Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.726.17ON69569533250.0
TPHA0J003106.17ON67570716110.0
TDEL0G045206.17ON67970515640.0
ZYRO0C07876g6.17ON68169915190.0
SAKL0E01100g6.17ON71073213970.0
Ecym_30216.17ON67471013231e-174
Skud_5.276.17ON61569913121e-173
ACR009W6.17ON68072513061e-171
KNAG0M011406.17ON59470912631e-166
Kwal_56.224116.17ON68970412671e-165
CAGL0L13288g6.17ON64669812461e-162
KLLA0D01067g6.17ON66070312461e-162
KLTH0C11308g6.17ON69071912491e-162
YEL062W (NPR2)6.17ON61550012321e-161
Smik_5.256.17ON61559312191e-159
NCAS0H008706.17ON61269912041e-157
TBLA0G010106.17ON71075811971e-154
NDAI0D008606.17ON66671011791e-152
Suva_5.56.17ON61935311351e-146
KAFR0L003806.17ON54069610731e-138
Ecym_11848.520ON1837117743.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.72
         (695 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...  1285   0.0  
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   625   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   607   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   589   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   542   0.0  
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   514   e-174
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   509   e-173
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   507   e-171
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   491   e-166
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   492   e-165
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   484   e-162
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   484   e-162
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   485   e-162
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   479   e-161
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   474   e-159
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   468   e-157
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   465   e-154
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   458   e-152
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    441   e-146
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   417   e-138
Ecym_1184 Chr1 complement(374705..380218) [5514 bp, 1837 aa] {ON...    33   3.2  

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score = 1285 bits (3325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/695 (92%), Positives = 641/695 (92%)

Query: 1   MVGFDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLL 60
           MVGFDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLL
Sbjct: 1   MVGFDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLL 60

Query: 61  TLKYGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQ 120
           TLKYGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQ
Sbjct: 61  TLKYGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQ 120

Query: 121 SQFLSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDS 180
           SQFLSKAEKDLAYFDFKAILHSSLDQDSKLKPEK                       TDS
Sbjct: 121 SQFLSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDS 180

Query: 181 KKNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFP 240
           KKNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFP
Sbjct: 181 KKNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFP 240

Query: 241 LLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLV 300
           LLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLV
Sbjct: 241 LLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLV 300

Query: 301 IECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXX 360
           IECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQ  
Sbjct: 301 IECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLP 360

Query: 361 XXXXXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHR 420
                           QNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHR
Sbjct: 361 LESLSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHR 420

Query: 421 SESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXXXX 480
           SESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNN       
Sbjct: 421 SESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKF 480

Query: 481 XXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDIK 540
                 NGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDIK
Sbjct: 481 IIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDIK 540

Query: 541 VGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLF 600
           VGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLF
Sbjct: 541 VGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLF 600

Query: 601 ESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRKQNEQILLEAL 660
           ESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRKQNEQILLEAL
Sbjct: 601 ESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRKQNEQILLEAL 660

Query: 661 ESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695
           ESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS
Sbjct: 661 ESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/707 (49%), Positives = 452/707 (63%), Gaps = 53/707 (7%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           FDGF PIH IFYSVFHPTEG KV Y+FPP+NL    INFD+I++YVIPKPQLC+KLLTLK
Sbjct: 5   FDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLTLK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           Y NYRI+GYPI IN S+YARNNFSFNLVFVFPYEC+TSPYE V+ +LGKMF  LE Q QF
Sbjct: 65  YNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQCQF 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQD-SKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSK- 181
           LSK EKD+AYFDFK ++ + +DQD S  +P+                        T+++ 
Sbjct: 125 LSKCEKDMAYFDFK-LISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTNTQD 183

Query: 182 ----KNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIK 237
               K   YLF KY  IQ ++ ND+   S+ D +MR++QDLN+YSEC IPID GNA+DIK
Sbjct: 184 KANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAIDIK 243

