GTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGSHRNQH 378

Query: 367 VIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           V P++DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 379 V-PYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIK 430

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 97/189 (51%), Gaps = 20/189 (10%)

Query: 248 RHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVL- 306
           RH  +++   Y+ N++ F I N  + I L+++    R  +S+    +SSR+  IF I L 
Sbjct: 554 RH-DDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLE 612

Query: 307 -YKEEEGEIFRVSKWNFVDLAGAEHSH--KIEGTNQRFKDXXXXXXXXXXXXXXVNSLH- 362
            Y  +  E   +SK N VDLAG+E  +  K++G   R K+              +++L+ 
Sbjct: 613 GYNHKTNEKC-ISKLNLVDLAGSERINFSKVQG--DRLKETQSINKSLSCLGDVIHALNR 669

Query: 363 -----------EKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEF 411
                      +K   IPF++SKLTYL+K +L G+SK++  + +  N+  L+E I +L F
Sbjct: 670 GNKNHLNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRF 729

Query: 412 GNKVRSLKC 420
             KV + K 
Sbjct: 730 ATKVNNTKA 738

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 16/111 (14%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  DH+F  D    +++ + ++ + Q  ++GYN     YG+TGSGKTYT+    D     
Sbjct: 444 FEFDHVFKQDEGNSEVF-NEIEQLIQSALDGYNVCIFAYGQTGSGKTYTMLNPND----- 497

Query: 118 EASRLSVGVIPRVLEELF---DHLSCNNIDHVVKCSYVEIYNEELKDLLVD 165
                  GVIP  ++ +F   D L  N  ++ V C ++E+YNE + DL  D
Sbjct: 498 -------GVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRD 541

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 94/173 (54%), Gaps = 9/173 (5%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRV 317
           +++ L EF +++ ++ +  + +G + R + S+   +YSSR+ TIFTI + ++E+  +  V
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 318 ----SKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKES--VIPFK 371
               S    +DLAG+E +   + +  R K+              ++ L +++   +IP++
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK-CYPL 423
           D+ LT+++K++L GNSK+  I  +  +    +E + TL +    R++K C  L
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACV--SPCDYEETLSTLRYATLARNVKTCAQL 339

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 86/164 (52%), Gaps = 28/164 (17%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQII--IEEPGLIKFKGKDDAVK-REFGMDHIFSS---- 66
           NIKV  R +  ++ E    V + II  +E+  +I+ K ++   + R F  D  F+     
Sbjct: 4   NIKVAVRLRRPLERE----VDESIIARVEDGNVIQVKDRNQKNETRSFHFDQCFAYSENI 59

Query: 67  DVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGV 126
           +  Q +LY    +      ++GY+     YG+TGSGK++T++G  +          S G+
Sbjct: 60  EADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGSPE----------SPGI 109

Query: 127 IPRVLEELFD--HLSCNNIDHV-----VKCSYVEIYNEELKDLL 163
           + R+ +ELF+   +  ++ D V     ++CSY+EIYNE ++DLL
Sbjct: 110 VSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL 153

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 58/114 (50%), Gaps = 22/114 (19%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D +F  +  Q Q+Y ++  P+    ++GYN +   YG TG GKTYT+SG       
Sbjct: 152 KFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGTPS---- 207

Query: 117 SEASRLSVGVIPRVLEELFDHLSCNNIDHV-------VKCSYVEIYNEELKDLL 163
                   GVI   +EELF     N ID +       +  SY+EIYNE ++DLL
Sbjct: 208 ------QPGVIFLAMEELF-----NKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 79/169 (46%), Gaps = 8/169 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE----GEI 314
           + NL   H T  ++ + L+ +G  NR  + ++  + SSR+  +  I + +  +       
Sbjct: 271 VANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQ 330

Query: 315 FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL----HEKESVIPF 370
              +  + +DLAG+E +        R  +              +N+L      +   IP+
Sbjct: 331 HTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSRTCHIPY 390

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 391 RDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 73/158 (46%), Gaps = 18/158 (11%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQI--IIEEPGLIKFKGKDDAVKREFGMDHIFSSDVVQE 71
           NI+V  R +  +DNEK D     I    +E G      K +A   +F  D  F +    +
Sbjct: 362 NIRVFCRLRPHLDNEKEDSSSISIDGFSDENGTQCITIKREAKYHKFTFDRCFGAQESNK 421

Query: 72  QLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRVL 131
            ++ + +  + Q  ++GYN     YG+TGSGKTYT+   ED            G+IP  L
Sbjct: 422 DIFHE-IGQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPED------------GIIPSTL 468

Query: 132 EELF---DHLSCNNIDHVVKCSYVEIYNEELKDLLVDQ 166
             +F   + L      + +   ++EIYNE +KDL  D 
Sbjct: 469 NHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDH 506

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 93/177 (52%), Gaps = 7/177 (3%)

Query: 248 RHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLY 307
           RH  EK G  YI N+    +T+  +   +L +  K R  A++++ + SSR+ ++F + + 
Sbjct: 531 RHDHEKQGT-YITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHIN 589

Query: 308 KE--EEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKE 365
                 GE  +  K N VDLAG+E  +    T +R ++              + +L+  +
Sbjct: 590 GRNLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPD 648

Query: 366 S---VIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +    IPF++SKLTYL++ +L G+SK++  + +  + + + E + +L F +KV S K
Sbjct: 649 AGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 76/162 (46%), Gaps = 25/162 (15%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEE-------PGLIKFKGKDDAVKREFGMDHIFSS 66
           NI+V  R +  + NE  D     I+IE+         L   + +   +   F  D IF  
Sbjct: 366 NIRVYCRVRPPLLNEPQD--MSHILIEKFNEAKGAQSLTINRNEGRILSYNFQFDMIFEP 423

Query: 67  DVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGV 126
               ++++ + ++ + Q  ++GYN     YG+TGSGKTYT+    D            G+
Sbjct: 424 SHTNKEIF-EEIRQLVQSSLDGYNVCIFAYGQTGSGKTYTMLNAGD------------GM 470

Query: 127 IPRVLEELFD---HLSCNNIDHVVKCSYVEIYNEELKDLLVD 165
           IP  L  +F    +L     ++ ++C Y+EIYNE + DLL D
Sbjct: 471 IPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 73/158 (46%), Gaps = 18/158 (11%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQI--IIEEPGLIKFKGKDDAVKREFGMDHIFSSDVVQE 71
           NI+V  R +  +DNEK D     I    +E G      K +A   +F  D  F +    +
Sbjct: 362 NIRVFCRLRPHLDNEKEDSSSISIDGFSDENGTQCITIKREAKYHKFTFDRCFGAQESNK 421

Query: 72  QLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRVL 131
            ++ + +  + Q  ++GYN     YG+TGSGKTYT+   ED            G+IP  L
Sbjct: 422 DIFHE-IGQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPED------------GIIPSTL 468

Query: 132 EELF---DHLSCNNIDHVVKCSYVEIYNEELKDLLVDQ 166
             +F   + L      + +   ++EIYNE +KDL  D 
Sbjct: 469 NHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDH 506

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 74/134 (55%), Gaps = 18/134 (13%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D +F  D  Q+ +Y  ++ P+    ++G+N +   YG TG GKTYT+SG  +     
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGSPE----- 182

Query: 118 EASRLSVGVIPRVLEELFDHL-SCNNIDHV-VKCSYVEIYNEELKDLLVDQHNSLLSASI 175
                + G+I + ++ELF+ + +  +  H  +  S++EIYNE ++DLL  + +S      
Sbjct: 183 -----NPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLLCPETSS------ 231

Query: 176 KKLRIVDSGSPNVK 189
           KKL I++  + +++
Sbjct: 232 KKLVILEDSNESIR 245

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 91/195 (46%), Gaps = 13/195 (6%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFR-- 316
           + NL  ++    ++ + L+ +G  NR  +++   + SSR+  +  I + +       +  
Sbjct: 246 VSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTADLKSD 305

Query: 317 --VSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL-----HEKESVIP 369
              +  + +DLAG+E +   +    R  +              +N+L       +   +P
Sbjct: 306 HTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRSCHVP 365

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSIN 429
           ++DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K       S N
Sbjct: 366 YRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKT----KVSRN 421

Query: 430 KETLIKSISNELAKV 444
            +TL + +S+ L  +
Sbjct: 422 NQTLDRHVSSYLKMI 436

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 89/178 (50%), Gaps = 14/178 (7%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE-GEIFR 316
           Y++ L   ++T+ +E +  + +G   R ++S+     SSR+ +I  I L K     E  +
Sbjct: 198 YVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEENIQ 257

Query: 317 VSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV-------IP 369
            S    VDLAG+E   K        ++              +N+L + ES        IP
Sbjct: 258 HSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSAHIP 317

Query: 370 FKDSKLTYLIKDTLEGNSKSIFIL---TLRFNKDSLDEMIETLEFGNKVRSLKCYPLL 424
           ++DSKLT L++D+L GNSK+  IL   T RFN+    E + TL FG++ + +K + +L
Sbjct: 318 YRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNE---QETLSTLRFGSRAKKIKNFAIL 372

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 13/112 (11%)