Query: 238 LFPLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDT 297
           LFP L PP  +IS+EDVPI  VNL +IIDVNWDPTMLKIVP+IDG+NSI KIA LS+SD 
Sbjct: 244 LFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNSDA 303

Query: 298 VLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLH 357
           +LVIECI+HF+YYGCV++SDIFQFSNIYAPTS + +FLTDP +ATECQ YVT PE S L 
Sbjct: 304 MLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDSLLS 363

Query: 358 -------QXXXXXXXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYS 410
                  +                   +LR++ N   S+A+SF+S  G   HN++++  +
Sbjct: 364 ALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLN---SKASSFISDEG--HHNDDTAYPN 418

Query: 411 RSDLYLNRHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEI 470
              +Y NR RSESS SS N ++++ N   LPT+STLFDLYRSLSQGV L+EWY+ NF  I
Sbjct: 419 HDSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSI 478

Query: 471 RNNXXXXXXXXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLS 530
           R+N               ++YRC S+P+  N+E  +K+   K++QN  +  K+K Q   +
Sbjct: 479 RDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQ-SYT 537

Query: 531 QDIFSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQE 590
            +IFSTSDIK G DL +   +++ TLD+D+AD VL NVYKKL+       S N       
Sbjct: 538 YNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSING------ 591

Query: 591 LEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRK 650
                     +  +P           SKV+F+   N  Y      +  N  I   +  R+
Sbjct: 592 ----------QGQHP-----------SKVAFK---NQSYDNDLPGLMNNLGIEATKFSRE 627

Query: 651 QN---EQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694
            N   +  LL+AL+S ENLD IC  LE  R EVE +L  L ++++IN
Sbjct: 628 ININDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIIN 674

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/705 (49%), Positives = 461/705 (65%), Gaps = 43/705 (6%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F+GF PIHTIFY+VFHPTEG KV Y+FPP NL++++INFD+I++Y+IPKPQLC+KLLTLK
Sbjct: 5   FEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKLLTLK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           Y NYRI  YP+T+N  IYARN FSFN VFVFPY+C+TSPYE  I +LGKMF+VLEEQ+  
Sbjct: 65  YKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEEQNLI 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSKAEKD  ++ FK +     DQD+K KPEK                        +  K+
Sbjct: 125 LSKAEKDPIFYHFKQV-EIKDDQDAKSKPEKGSH---------------------NLSKS 162

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
            +Y  EKY +I   + + +S FS++D ++R+YQDLNNYSECLIPID GNAVDIK+FP++ 
Sbjct: 163 QAYASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMT 222

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP + ISIEDVP+S VNL ++IDVNWDPTMLKIVP+I+G+NSI+KIAKLS SD  LVIEC
Sbjct: 223 PPNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIEC 282

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           IKH IYY CV+++DIFQFSNIYAPTS LR FLTD +++TECQ+YV   E STL +     
Sbjct: 283 IKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKR 342

Query: 364 XXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRG---ASSHNENSSLYSRSDLYLNRHR 420
                         +  +S+    SR  S +SS G    SS+NE  +L S   LY     
Sbjct: 343 VNHSATESVDHELADSHRSQRTSGSRTTS-MSSNGKFFPSSNNEMPALISEESLYRTGKH 401

Query: 421 SESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXXXX 480
           S+SS SS NTN  N   + LPT+S LFDLYRSLSQG +L+EWY  ++  IR N       
Sbjct: 402 SQSSFSSNNTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRF 461

Query: 481 XXXXXXNGLLYRCQSFPVTANFEEINKVKKF--KDIQNRKETRKDKLQKQLSQDIFSTSD 538
                 NGL+YRC S+P+  N E  +  K+   +DI N   T K    K  S++IFSTSD
Sbjct: 462 ITFGVINGLIYRCYSYPIMKNLEIFDLAKRLHREDISN--HTVKHNKAKNPSKNIFSTSD 519