Query: 56  REFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLL 115
           R F  D +F +   QE +Y      M + F  GYN + L YG+TGSGK++T+ G +++  
Sbjct: 73  RLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFGPKENR- 131

Query: 116 HSEASRLSVGVIPRVLEELFDHLSCNNIDHV---VKCSYVEIYNEELKDLLV 164
                    GVIPR+  ++F  +   + +     V  S++E+Y E++ DLL 
Sbjct: 132 ---------GVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLA 174

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 61/122 (50%), Gaps = 23/122 (18%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH+F +     ++Y  + KPM      G N +   YG TGSGKT+T++G E++L  
Sbjct: 121 EFKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTEETL-- 178

Query: 117 SEASRLSVGVIP--------RVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHN 168
                   G+IP        RV+EE        +    +  SY+EIYNE++ DLL D  N
Sbjct: 179 --------GLIPLSVAYLYSRVMEESLQ----GDSRFEIAVSYLEIYNEKIYDLL-DCEN 225

Query: 169 SL 170
            L
Sbjct: 226 EL 227

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 83/189 (43%), Gaps = 22/189 (11%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVS 318
           I  L E    ++ E ++ +  G K+R+   +     SSR+  I  I L K +  E   VS
Sbjct: 264 IVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDLKEGTSVS 323

Query: 319 K-WNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV---------- 367
              +  DLAG+E   K    N+R K+              ++ L  + +           
Sbjct: 324 STLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNGGSSSPV 380

Query: 368 ---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCY--- 421
              IP++DSKLT +++  L GN     I T+    D+  E + TL F ++ +++  +   
Sbjct: 381 TGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKNVSLHIFR 440

Query: 422 -PLLGPSIN 429
            PLL PS++
Sbjct: 441 KPLL-PSMS 448

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 61/113 (53%), Gaps = 16/113 (14%)

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
           +++F  D +F  D  Q+ ++  +  P+    ++G+N +   YG TG GKT+T+SG  D  
Sbjct: 125 EQKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISGTPD-- 182

Query: 115 LHSEASRLSVGVIPRVLEELFDHLSCNNIDHV----VKCSYVEIYNEELKDLL 163
                   S G+I   ++ELF  +  NN+       +  SY+EIYNE ++DLL
Sbjct: 183 --------SPGIIFLTMQELFQRI--NNLKDTKTFELTVSYLEIYNETIRDLL 225

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 82/166 (49%), Gaps = 13/166 (7%)

Query: 265 FHITNAKEGIQ-LLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKE------EEGEIFRV 317
           +H     E +  L+ RG  NR  + +   + SSR+  +  + + +       +E +++  
Sbjct: 251 YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSRTVDLKEDKMY-- 308

Query: 318 SKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL--HEKESV--IPFKDS 373
           +  + +DLAG+E +   +   +R  +              +N+L    + +V  +P++DS
Sbjct: 309 ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVCHVPYRDS 368

Query: 374 KLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           KLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 369 KLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIK 414

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 63/111 (56%), Gaps = 12/111 (10%)

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
           +++F  D IF  DV Q+++Y ++ +P+    ++G+N +   YG TG GKT+T+SG  +  
Sbjct: 121 EQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGTSE-- 178

Query: 115 LHSEASRLSVGVIPRVLEELFDHLSC--NNIDHVVKCSYVEIYNEELKDLL 163
                     G+I   ++ELF  +    +     ++ S++EIYNE++ DLL
Sbjct: 179 --------QPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLL 221

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 101/211 (47%), Gaps = 17/211 (8%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTI-VLYKEEEGEIFR 316
           ++ NL +    N +E + L+ +G  NR  + +   + SSR+  +  I V       +I +
Sbjct: 241 FVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQ 300

Query: 317 ---VSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV------ 367
               +  + +DLAG+E +   +   +R  +              +N+L    +       
Sbjct: 301 DQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFSCH 360

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPS 427
           +P++DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K   +    
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTKVIR--- 417

Query: 428 INKETLIKSISNELAKV---KSDLLSTKSKE 455
            NK++L + + + L  +   KS++   +S+E
Sbjct: 418 -NKQSLDRHVGSYLKLITEQKSEIEELRSRE 447

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D +F     Q ++Y ++  P+    ++G+N +   YG TG GKTYT+SG       
Sbjct: 152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPS---- 207

Query: 117 SEASRLSVGVIPRVLEELFDHLS--CNNIDHVVKCSYVEIYNEELKDLL 163
                   G+I   +EELF+ ++   +  D  +  SY+EIYNE ++DLL
Sbjct: 208 ------QPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 78/169 (46%), Gaps = 8/169 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE----GEI 314
           + NL   H    ++ + L+ +G  NR  + ++  + SSR+  +  I + +  +       
Sbjct: 271 VANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQ 330

Query: 315 FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL----HEKESVIPF 370
              +  + +DLAG+E +        R  +              +N+L      +   IP+
Sbjct: 331 HTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPY 390

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 391 RDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D +F  D  QE +Y  +   +    ++G+N +   YG TG GKTYT+SG  +    
Sbjct: 150 KFVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGTPE---- 205

Query: 117 SEASRLSVGVIPRVLEELFDHLS--CNNIDHVVKCSYVEIYNEELKDLL 163
                   G+I RV++ELF+ +    +     +  SY+EIYNE ++DLL
Sbjct: 206 ------QPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 89/189 (47%), Gaps = 12/189 (6%)

Query: 243 EYSPQRHIQEKTGAPYIQ--NLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300
           E  P+R I  + GA  I   NL   +    +E I L+ +G  NR  + ++  + SSR+  
Sbjct: 251 ETVPKRLIIREDGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHA 310

Query: 301 IFTI-VLYKEEEGEI---FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXX 356
           +  I ++      ++      +  + +DLAG+E +   +   +R  +             
Sbjct: 311 VLQIHIMQTNRTADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGN 370

Query: 357 XVNSL------HEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLE 410
            +N+L        +   IP++DSKLT L+K +L GN K++ I+ +  +    DE + TL+
Sbjct: 371 CINALCLTDGGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLK 430

Query: 411 FGNKVRSLK 419
           + N+ + +K
Sbjct: 431 YANRAKEIK 439

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 12/111 (10%)

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
           +++F  D +F  D  Q ++Y  + +P+    ++G+N +   YG TG GKT+T+SG  +  
Sbjct: 133 EQKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGTPE-- 190

Query: 115 LHSEASRLSVGVIPRVLEELFDHL-SCNNIDHV-VKCSYVEIYNEELKDLL 163
                     GVI   ++ELF  +    +  H  +  SY+EIYNE ++DLL
Sbjct: 191 --------QPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 79/169 (46%), Gaps = 8/169 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTI-VLYKEEEGEIFRV 317
           + NL        ++ + L+ RG  NR  + +   + SSR+  +  I V+ K    E+   
Sbjct: 254 VANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAELSEA 313

Query: 318 ---SKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL----HEKESVIPF 370
              +  + +DLAG+E +   +   +R  +              +N+L          +P+
Sbjct: 314 HTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCHVPY 373

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 374 RDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIK 422

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 61/115 (53%), Gaps = 13/115 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSG-----EE 111
           EF  DH+F+S V   ++Y    +PM      G+N +   YG TGSGKTYT+ G     ++
Sbjct: 136 EFKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCPEREQK 195

Query: 112 DSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQ 166
           D L+    S L      +++EE  D     +    +  SY+EIYNE++ DLL D+
Sbjct: 196 DGLIPLSVSYL----FTKIMEETLD----GDKKFEIVLSYLEIYNEKIYDLLGDE 242

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 37/138 (26%)

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPS 427
           IP++DSKLT L++  L G+S    I T+    +S  E + TL F ++ +++  +      
Sbjct: 417 IPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLNTLRFASRAKNISLH------ 470

Query: 428 INKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDE 487
           +N++ L+ +                                +D D    +IM L K + E
Sbjct: 471 VNRKPLVHT-------------------------------GEDSDDKNYKIMQLTKKLQE 499

Query: 488 LNEQSTTLRKDKRAFEEV 505
             +  +TLR+D ++  +V
Sbjct: 500 QQQLISTLRQDDKSLNKV 517

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 75/162 (46%), Gaps = 32/162 (19%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKRE---------FGMDHIF 64
           NI+V  R +  ++NE  D       I    +  F  ++ +   E         F  D +F
Sbjct: 358 NIRVYCRIRPPLENEVQD-------ISHIHVSNFDNRNGSQAIEISNEDRNSRFLFDKVF 410

Query: 65  SSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSV 124
           SS+     ++ + +  + Q  ++GYN     YG+TGSGKTYT+  + D            
Sbjct: 411 SSNASNRDVF-EEVGQLIQSSLDGYNVCIFAYGQTGSGKTYTMMNDPD------------ 457

Query: 125 GVIPRVLEELFDH---LSCNNIDHVVKCSYVEIYNEELKDLL 163
           GVIP  L+ +FD    L     D+  +  ++EIYNE++ DLL
Sbjct: 458 GVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 77/147 (52%), Gaps = 4/147 (2%)

Query: 276 LLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE--GEIFRVSKWNFVDLAGAEHSHK 333
           +L    K + IA++ + + SSR+ ++FTI ++      GE       N VDLAG+E    
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD-GVLNLVDLAGSERIDT 599

Query: 334 IEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKE-SVIPFKDSKLTYLIKDTLEGNSKSIFI 392
              T  R ++              + +L+ K+   IPF++SKLTYL++ +L G+SK++  
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 393 LTLRFNKDSLDEMIETLEFGNKVRSLK 419
           + +  + + + E + +L F +KV S K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 86/167 (51%), Gaps = 14/167 (8%)

Query: 266 HITN-------AKEGI-QLLHRGLKNRQIASSKNQKYSSRASTIFTIVL--YKEEEGEIF 315
           HITN       ++E + ++L R LK R  A++     SSR+ ++F I L  Y    GE  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 316 RVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV---IPFKD 372
                N VDLAG+E  H ++   +R ++              +++L   ++    IPF++
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 373 SKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           SKLTYL++ +L G+SK++  + +    +S+ E + +L F  KV S K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 71/155 (45%), Gaps = 18/155 (11%)

Query: 14  NIKVVARFKGQIDNE--KGDDVRDQIIIEEPGLIKFKGKDDAVKREFGMDHIFSSDVVQE 71
           NI+V  R +  ++NE      +  +   +E G+     K D+ + +F  D  FS+     
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEIEKFSDETGMQSITIKRDSKQHKFTFDRCFSAQETNG 422

Query: 72  QLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRVL 131
            ++   +  + Q  ++GYN     YG+TGSGKT+T+    D            G+IP  L
Sbjct: 423 DVF-SEIGQLIQSSLDGYNVCIFAYGQTGSGKTFTMLNPND------------GIIPSTL 469

Query: 132 EELF---DHLSCNNIDHVVKCSYVEIYNEELKDLL 163
             +F   + L      + +   +VEIYNE +KDL 
Sbjct: 470 NHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLF 504

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 62/113 (54%), Gaps = 16/113 (14%)

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
           +++F  D +F  +  Q+ ++L + +P+    I+G+N +   YG TG GKT+T+SG  +  
Sbjct: 127 EQKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISGTPE-- 184

Query: 115 LHSEASRLSVGVIPRVLEELFDHLSCNNIDHV----VKCSYVEIYNEELKDLL 163
                   + G+I   ++ELF  +   N+       +  SY+EIYNE ++DLL
Sbjct: 185 --------NPGIIFLTMQELFQRI--ENLKDTKTFQLTVSYLEIYNEMIRDLL 227

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 78/169 (46%), Gaps = 8/169 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVS 318
           + NL      + ++ + L+ +G  NR  + +   + SSR+  +  I + +       +  
Sbjct: 248 VANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKED 307

Query: 319 K----WNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL----HEKESVIPF 370
           K     + +DLAG+E +   +   +R  +              +N+L          +P+
Sbjct: 308 KTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPY 367

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 368 RDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIK 416

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 12/109 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D IF  +  Q+++YL +   +    ++G+N +   YG TG GKTYT+SG ++    
Sbjct: 190 KFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTQE---- 245

Query: 117 SEASRLSVGVIPRVLEELFDHLS--CNNIDHVVKCSYVEIYNEELKDLL 163
                 + G+I RV++ELF+ +    +     +  SY+EIYNE + DLL
Sbjct: 246 ------NPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 86/175 (49%), Gaps = 15/175 (8%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVS 318
           + NL   +  + ++ I L+ RG  NR  +S++  + SSR+  +  I +  +   +I   S
Sbjct: 309 VSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIM-QTNTKIDLTS 367

Query: 319 KWNF-----VDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL------HEKESV 367
           +  F     +DLAG+E +   +   +R  +              +N+L        + ++
Sbjct: 368 EHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNNTRRRNI 427

Query: 368 ---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
              IP++DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 428 RYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 482

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 12/108 (11%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D +F  +  Q ++Y ++  P+    ++G+N +   YG TG GKTYT+SG        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPS----- 207

Query: 118 EASRLSVGVIPRVLEELFDHLS--CNNIDHVVKCSYVEIYNEELKDLL 163
                  G+I   +EELF+ ++   +  +  +  SY+EIYNE ++DLL
Sbjct: 208 -----QPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 79/169 (46%), Gaps = 8/169 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE----GEI 314
           + NL   H T  ++ + L+ +G  NR  + ++  + SSR+  +  I + +  +       
Sbjct: 271 VANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQ 330

Query: 315 FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL----HEKESVIPF 370
              +  + +DLAG+E +        R  +              +N+L      +   IP+
Sbjct: 331 HTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPY 390

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 391 RDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 12/111 (10%)

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
           +++F  D +F     QE++Y  + +P+    ++G+N +   YG TG GKTYT+SG  +  
Sbjct: 122 EQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTAE-- 179

Query: 115 LHSEASRLSVGVIPRVLEELFDHLSC--NNIDHVVKCSYVEIYNEELKDLL 163
                   + G+I   ++ELF  +    +     +  SY+EIYNE ++DLL
Sbjct: 180 --------NPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLL 222

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 81/170 (47%), Gaps = 9/170 (5%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKE----EEGEI 314
           + NL    +   ++ + L+ +G  NR  +++   + SSR+  +  + + ++    E  E 
Sbjct: 243 VANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELTED 302

Query: 315 FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV-----IP 369
            + +  + +DLAG+E +   +   +R  +              +N+L           +P
Sbjct: 303 HKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFHVP 362

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           ++DSKLT L+K +L GN K++ I+ +    +  DE + TL++  + + +K
Sbjct: 363 YRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIK 412

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 16/123 (13%)

Query: 44  LIKFKGKDDAVKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGK 103
           ++K     +++ + F  D IF  +   E ++ + +  + Q  ++GYN     YG+TGSGK
Sbjct: 414 IVKSNNTGNSIPQNFKFDRIFDQNETNENVF-EEIGQLVQSSLDGYNVCIFAYGQTGSGK 472

Query: 104 TYTLSGEEDSLLHSEASRLSVGVIPRVLEELF---DHLSCNNIDHVVKCSYVEIYNEELK 160
           TYT+    +            G+IP  +  +F   ++L     ++ + C ++EIYNE + 
Sbjct: 473 TYTMLNPRN------------GIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIA 520

Query: 161 DLL 163
           DLL
Sbjct: 521 DLL 523

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 77/153 (50%), Gaps = 14/153 (9%)

Query: 276 LLHRGLKNRQIASSKNQKYSSRASTIFTIVL------YKEEEGEIFRVSKWNFVDLAGAE 329
           LL +  + R  AS+   + SSR+ ++F I L        E+   I      N VDLAG+E
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGIL-----NLVDLAGSE 620

Query: 330 HSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV---IPFKDSKLTYLIKDTLEGN 386
             +  +   +R ++              V++L   ++    IPF++SKLTYL++ +L GN
Sbjct: 621 RINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGN 680

Query: 387 SKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           SK++  + +   +  L+E + +L F +KV S K
Sbjct: 681 SKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 90/177 (50%), Gaps = 7/177 (3%)

Query: 248 RHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVL- 306
           RH QE +   ++ N+    +T+      LL R  K R  A++ + + SSR+ ++F I L 
Sbjct: 527 RHDQE-SQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLR 585

Query: 307 -YKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKE 365
            Y    GE  +    N VDLAG+E  +  + T  R ++              +++L   +
Sbjct: 586 GYNSNTGEECQ-GTLNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPD 644

Query: 366 SV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +    IPF++SKLTYL++ +L G+SK++  + +    D  +E + +L F +KV S +
Sbjct: 645 ASKRHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 74/155 (47%), Gaps = 18/155 (11%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIII--EEPGLIKFKGKDDAVKREFGMDHIFSSDVVQE 71
           NI+V  R +  +  E  +     I +  ++ G        D+ K EF  D IF  +   +
Sbjct: 367 NIRVFCRIRPLLQGEGSESCHVHINLFNDDEGTQSMNITRDSKKHEFKFDKIFDPENSND 426

Query: 72  QLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRVL 131
            ++ + ++ + Q  ++GYN     YG+TGSGKTYT       +LH +      G+IP  L
Sbjct: 427 DIF-EEIRQLVQSSLDGYNVCIFAYGQTGSGKTYT-------MLHPQN-----GMIPSTL 473

Query: 132 EELFDHLSC---NNIDHVVKCSYVEIYNEELKDLL 163
           + +F  +        ++ +   ++EIYNE + DLL
Sbjct: 474 DHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D +F  +  Q ++Y ++  P+    ++G+N +   YG TG GKTYT+SG       
Sbjct: 152 KFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPS---- 207

Query: 117 SEASRLSVGVIPRVLEELFDHLS--CNNIDHVVKCSYVEIYNEELKDLL 163
                   G+I   +EELF+ +S   +  +  +  SY+EIYNE + DLL
Sbjct: 208 ------QPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 80/169 (47%), Gaps = 8/169 (4%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE----GEI 314
           + NL   H T  ++ + L+ +G  NR  + ++  + SSR+ ++  I + +  +       
Sbjct: 271 VANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLTSQ 330