Query: 539 IKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQEL-EKKSVQ 597
           IK G +    RN+  + L+LDIAD VL+NVYKKL++    +   N A     L  ++S+ 
Sbjct: 520 IKFGVEYERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLG 579

Query: 598 SLFESS--NPYS-KVPKRPGTLSKVSFQQNSNMQY----SASSGDVTENEDINNLEKLRK 650
           SL + S  N Y  +   RP   SKVSF +   + +     +SS D  + ++   LE  R+
Sbjct: 580 SLADGSTNNIYRLQNSDRP---SKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLE--RR 634

Query: 651 QNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695
           + + ILLE++E+ ++LD ICV LE  R +VE ++++L ++K+INS
Sbjct: 635 ERDLILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/699 (48%), Positives = 450/699 (64%), Gaps = 43/699 (6%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F+GF PIHT+FY+VFHPT+G +V Y++PP NL+  +INFD+I++Y+IPKPQLC+KLLTLK
Sbjct: 19  FEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKLLTLK 78

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           Y  YRI+ YP+T+N   YARN FSFN VFVFPY+C+TS YE  I +LGKMFRVLEEQ+Q 
Sbjct: 79  YKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEEQNQI 138

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSKAE D  YFDFK +  ++ +QD KL  EK                           K+
Sbjct: 139 LSKAENDPIYFDFK-LADNTTEQDGKLNAEKSFKGLT---------------------KS 176

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
                 KY EI + + +++SDFS+QD +MR++QDLNNYSECLIPID GNAVDIK+FPL  
Sbjct: 177 QGMALAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKT 236

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP + ISIEDVPIS VNLK IIDVNWDPTMLKIVP+IDG+NSI+KIAKLSDSD  LV+EC
Sbjct: 237 PPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLEC 296

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           +KH +YY CV+++DIFQFSNIYAPTSL+R FLTDP +A+ECQ++VT+   S+L +     
Sbjct: 297 VKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSE----- 351

Query: 364 XXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSR-SDLYLNRHRSE 422
                         ++ +SKN  +S + +   S  + S ++    YS   + Y    RS+
Sbjct: 352 --MPFERLRKFDLDDMDQSKNQ-ESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQ 408

Query: 423 SSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXXXXXX 482
           SS SS NTN  +   + LPT++ LFDLYR+LSQGVT++EWY  N+  I+ N         
Sbjct: 409 SSFSSTNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFIT 468

Query: 483 XXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKE-TRKDKLQKQLSQD--IFSTSDI 539
                GL+YRC SFPV       +   K     N  + T+K K QK L++   +FSTSD+
Sbjct: 469 FGVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDM 528

Query: 540 KVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSL 599
           K+GE      ++  Q   +DIAD VL+NVYKKL+  T E  S +    S+   ++S  SL
Sbjct: 529 KLGEG-----SKMHQNFSVDIADEVLRNVYKKLS-NTNEPGSRDDYPLSRIYREESHVSL 582

Query: 600 FESSNPYSKVPKRPGTLSKVSFQQNSN--MQYSASSGDVTENE-DINNLEKLRKQNEQIL 656
              S      PK+P  +SKV+F  N +  + YS S       E +   L++ +   + IL
Sbjct: 583 SALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIIL 642

Query: 657 LEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695
           LE++ + + LDKICV LEKPR EVEE+L  L D+K+INS
Sbjct: 643 LESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/732 (44%), Positives = 424/732 (57%), Gaps = 66/732 (9%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           FDGF PIHT+FYSVFHPTEG KV YQFPP NL+N  INFD+I++YVIPKPQLCNKLLT K
Sbjct: 5   FDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKLLTFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG YR+  YP+ +N S YARN+F+FN VFVFPY C TSPYE  + +LGKMFRVLEEQSQ 
Sbjct: 65  YGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEEQSQI 124

Query: 124 LSKAEKDLAYFDFKAILHSS------LDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXX 177
           LSKAE D  YF  K+   S+      +DQ    +P+                        
Sbjct: 125 LSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQ------------ 172