Query: 315 FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL----HEKESVIPF 370
              +  + +DLAG+E +        R  +              +N+L      +   IP+
Sbjct: 331 HTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTCHIPY 390

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 391 RDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 91/169 (53%), Gaps = 6/169 (3%)

Query: 256 APYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVL--YKEEEGE 313
           A  I N+ +  +T+ ++   +L R  + R  A +++ + SSR+ ++F + +  + ++ GE
Sbjct: 540 ATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTGE 599

Query: 314 IFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV---IPF 370
           +    K N +DLAG+E  +    T  R ++              + +L+  ++    IPF
Sbjct: 600 VSH-GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPF 658

Query: 371 KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           ++SKLTYL++ +L G+SK++  + +  ++   +E + +L F +KV S K
Sbjct: 659 RNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 55/114 (48%), Gaps = 26/114 (22%)

Query: 58  FGMDHIF-----SSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEED 112
           F  D IF     ++DV QE      +  + Q  ++GYN     YG+TGSGKTYT+    D
Sbjct: 417 FHFDKIFEPHNTNADVFQE------ICQLVQCSLDGYNVCIFAYGQTGSGKTYTMLNPGD 470

Query: 113 SLLHSEASRLSVGVIPRVLEELF---DHLSCNNIDHVVKCSYVEIYNEELKDLL 163
                       G+IP  L  +F   + L  +   + + C Y+EIYNE + DLL
Sbjct: 471 ------------GMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 16/111 (14%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D IF+ D    Q++   +K + Q  ++G+N     YG+TGSGKTYT+  EED     
Sbjct: 408 FQFDKIFNYDESNRQVF-GEVKELVQSALDGHNVCIFTYGQTGSGKTYTMLNEED----- 461

Query: 118 EASRLSVGVIPRVLEELFDHLSCN---NIDHVVKCSYVEIYNEELKDLLVD 165
                  G+IP  L+ + D  S        + +K  +VEIYN+ + DLL D
Sbjct: 462 -------GIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLND 505

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 79/159 (49%), Gaps = 18/159 (11%)

Query: 268 TNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLY---KEEEGEIFRVSKWNFVD 324
           +N +E  +L+ R  K R+ A +     SSR+ ++F + +    K+ E     V   N VD
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGV--LNLVD 600

Query: 325 LAGAEH--------SHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLT 376
           LAG+E           +IE T Q  K                 SLH     IPF+++KLT
Sbjct: 601 LAGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLH-----IPFRNTKLT 655

Query: 377 YLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKV 415
           YL+K +L+G+SK++ ++T+  +  S +E + +L F  KV
Sbjct: 656 YLLKHSLQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 12/111 (10%)

Query: 55  KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
           +++F  D +F  D  Q ++Y  + +P+    ++G+N +   YG TG GKTYT+SG  +  
Sbjct: 122 EQKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGTPE-- 179

Query: 115 LHSEASRLSVGVIPRVLEELFDHLS--CNNIDHVVKCSYVEIYNEELKDLL 163
                   + G+I   ++ELF  +    +     +  SY+EIYNE ++DLL
Sbjct: 180 --------NPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLL 222

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 82/170 (48%), Gaps = 9/170 (5%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKE----EEGEI 314
           + NL    ++  ++ + L+ +G  NR  +++   + SSR+  +  + + +     E  E 
Sbjct: 243 VANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELTED 302

Query: 315 FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL-----HEKESVIP 369
            + +  + +DLAG+E +   +   +R  +              +N+L           +P
Sbjct: 303 HKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYHVP 362

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           ++DSKLT L+K +L GN K++ I+ +  + +  DE + TL++  + + +K
Sbjct: 363 YRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIK 412

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 92/184 (50%), Gaps = 11/184 (5%)

Query: 245 SPQRH---IQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTI 301
           SP +H     ++T    + N+    + N      +L +  K R  A++ + + SSR+ ++
Sbjct: 537 SPNKHEIRHDKETMTTSVTNINTIALNNKGIVNNVLKKATKLRATAATNSNERSSRSHSV 596

Query: 302 FTIVLYKEEEGEIFRVSK---WNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXV 358
           F I  Y + + EI   S     N VDLAG+E  +  +    R ++              +
Sbjct: 597 FMI--YLKGKNEITGDSSEGILNLVDLAGSERLNSSQAVGARLRETQNINKSLSCLGDVI 654

Query: 359 NSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKV 415
           ++L + ++    IPF++SKLTYL++ +L G+SK++  + +   K  L+E I +L F +KV
Sbjct: 655 HALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKTLMFVNISPTKSHLNETINSLRFASKV 714

Query: 416 RSLK 419
            S K
Sbjct: 715 NSTK 718

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 74/169 (43%), Gaps = 40/169 (23%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGL--IKFKGKDD-------AVKREFGMDHIF 64
           NI+V  R +  + +           IE+P +  IK K  D+        V +E G   I+
Sbjct: 382 NIRVFCRMRPPLPD-----------IEDPDISNIKIKRFDNNYGTQSMKVTKENGESQIY 430

Query: 65  SSDVVQEQL-----YLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEA 119
             D + +Q          +  + Q  ++G+N     YG+TGSGKTYT+  + D       
Sbjct: 431 KFDRIFDQADSNTEVFKEIGQLVQSSLDGHNVCIFAYGQTGSGKTYTMLNDND------- 483

Query: 120 SRLSVGVIPRVLEELFDH---LSCNNIDHVVKCSYVEIYNEELKDLLVD 165
                G+IP  +  +FD    +      + + C ++EIYNE + DLL D
Sbjct: 484 -----GMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRD 527

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 58/113 (51%), Gaps = 22/113 (19%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D +   +  Q+ ++  + +P+    ++GYN +   YG TG GKTYT+SG  +     
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGTPE----- 164

Query: 118 EASRLSVGVIPRVLEELFDHLSCNNIDHV-------VKCSYVEIYNEELKDLL 163
                + G+I   L+ LF     N I+++       +  SY+EIYNE +KDLL
Sbjct: 165 -----NPGIIFLTLQSLF-----NKIENLKDTKEISISLSYLEIYNESIKDLL 207

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 86/176 (48%), Gaps = 17/176 (9%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE------- 311
           + NL  +     +E + L+ +G  NR  +S+   + SSR+  +  I L ++ +       
Sbjct: 228 VSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNKLNNDINS 287

Query: 312 -GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL------HEK 364
             ++F  S  + +DLAG+E +   +   +   +              +N+L      H +
Sbjct: 288 TEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCINTSSHSQ 345

Query: 365 ESV-IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           + + IP++DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 346 QQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIK 401

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 53/110 (48%), Gaps = 13/110 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  D++F       ++Y    KPM      GYN     YG TGSGKT+T+SG  +    
Sbjct: 138 EFKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGTPE---- 193

Query: 117 SEASRLSVGVIPRVLEELFDHL---SCNNIDHVVKCSYVEIYNEELKDLL 163
                   G+I   +E +F  +   S  N    V  SY+EIYNE++ DLL
Sbjct: 194 ------EAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLL 237

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 75/170 (44%), Gaps = 13/170 (7%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEE-EGEIFRV 317
           +  L E  + ++++ ++ +  G  NR+   +     SSR+  I T+ L   +        
Sbjct: 280 VMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDLVSGAETT 339

Query: 318 SKWNFVDLAGAE-----HSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV----I 368
           S  +  DLAG+E     H  + EG    F +               +S+H   S     I
Sbjct: 340 STLSLCDLAGSERAAGQHERRKEGA---FINKSLLALGTVISKLSASSMHTTPSFGNSHI 396

Query: 369 PFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           P++DSKLT +++  L G S    I T+    D++ E + T+ F ++ +++
Sbjct: 397 PYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNV 446

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 76/159 (47%), Gaps = 23/159 (14%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKREFGMDHIFSSDVV---Q 70
           NI+V  R +  I +E      D  I  +P      G+   +  +    H F+ D +   Q
Sbjct: 335 NIRVYCRLRPYIKDEAATSNSDGYIFIKP-FDANAGQQRIIVNDLKQLHAFTFDKIFGMQ 393

Query: 71  EQLY--LDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIP 128
           +  Y   D +K + Q  ++GYN     YG+TGSGKTYT+  E+D            G+I 
Sbjct: 394 DDNYEVFDDIKNLVQSSLDGYNVCIFTYGQTGSGKTYTMLNEKD------------GIIM 441

Query: 129 RVLEELFDHLSCN----NIDHVVKCSYVEIYNEELKDLL 163
           + +E +  H + N      ++ ++  ++EIYNE ++DLL
Sbjct: 442 QTIEYIV-HFAGNLHKLGWEYELEVEFIEIYNETIRDLL 479

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 71/146 (48%), Gaps = 3/146 (2%)

Query: 275 QLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE-GEIFRVSKWNFVDLAGAEHSHK 333
           QL+  G   R   S+     SSR+ ++F + +       +     + N VDLAG+E   +
Sbjct: 526 QLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHSTGRLNLVDLAGSERLQQ 585

Query: 334 IE--GTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIF 391
            E   + +  K+              ++S+  ++  IPF++SKLTYL+K++L   SK++ 
Sbjct: 586 QEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLM 645

Query: 392 ILTLRFNKDSLDEMIETLEFGNKVRS 417
            + +  N +S+ E I +L    KV +
Sbjct: 646 YVNISPNINSIRETINSLRLARKVNT 671

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 75/179 (41%), Gaps = 42/179 (23%)

Query: 14  NIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDD-------------AVKREFGM 60
           NIKV  R + +I  E             P +IK K  ++              V+  F  
Sbjct: 4   NIKVAIRIRDKISRETS----------RPSVIKRKTSNEITLQKDNTANVITTVEHTFYF 53

Query: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120
           D +F     Q+Q+Y +  +      + GY+   + YG+TG+GKTYT+ G E         
Sbjct: 54  DQVFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ-------- 105

Query: 121 RLSVGVIPRVLEELFDHLS-CNN--------IDHVVKCSYVEIYNEELKDLLVDQHNSL 170
               G+IP V  ELF  +  C +        +   V  SY +IYNE++ D+L    N L
Sbjct: 106 --EPGIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLSGGCNVL 162

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 100/198 (50%), Gaps = 9/198 (4%)

Query: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEE----EGE 313
           YI+ L +  + + +E ++ +  G   R +A +   + SSR+  I TI + + E       
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 314 IFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL-HEKESVIPFKD 372
           + RVS    VDLAG+E +   +  ++RFK+              V  L + K + +P+++
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 373 SKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPS-INK- 430
           S LT +++D L+GNS +  +  +  +    +E I TL + +  + ++    L  + I+K 
Sbjct: 293 SLLTRVLRDNLDGNSITCILACI--SPCDYEESISTLRYASTAKHVRTEAHLNTTQISKG 350

Query: 431 ETLIKSISNELAKVKSDL 448
           E  + S+ N+L ++++ L
Sbjct: 351 EEQLFSLQNQLKELQATL 368

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 22/134 (16%)

Query: 48  KGKDDAVKREFGMDHIFSSDVVQEQLYLDSLKP---MFQDFINGYNCSTLVYGKTGSGKT 104
           K ++ A   EF  D IF     Q+   +D  K    + Q  ++GYN     YG+TGSGKT
Sbjct: 426 KIQNTAQVHEFKFDKIFD----QQDTNVDVFKEVGQLVQSSLDGYNVCIFAYGQTGSGKT 481

Query: 105 YTLSGEEDSLLHSEASRLSVGVIPRVLEELFDH---LSCNNIDHVVKCSYVEIYNEELKD 161
           +T+    D            G+IP  +  +F+    L     D+ V C ++EIYNE + D
Sbjct: 482 FTMLNPGD------------GIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVD 529

Query: 162 LLVDQHNSLLSASI 175
           LL   +N+    SI
Sbjct: 530 LLRSDNNNKEDTSI 543

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 77/148 (52%), Gaps = 4/148 (2%)

Query: 276 LLHRGLKNRQIASSKNQKYSSRASTIFTIVLY-KEEEGEIFRVSKWNFVDLAGAEHSHKI 334
           +L +  K R  AS+ + ++SSR+ +IF I L     +         N VDLAG+E  +  
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 335 EGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV---IPFKDSKLTYLIKDTLEGNSKSIF 391
           +    R ++              +++L + +S    IPF++SKLTYL++ +L G+SK++ 
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 392 ILTLRFNKDSLDEMIETLEFGNKVRSLK 419
            + +  +   ++E + +L F +KV S +
Sbjct: 697 FVNISPSSSHINETLNSLRFASKVNSTR 724

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D +F  +  QE++Y  +   +    ++G+N +   YG TG GKTYT+SG  +    
Sbjct: 128 KFVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGTPE---- 183

Query: 117 SEASRLSVGVIPRVLEELFDHLS--CNNIDHVVKCSYVEIYNEELKDLL 163
                   GVI   ++ELF  +    +     +  SY+EIYNE ++DLL
Sbjct: 184 ------RPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 81/170 (47%), Gaps = 9/170 (5%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTI-VLYKEEEGEI--- 314
           + NL        ++ + L+  G  NR  +++   + SSR+  +  I ++      EI   
Sbjct: 247 VANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEITSD 306

Query: 315 FRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL-----HEKESVIP 369
              +K + +DLAG+E +   +   +R ++              +N+L       +   +P
Sbjct: 307 HTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCHVP 366

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           ++DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 367 YRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIK 416

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 8/107 (7%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  DH+F      E L+ +    + +   +G N + L YG TGSGKTYT+ G  D ++ 
Sbjct: 126 DFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGHNDGIVK 185

Query: 117 SEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLL 163
                        V   + +      +   V  SY+EIYNE++ DLL
Sbjct: 186 MCGD--------CVFTRMLNAADERQVKRSVTVSYLEIYNEKICDLL 224

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 32/51 (62%)

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           IP++DSKLT L++  L  +S    I T+   K+++ E + TL F ++ +++
Sbjct: 367 IPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 86/188 (45%), Gaps = 17/188 (9%)

Query: 248 RHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLY 307
           RH+ E  G P + NL + H+ + KE +   ++ +    + +SK+     R +TIF I + 
Sbjct: 201 RHVSEHKGLP-VDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIE 256

Query: 308 KEEE-GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEK-- 364
           K ++  E    S    VDLAG++   +   +    +D              + SL +   
Sbjct: 257 KLDKLDESTTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSY 316

Query: 365 ----------ESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNK 414
                     E+ +P+  SKL  L+K+ L GN K+ F+ T+  N +  D++IE L+ G  
Sbjct: 317 SDYKNYEFSLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTI 376

Query: 415 VRSLKCYP 422
           ++  K  P
Sbjct: 377 LQDSKTVP 384

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 18/118 (15%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE--EDSLL 115
           F   HIF  D   + +    +  M  + + GYN + + YG   SGKTY+L G   +DS  
Sbjct: 84  FEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYSLYGNDVDDSF- 142

Query: 116 HSEASRLSVGVIPRVLEELFDHLSCNNID------HVVKCSYVEIYNEELKDLLVDQH 167
                    G+   + ++LF  ++ +  D       +VK S++E++ +++ DLL  Q+
Sbjct: 143 ---------GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLLAPQN 191

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 75/162 (46%), Gaps = 22/162 (13%)

Query: 13  CNIKVVARF---KGQIDNE---KGDDVRDQIIIEEPGLIKFKGKDDAVKREFGMDHIFSS 66
           C+I+V+ R    KG  +NE   K D   + ++      +    K+      F  D +F +
Sbjct: 26  CHIEVILRAIPEKGLQNNESTFKIDPYENTVLFRTNNPLHETTKE--THSTFQFDKVFDA 83

Query: 67  DVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGV 126
           +  QE +    + P+  D +NGYN + + YG + SGK+Y+L G          S+ S G+
Sbjct: 84  NATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIG----------SKESEGI 133

Query: 127 IPRVLEELFDHLSCN----NIDHVVKCSYVEIYNEELKDLLV 164
           +P + + LFD L  N         V     EIY E+  DLLV
Sbjct: 134 LPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLLV 175

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 64/147 (43%), Gaps = 15/147 (10%)

Query: 283 NRQIASSKNQKYSSRASTIFTI-VLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRF 341
           NR     K ++  SR+  +F + V  +  + +I + S    VDL GAE   K   +    
Sbjct: 222 NRMACGDKTER--SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQ 279

Query: 342 KDXXXXXXXXXXXXXXVNSLHEKES----------VIPFKDSKLTYLIKDTLEGNSKSIF 391
                           V SL  KE              +++S+LT ++KD+L GN K+  
Sbjct: 280 DALKKLNQSIEALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKV 339

Query: 392 ILTLRFNKDSLDEMIETLEFGNKVRSL 418
           ILT   +  ++   + TLEFG+ +R +
Sbjct: 340 ILTCFLS--NVPTTLSTLEFGDSIRQI 364

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 78/143 (54%), Gaps = 30/143 (20%)

Query: 50  KDDAVKREFGMDHIFSSD--VVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTL 107
           KD  V  ++  D +F+S+   V+ Q +++S     +  + GYN S + YG++G+GK++ L
Sbjct: 65  KDQVVNTQYKFDKVFASNDTGVEHQEFIES---NLESLLQGYNTSIVTYGQSGTGKSFEL 121

Query: 108 SGEEDSLLHSEASRLSVGVIPRVLEELFDHL------SCNNIDHVVKCSYVEIYNEELKD 161
            GE+             G+I ++L +LF+ +      +  NI + VK S++E+Y E++ D
Sbjct: 122 YGEQQD-----------GLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFD 170

Query: 162 LLVDQHNSLLSASIKK-LRIVDS 183
           L+        S S+KK L+I DS
Sbjct: 171 LMD-------SPSVKKHLKINDS 186

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%)

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYP 422
           +P+K S LT L+ D L GN K+ F+LT    K+  +E + TL+FG   +S    P
Sbjct: 315 VPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANTNP 369

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 51/111 (45%), Gaps = 10/111 (9%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           EF  DH++S  V   ++Y    KPM      G+N +   YG TGSGKTYT+      +  
Sbjct: 134 EFKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTM------MGS 187