Query: 178 TDSKKNS-----SYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGN 232
            DSK+           EKY EI + +   +   SI+D I +LYQDLNNYSEC IPID+GN
Sbjct: 173 -DSKEQGKIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGN 231

Query: 233 AVDIKLFPLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKL 292
           +VDIKLFPLL PP + +S EDVPIS VNL ++IDVNWDPTMLKIVP I+GVNSIAKIAK 
Sbjct: 232 SVDIKLFPLLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKF 291

Query: 293 SDSDTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTV-- 350
           S SDT LVIEC+KH IYY CVV++DIFQFSNIYA TSL+  FLTDP +A+ECQTYVT   
Sbjct: 292 SSSDTDLVIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSD 351

Query: 351 -----------PESSTLHQXXXXXXXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGA 399
                      P   ++H                     +R S N    R  S       
Sbjct: 352 LELYRLPFESRPNLLSMHSSRKQNSSSTIHTV------GVRNSPN----RTNSLDYPSEL 401

Query: 400 SSHNENSSLYSRSDLYLNRHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTL 459
           S+   N S  S S L   R RS  S +    ++    +  LPT+S LFDLYRSL QG T+
Sbjct: 402 STRRNNFSSSSASSLMRVRDRSGQSTTGSAVDEQESRL-LLPTKSCLFDLYRSLHQGETV 460

Query: 460 KEWYKENFFEIRNNXXXXXXXXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKE 519
           KEWYK NF  IR+N              GL+YRC ++PV  N   +  +K  K   + + 
Sbjct: 461 KEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRS 520

Query: 520 TRKD---KLQKQLSQDIFSTSDIKVGEDLISGRN-----RRIQTLDLDIADSVLKNVYKK 571
            R+    + +K  + ++FST+DIKV  +   G        R  T ++D+A+ VLK+ YKK
Sbjct: 521 LRRKLKFREKKNFTNNVFSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKK 580

Query: 572 LTLKTEEENSSNRALNSQELEKKSVQSLFESSNPYSKVPKRPG--------TLSKVSFQQ 623
           L++    +++     N   + +       ESS   S+   R G        T SKV+F++
Sbjct: 581 LSIIESMDDNLYHVHNP--MSRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEK 638

Query: 624 NSNMQYSASSGDVTENEDINNLEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEM 683
             +             E+++NL K ++  E +LL++++S +  DKIC+ LEK R EVE++
Sbjct: 639 GRSPWQVEEDEKKERTEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQL 698

Query: 684 LKHLVDFKVINS 695
           LK +  + +INS
Sbjct: 699 LKEMGHYNIINS 710

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  514 bits (1323), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 310/710 (43%), Positives = 428/710 (60%), Gaps = 58/710 (8%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           FDGF PIH+IFYS+FHPTEG KV +QFPP++L+N  I+FD+I++YVIPKPQLCNKLLT K
Sbjct: 5   FDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKLLTFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG+YR++ YP+ IN S YARN+FSF+ VFVFPY+  TSPYE  I +LGKMFRVLEEQSQ 
Sbjct: 65  YGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEEQSQV 124

Query: 124 LSKAEKDLAYF-----DFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXT 178
           LSK E+D  Y+     D KA+  +S + +SK  P+                         
Sbjct: 125 LSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIR------------------ 166

Query: 179 DSKKNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKL 238
             + +  + FEKY EI + ++ +E   SI+D I +LY+DLNNYSECLIP+D+GNA+DIKL
Sbjct: 167 --RGHHEHAFEKYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKL 224

Query: 239 FPLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTV 298
           FPLL PP +  S+EDVPI+++NL + +DVNWDPTM+KIVP+I+G+NSIAKI+K SDSD  
Sbjct: 225 FPLLAPPNSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVG 284

Query: 299 LVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQ 358
           LV+EC+KH IYY CVV+ D+FQFSNIYAPTS L  FLTDP +A ECQ YV   E S LHQ
Sbjct: 285 LVMECVKHLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQ 344