Query: 117 SEASRLSVGVIPRVLEELFDHLS----CNNIDHVVKCSYVEIYNEELKDLL 163
                   G+IP  +  LF  +            V  SY+EIYNE + DLL
Sbjct: 188 GGDGGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLL 238

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 85/193 (44%), Gaps = 24/193 (12%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVS 318
           +  L E    +++E ++ + RG  +R+ A +     SSR+  I  I L      +   +S
Sbjct: 281 VMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGTSIS 340

Query: 319 K-WNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESV---------- 367
              +  DLAG+E +    G  +R K+              ++ L  + +           
Sbjct: 341 STLSLCDLAGSERA---TGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSPNAN 397

Query: 368 ----IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPL 423
               IP++DSKLT +++  L G+S    I T+   K+S  E + TL F ++ +++  +  
Sbjct: 398 GNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNVSLH-- 455

Query: 424 LGPSINKETLIKS 436
               +N++ L+ S
Sbjct: 456 ----VNRKPLMNS 464

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (49%), Gaps = 16/111 (14%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D +F+    Q  +Y  +   +    ++G+N +   YG TG GKTYT+SG  +    
Sbjct: 145 KFIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGTPE---- 200

Query: 117 SEASRLSVGVIPRVLEELFDHLSCNNIDHV----VKCSYVEIYNEELKDLL 163
                   G+I   +EELF  +   NI       +  SY+EIYNE ++DLL
Sbjct: 201 ------QPGIIFLAMEELFQKIE--NIKDTKNFELTLSYLEIYNESIRDLL 243

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 80/172 (46%), Gaps = 13/172 (7%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE------G 312
           + NL        ++ + L+ +G  NR  +++   + SSR+  +  I + +          
Sbjct: 264 VANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVDLTSS 323

Query: 313 EIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL-----HEKESV 367
            +F  +  + +DLAG+E +   +   +R  +              +N+L       +   
Sbjct: 324 HVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTRRSCH 381

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           +P++DSKLT L+K +L GN K++ I+ +  +    DE + TL++ N+ + +K
Sbjct: 382 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIK 433

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 16/111 (14%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           +F  D +F     Q  +Y  +   +    ++G+N +   YG TG GKT+T+SG  +    
Sbjct: 127 KFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGTPE---- 182

Query: 117 SEASRLSVGVIPRVLEELFDHL----SCNNIDHVVKCSYVEIYNEELKDLL 163
                   G+I   ++ELF  +       NI+  +  SY+EIYNE ++DLL
Sbjct: 183 ------QPGIIFLTMDELFKRIESLKDTKNIE--LTLSYLEIYNETIRDLL 225

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 78/170 (45%), Gaps = 9/170 (5%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTI-VLYKEEEGEIFRV 317
           + NL        +E +  + RG  NR  + +   + SSR+  +  I +   +   ++   
Sbjct: 246 VSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLISN 305

Query: 318 SKW---NFVDLAGAEHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSL-----HEKESVIP 369
           S +   + +DLAG+E +   +   +R  +              +N+L       +   +P
Sbjct: 306 STFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRTCHVP 365

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
           ++DSKLT L+K +L GN K++ I+ +  +    DE + TL + N+ + +K
Sbjct: 366 YRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIK 415

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 28/118 (23%)

Query: 73  LYLDSLKPMFQ----DFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIP 128
           +++   KP+      D I+G   + + YG TGSGKTYT+ G          ++   G++ 
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHG----------TKAEGGIVQ 168

Query: 129 RVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRIVDSGSP 186
             + +L   LS N     +  SY+EIYNE L DLL D          K+LRI+D  +P
Sbjct: 169 LSIRDLLTQLSKNC---QITISYLEIYNERLHDLLCD--------GTKELRILDDSAP 215

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 65/144 (45%), Gaps = 6/144 (4%)

Query: 274 IQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHS-- 331
           ++L+ +G +NR++ S+++   SSR+  +  + +  +  G   RV      DLAG+E +  
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI-TDSMGSKARV--LTLCDLAGSERASV 297

Query: 332 HKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIF 391
           H   G                     +N      + +P++DSKLT L+K +L GN     
Sbjct: 298 HD-RGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLVTM 356

Query: 392 ILTLRFNKDSLDEMIETLEFGNKV 415
           + T+  +    ++ + TL F  + 
Sbjct: 357 VCTVSLSGTDYEQSLGTLRFARRA 380

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 14/111 (12%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D +F ++  Q+ +    + P  +D ++GYN + L YG + SGK+Y+L G        
Sbjct: 75  FQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLG-------- 126

Query: 118 EASRLSVGVIPRVLEELFDHLSCN----NIDHVVKCSYVEIYNEELKDLLV 164
             S+ + GV+P + + LF+ L  N      +  V     EIY E+  DLLV
Sbjct: 127 --SQYNEGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLLV 175

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 78/158 (49%), Gaps = 29/158 (18%)

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSIN 429
           +++S+LT +++D+L GN K   ILT   +  ++   I TLEFG+ +R +         IN
Sbjct: 318 YRESQLTEVLRDSLGGNRKMKVILTCFLS--NVPTTISTLEFGDNIRQI---------IN 366

Query: 430 KETLIKSISNELAKVKSDLL--STKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDE 487
           K  ++ S +    K K DL     K K+  Y+S    ++L  +LD  K          D 
Sbjct: 367 K--VMSSTTGLNMKKKMDLFVQDMKIKDDNYVS--QINILKSELDSLK----------DL 412

Query: 488 LNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYT 525
            NE S+  R+D +   E  E + +KL+   DS++ + +
Sbjct: 413 SNESSS--REDMKTELENYEKENVKLKLQLDSITQLLS 448

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 53/113 (46%), Gaps = 18/113 (15%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D +F ++  Q+ +    L P   D ++GYN + L YG + SGK+Y+L G +D     
Sbjct: 76  FQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQD----- 130

Query: 118 EASRLSVGVIPRVLEELFDHLS------CNNIDHVVKCSYVEIYNEELKDLLV 164
                  G++P + + LF  L        NN    V     EIY E+  DLLV
Sbjct: 131 -----GGGILPNICKALFSTLEDREKNKGNNFS--VSVLAFEIYMEKTYDLLV 176

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 33/49 (67%), Gaps = 2/49 (4%)

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           +++S+LT ++KD+L GN K+  ILT   +  ++   + TL+FG+ +R +
Sbjct: 319 YRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPTTLSTLKFGDSIRQI 365

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 93/205 (45%), Gaps = 37/205 (18%)

Query: 2   SLSDGVKDKV--ECNIKVVARFKGQIDNEKG----DDVRDQIIIEEPGLIKFKG---KDD 52
           S+S+G  D +    +I+VV R K  ID        +D    + +++   +  K     D 
Sbjct: 3   SISNGCTDAIVQPTSIRVVLRLKPLIDEAAKLSYVEDGAGSLSLQDFPQVAGKATFFSDA 62

Query: 53  AVKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEED 112
               +F  + ++   V Q+++  D +     + + G+N S + +G  GSGKTYT+ G + 
Sbjct: 63  NDTNKFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGND- 121

Query: 113 SLLHSEASRLSVGVIPRVLEELFDHL------SCNNIDHVVKCSYVEIYNEELKDLLVDQ 166
              H E      G++ R+ + +FD L      S N  +  +  ++ E++ E + DLL  Q
Sbjct: 122 ---HEE------GIVQRMCQSIFDQLDKLHEDSGN--ESTISINFFELFAENVYDLLSLQ 170

Query: 167 HNSLL----------SASIKKLRIV 181
            NS +          + S+K LR V
Sbjct: 171 KNSKVLKTSSDTKTHTLSVKGLRTV 195

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 56/115 (48%), Gaps = 14/115 (12%)

Query: 58  FGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHS 117
           F  D +F ++  QE +    ++P   D ++GYN + + YG + SGK+Y+L G ++     
Sbjct: 75  FKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQE----- 129

Query: 118 EASRLSVGVIPRVLEELFDHLSCN----NIDHVVKCSYVEIYNEELKDLLVDQHN 168
                  G++P + + LF+ L  N      +  V     EI+ E+  DLLV   N
Sbjct: 130 -----GEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLLVPLTN 179

 Score = 35.8 bits (81), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 32/49 (65%), Gaps = 2/49 (4%)

Query: 370 FKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           +++S+LT ++KD+L GN K+  ILT   +  ++   + TLEFG  +R +
Sbjct: 318 YRESQLTEVLKDSLGGNRKTKVILTCFLS--NVSTTLSTLEFGECIRQI 364

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 65/143 (45%), Gaps = 35/143 (24%)

Query: 58  FGMDHIFSSDV----VQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDS 113
           F +D IF+           +  DS+  +F    NGYN + + YG+T SGKT T+ G    
Sbjct: 71  FRVDQIFNPGAQTKDTTSSIIGDSVAQLF----NGYNVAIMAYGQTDSGKTSTMFGYNK- 125

Query: 114 LLHSEASRLSVGVIPRVLEELFDHL---SCNNIDHVVKCSYVEIYNEELKDLL------- 163
                      GVI  V +++F  +   S NNID+ +  S +E+  E ++DLL       
Sbjct: 126 ---------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLAPLSEQK 176

Query: 164 -----VDQHNSLLSASIKKLRIV 181
                +D   S  S SIK LR V
Sbjct: 177 PLKLRLDSKKS--SISIKNLRCV 197

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 76/177 (42%), Gaps = 29/177 (16%)

Query: 259 IQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE-GEIFRV 317
           I+NL   ++T+  E +    +G   R +ASS       R+S I  I + + +   E+F+ 
Sbjct: 191 IKNLRCVYVTSLLEALSYCEKG---RSLASS-------RSSVIIRITVEQRDNVKEVFKT 240

Query: 318 SKWNFVDLAGA-------------EHSHKIEGTNQRFKDXXXXXXXXXXXXXXVNSLHEK 364
             +  VDL  +             E++ KI   NQ                  V +   +
Sbjct: 241 GSFQLVDLGSSDKIDKQNNLGISPENTKKI---NQSMVTLENVARSLAGTEQSVKNGRPR 297

Query: 365 ES--VIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLK 419
                IP+K+S LT L+++T+ GN K+  +L     K   +E + TL FG  ++ +K
Sbjct: 298 SGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVK 354

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 71/162 (43%), Gaps = 23/162 (14%)

Query: 57  EFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLH 116
           E+  D IF  D  + + Y      +  D   GYN + + YG T SGK++ L G+ DS   
Sbjct: 85  EYQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDS--- 141

Query: 117 SEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSL----LS 172
                 + G+I  + + L      +N+  +   S  E+Y +++ DLL++    L      
Sbjct: 142 -----TNDGLINHIADRLLFPQCEDNLKTLCSISMWELYIDKVYDLLLNNGKPLKVHVHG 196

Query: 173 ASIKKLRIVDSGSP-----NVKNGANSNCNTRDNSPLTSSKS 209
             I+ L  +   SP      +KNG       ++ SPL  SKS
Sbjct: 197 DHIRDLHQIHVTSPIEIKDTLKNGY------KNISPLHHSKS 232

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 55/113 (48%), Gaps = 10/113 (8%)

Query: 52  DAVKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEE 111
           D  +R F +D +F     Q  +    L P+  +  +G N      G + +GKT+T+ G++
Sbjct: 38  DPHERTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQ 97

Query: 112 DSLLHSEASRLSVGVIPRVLEELFDHLSCN-NIDHVVKCSYVEIYNEELKDLL 163
                     +S G++ R+L ++F  ++ N  +      S VE+ N+++ DLL
Sbjct: 98  G---------VSQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLL 141

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 55/131 (41%), Gaps = 44/131 (33%)

Query: 84  DFINGYNCSTLVYGKTGSGKTYTLSGEE--DSLLHSEASRLSV----------------- 124
           D   GYN + + YG+TG+GKTYTL G    D+    ++  ++                  
Sbjct: 84  DLFKGYNSTYISYGQTGTGKTYTLYGTAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQ 143

Query: 125 ------------------GVIPRVLEELFDHLSC-----NNIDHVVKCSYVEIYNEELKD 161
                             G+I +V  +LF+ +         I  +V  S+VE+Y EE+ D
Sbjct: 144 TSASSNKSANSILQKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYD 203

Query: 162 LLVDQHNSLLS 172
           LL  QH+  LS
Sbjct: 204 LL--QHDDTLS 212

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 72/163 (44%), Gaps = 13/163 (7%)

Query: 267 ITNAKEGIQLLHRGLKNRQIASSKNQKYSS-----RASTIFTIVLYKEEEGEIFRV-SKW 320
           I N K  + +L R   N  I SS+   +S      R+STI  I L + +E E     S  
Sbjct: 231 IKNVK-SVTILDRNELNDLIDSSRRLLHSCHNNGIRSSTILRIKLLQLDEDEDLETQSTI 289

Query: 321 NFVDLAGAEHSHK-IEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIP----FKDSKL 375
            FVDLAG++ + K IE    R +               V +L   ES+      +++S L
Sbjct: 290 CFVDLAGSDRASKDIEKGITR-EAASKYNRVMDSLNSMVYTLANSESISINKSIYRNSHL 348

Query: 376 TYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSL 418
           T ++ D L GN K+  I +   NKD   E   TL F +   S+
Sbjct: 349 TRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGFSSYASSM 391

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 68/150 (45%), Gaps = 33/150 (22%)

Query: 44  LIKFKGKDDAVKREFGMDHIFSSDVVQEQL--YLDSLKPMFQ---------------DFI 86
           L+K K +D  +    G +++F+S ++Q+ L  Y D  K  F                D I
Sbjct: 27  LLKVKPRDAEINS--GDENLFNSYLLQDNLFFYKDEDKYQFDSVHEKSTELYNGIKGDLI 84

Query: 87  N----GYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRVLEELFDHLSC-- 140
           N    GY+   + YG  G+GK+        S+ +   S    GV+   +++L+D +    
Sbjct: 85  NNIFEGYHTGVITYGSAGTGKS--------SIFYGTDSTYEGGVVLMFVQDLYDKIDSIG 136

Query: 141 NNIDHVVKCSYVEIYNEELKDLLVDQHNSL 170
           N+    V  S +EI+ E++ DLLV+    L
Sbjct: 137 NDTHFTVSLSTIEIHLEKMYDLLVNDRRPL 166

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 112/266 (42%), Gaps = 72/266 (27%)

Query: 366 SVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLG 425
           +VIP+K+S LT L+     GN K+  ILT    K +  E +ETL+ G K+ S+       
Sbjct: 296 AVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISS----N 351

Query: 426 PSINKETLIKSISNELAKVKSDLL--STKSKEGVYMSH---------------------- 461
             +NK  L        +K K DL+    KSKE  YM+                       
Sbjct: 352 VHMNKHALN-------SKKKLDLIVEDMKSKEANYMNRIRLLETELNDLRASYGEAISET 404

Query: 462 ------------------EHYDVLTKDLDK---------HKVEIMDLKKVIDELNEQSTT 494
                             E  +V  K L K          ++ + D ++++ +L E+S +
Sbjct: 405 SSFKEEMNKERAKNVKLKEELEVFKKLLQKKGEAQSTHSKEMPLTDDEEIMQQLIEKSAS 464

Query: 495 LRKDKRAFE-------EVNEVQRI---KLQSMRDSVSMMYTNIEKQQRREHDLINSTDKL 544
           + + K   +       ++NEV +    KLQ+++     + T IEKQ+    DL++S   +
Sbjct: 465 VAELKATLDIEKHKSFKLNEVLKNYVEKLQTLKKMNDNLVTRIEKQEDSIQDLLSSNTVM 524

Query: 545 KETVNNMNVTIARYTDRESSVQTQMK 570
           K  + N N T    T+R   ++++++
Sbjct: 525 KSQIKNWNNTADSRTERIKLLESKLR 550

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 17/81 (20%)

Query: 56  REFGMDHIFSSDVVQ-EQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSL 114
           ++F  D+IF ++  Q E L + ++K +F    +GYN S + YGK+ SGK+ TL  E+D  
Sbjct: 67  QDFKFDNIFPTNSEQNEMLTVSTIKDLF----DGYNQSFITYGKSNSGKSDTLFNEKD-- 120

Query: 115 LHSEASRLSVGVIPRVLEELF 135
                     G+I  + E+LF
Sbjct: 121 ----------GLIRLLFEQLF 131

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 78/342 (22%), Positives = 160/342 (46%), Gaps = 54/342 (15%)

Query: 255 GAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEE---E 311
           G  +++NL    I +  +  +    G +      +       R+++I    ++ E+   +
Sbjct: 202 GDKHVKNLSHIQIASLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNPK 261

Query: 312 GEIFRVSKWNFVDLAGAEHSHK--IEGTNQRFKDXXXXXXXXXXXXXXVNSLHEKESVIP 369
            +++++S  +F+DL G +   K  I+ TN   K               + +L + +S +P
Sbjct: 262 DQLYKLSTLSFIDLYGIDKFTKKDIQLTNDEMK---KLNTLMSSFQNLITTLSDPKS-LP 317

Query: 370 F-----KDSKLTYLIKDTLEGNSKSIFILTLRFNKDSL---DEMIETLEFGNKVRSLKCY 421
           +     KDS L  +++D + GNSK+ FI+   F   S+   +E+IE L+F   ++S+K  
Sbjct: 318 YTSSLYKDSALNKILQDYIGGNSKTTFIIP--FPSPSIIQHEELIEMLKFAMGLKSIK-N 374

Query: 422 PLL----GPSINKETLIKSISNELAK---------VKSDL-LSTKSKEGVYMSH--EHYD 465
           PL+    G ++ K+ L+   S++L +         ++S+L L  K  E V   H  E+Y+
Sbjct: 375 PLIMNVFGLNLQKQMLLFIKSSKLREENCQTKINYLQSELALKNKLLEPVATDHHEENYN 434

Query: 466 VLTKDLDKH-----KVEIMDLKKVID------------ELNEQSTTLRKDKRAFEEVNEV 508
             +   DK      K++I  L++V++            E NE    L+K     E+V ++
Sbjct: 435 DESSCSDKETIMKLKLKIESLEQVLEHISTSENPKSKTETNEHDELLKKLMDKCEDVAKL 494

Query: 509 QRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNN 550
           Q +++++ +++ S +  +++    ++H L     KL E + N
Sbjct: 495 Q-VEIEAEKNTNSKLKQDLKYSASKQHALETMNLKLLEQLQN 535

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 86/166 (51%), Gaps = 27/166 (16%)

Query: 368 IPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPS 427
           +P+KDS+LT LI++ L GNS++  +L    +K   +E I TL FG +++++         
Sbjct: 338 VPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGVQLQNI--------- 388

Query: 428 INKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIM--DLKKVI 485
                        L  V++D+    SK+ + +  ++  V+  + D+ K+ ++  +L K+ 
Sbjct: 389 -------------LNFVRADVTGLNSKKTLDLLIDNMKVIENNYDQ-KITLLESELNKLA 434

Query: 486 DELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQ 531
           D + +   T   +    E+ +E++  KL+   ++++ ++ NI+ ++
Sbjct: 435 DTVKKAKVTEELETEIVEKNDEIK--KLREQLETMTQLFNNIDPKE 478

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (72%)

Query: 81  MFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDS 113
           + +D  +GY+ S + YG+ GSGK++TL G EDS
Sbjct: 110 VLKDIYDGYDVSIISYGEAGSGKSFTLFGNEDS 142

>TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.149
           YJL187C
          Length = 740

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%)

Query: 658 SENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKF 717
           S ++N++ +L+ D S   N L +  NE+ FK  HE+L   +    Y +++KS +  ++  
Sbjct: 234 SPSFNSIPQLMIDASPLINPLSEDDNERGFKVRHEKLPPQFHVSRYKKIKKSRNSVIMNN 293

Query: 718 NDLLES 723
           NDL  S
Sbjct: 294 NDLTNS 299

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 57  EFGMDHIFSSDVVQEQLYL-DSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSG 109
           EF +D +F     Q  L   D +K    +  +G+N S + +G++G+GK++T+ G
Sbjct: 50  EFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFG 103

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 16/64 (25%)

Query: 79  KPMFQDFIN----GYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEASRLSVGVIPRVLEEL 134
           +P+  D IN    G +CS + YG++ +GKT+ L  +              G+IP  +E+L
Sbjct: 66  EPLVIDNINELTRGVDCSMVTYGQSATGKTHVLFDQ------------VRGIIPLFIEQL 113

Query: 135 FDHL 138
           + +L
Sbjct: 114 YIYL 117

>TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {ON}
           Anc_2.597 YKL048C
          Length = 750

 Score = 35.4 bits (80), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 41/77 (53%)

Query: 476 VEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREH 535
           VE+   KK+IDE  + S  +R+    F + +  + +   ++  +   ++T++ K +++ H
Sbjct: 623 VELTPTKKIIDEGADYSPGIRQGLSLFNQFSRSEEMLPSTINSTPIQVHTHLAKHKQQAH 682

Query: 536 DLINSTDKLKETVNNMN 552
           ++  S  KL  + N MN
Sbjct: 683 NVFQSKSKLAHSKNVMN 699

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/112 (19%), Positives = 54/112 (48%), Gaps = 4/112 (3%)

Query: 56  REFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEE--DS 113
           + F    + +    + + + +    +  D ++G NC    YG   +  +  + G +  +S
Sbjct: 88  QSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGLAADSLVMFGPQSGNS 147

Query: 114 LLHSEASRLSVGVIPRVLEELFDHLSCNNI-DHVVKCSYVEIYNEELKDLLV 164
               ++SR S G++ +  + +F+ +  ++  ++ V  S  E+Y +++ DLLV
Sbjct: 148 KEEQDSSRCS-GLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDKVFDLLV 198

>KLTH0D15884g Chr4 complement(1313964..1315268) [1305 bp, 434 aa]
           {ON} weakly similar to uniprot|Q06671 Saccharomyces
           cerevisiae YLR431C ATG23 Peripheral membrane protein
           required for autophagy and for the cytoplasm-to-vacuole
           targeting (Cvt) pathway
          Length = 434

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 49/104 (47%), Gaps = 19/104 (18%)

Query: 723 SYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKN--- 779
           SYLE  + VL+ ++K+      +NE++     +  WE S+  I K + S      +N   
Sbjct: 273 SYLETKEDVLVADLKT-----FKNELHPAEHSRNTWEDSLSQISKLEASLKSILIRNPDT 327

Query: 780 --RV-------IVGKLQDTLKGTSESLFDTLSEMKSKINELQKA 814
             RV       +VG L+D   GTS SL      + S+I  L+KA
Sbjct: 328 PPRVLSTEINAVVGHLEDASSGTSSSLLKYC--LGSEIEVLKKA 369

>Suva_2.678 Chr2 (1203476..1205071) [1596 bp, 531 aa] {ON} YDR501W
           (REAL)
          Length = 531

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 9/86 (10%)

Query: 664 LAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFL-LKFNDLLE 722
           + E LS +++E  + K+   +K   NNH E+ +    +  H     SD+F+ +  N L  
Sbjct: 383 IKEPLSKITDESPSRKR---QKTLINNHSEIFQLLAKRGIH-----SDEFVHVLCNHLAF 434

Query: 723 SYLEGNKSVLLQNIKSATSEVIENEM 748
           S L+     +LQNI S TS++  NE+
Sbjct: 435 SNLQQTPLSVLQNINSITSQLSRNEL 460

>NDAI0A08230 Chr1 (1882144..1889643) [7500 bp, 2499 aa] {ON} Anc_3.211
            YBL004W
          Length = 2499

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 145  HVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRIV------DSGSPNVKNGANSNCNT 198
            +++  SY+E +   LKD L+  + SLL+++++ L I+      +   P  KN A    N 
Sbjct: 1880 NLMTVSYLEGFIPLLKDALLSDNESLLTSTLRVLVILVKLDFSEESEPIFKNCARKVLNI 1939

Query: 199  RDNSPLTSSK 208
              +SP TSS+
Sbjct: 1940 IKDSPTTSSE 1949

>AFR352C Chr6 complement(1073984..1075912) [1929 bp, 642 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR045C
           (SSC1) and YEL030W (ECM10)
          Length = 642

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 655 NSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFL 714
           +ST     NL  + +D S       ++IN KF +   E+L +  V KT   V+K+  D  
Sbjct: 293 SSTDATEINLPFITADASG-----PKHINMKFTRAQFEQLTEPLVKKTIDPVKKAMKDAG 347

Query: 715 LKFNDLLESYLEGNKS 730
           L  +D+ E  L G  S
Sbjct: 348 LSTSDVAEVILVGGMS 363

>Kwal_27.12622 s27 (1304495..1309786) [5292 bp, 1763 aa] {ON}
           YJL109C (UTP10) - Protein required for cell viability
           [contig 260] FULL
          Length = 1763

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 738 SATSEVIENEMNHFIPQKEKWEK-------SIELIEKSKHSSNEFKTKNRVIVGKLQDTL 790
           S+ S + E+ +  ++P++  WEK       S E  EK+  S    K K++VI+   ++ L
Sbjct: 681 SSYSTLFEDFIKDYLPKRASWEKRCLDNKTSFEKFEKAVVSIISTKEKSKVILDFAENAL 740

Query: 791 KGTSESLFDTLSE 803
           K T E L   +SE
Sbjct: 741 KSTHEQLAKLVSE 753

>CAGL0C03201g Chr3 (311804..321130) [9327 bp, 3108 aa] {ON} similar
           to uniprot|Q07878 Saccharomyces cerevisiae YLL040c VPS13
          Length = 3108

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 7/84 (8%)

Query: 444 VKSDLLST-KSKEGVYMSHEHYDVLTKD------LDKHKVEIMDLKKVIDELNEQSTTLR 496
           V SD++   K KE + MS E YD L  +       D++K+E+ D + ++      + +  
Sbjct: 699 VSSDVIPKEKIKEIIGMSPEDYDKLNPNDKNRLMFDRYKLELQDTQILVGANIHNTLSSL 758

Query: 497 KDKRAFEEVNEVQRIKLQSMRDSV 520
           KD  +FE ++ ++++KL  + DS+
Sbjct: 759 KDSESFENLSVLEKMKLVLVLDSL 782

>Smik_2.259 Chr2 (464023..464030,464121..465009) [897 bp, 298 aa]
           {ON} YBR119W (REAL)
          Length = 298

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 748 MNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTL 801
           + + IPQ+E  +K++E +E  K+SS      N+V++  +Q+   GT+E L   +
Sbjct: 195 LKNIIPQRETPKKALESLEPPKNSSTIENPPNKVLL--IQNLPSGTTEQLLSQI 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,923,527
Number of extensions: 4524007
Number of successful extensions: 22958
Number of sequences better than 10.0: 811
Number of HSP's gapped: 24015
Number of HSP's successfully gapped: 1218
Length of query: 962
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 843
Effective length of database: 39,836,145
Effective search space: 33581870235
Effective search space used: 33581870235
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)