Query: 359 XXXXXXXXXXXXXXXXXXQ---NLRKSKNGIDSRAASFVS-SRGASSHNENSSLYSRSDL 414
                                    K     + R  SF S +  A   N N+SL S   +
Sbjct: 345 LPFEGRPNANHSRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSI 404

Query: 415 YLNRHRSESSISSQNTNDLNGNV--KQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRN 472
                 + SS +S+  ++ N  +  + LPTRS LFDLYRSLSQG T+K+WYK NF  IR 
Sbjct: 405 ------THSSKNSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRK 458

Query: 473 NXXXXXXXXXXXXXNGLLYRCQSFPVTANFEEINKVKKF--KDIQNRKETRKDKLQKQLS 530
           N               L+YRC S+PV  +   ++ +K+F    + N   + K+      S
Sbjct: 459 NRIDVRRFITFGVFRKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKN----NNS 514

Query: 531 QDIFSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQE 590
            ++FST+DI V     S   ++    + D AD VL++ YKKL+L     N  ++   S++
Sbjct: 515 NNVFSTADICVDFGEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKK 574

Query: 591 LEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQ-----NSNMQYSASSGDVTENEDINNL 645
           L   S+++   ++    K+       +KV F       N + +Y   +   TE       
Sbjct: 575 L---SLENDASANVDNRKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTE------- 624

Query: 646 EKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695
            K ++Q + +LL+++++ ++ DKI + LE  + EVEE+LK   ++ +INS
Sbjct: 625 LKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  509 bits (1312), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 313/699 (44%), Positives = 403/699 (57%), Gaps = 95/699 (13%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL N+ INF++I++Y+IPKP LC+KL+T K
Sbjct: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLITFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG YRI+ YP+TIN  IYARN FSFN VFVFPY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 65  YGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQL 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSK+EKD  +FD KA+ +S++   +   P                         T  K  
Sbjct: 125 LSKSEKDAVFFDLKALENSTITPSTAGAP-----------TTSNPSSNTTPTYPTSDKDA 173

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
                 +Y ++ + +   ES FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 174 KDLRSSRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR 233

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP   +S+EDVP+S VNLK+IIDVNWDPTM+ IVP+IDG+NSIAKI+KLS SD  LVIEC
Sbjct: 234 PPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIEC 293

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           I+H IYY CV +SDIFQFSNIYAP+SL+R FLTD LMA++CQ+YV  PE S +       
Sbjct: 294 IRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK 353

Query: 364 XXXXXXXXXXXXXQNLRKSKNG-----IDSRAASFVSSRGASSHNENSSLYSRSDLYLNR 418
                           RKSK+       DSR  SF  S  +     +S   S S +  + 
Sbjct: 354 NLDSADRDSPSLFVR-RKSKSSSIPSNPDSRTTSF--SSNSKVSQNSSLNSSFSSVCKDW 410

Query: 419 HRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXX 478
            +S++S+SS N    +   + LPTRS LFDLYRSLSQG TLK WY+     ++ N     
Sbjct: 411 RQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVR 470

Query: 479 XXXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSD 538
                     ++YRC SFPV  N           D + RKE  +  L+  L+ D      
Sbjct: 471 RFITFGLERRIIYRCYSFPVMLNV----------DSRERKEMTRMILKDSLNDD------ 514

Query: 539 IKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQS 598
                                             +LK + +++S   + S+         
Sbjct: 515 ---------------------------------RSLKKKNQDASFSVVGSK--------- 532

Query: 599 LFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSAS--SGDVTENEDINNLEKLRKQNEQIL 656
              S  P +   +RP   SKVSF+    MQ + S  +G+ T       + KL  + E+IL
Sbjct: 533 --NSGQPNNVKSERP---SKVSFE----MQRAGSLATGEAT-------IPKLSDEEERIL 576

Query: 657 LEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695
             ++ S E+ D ICVLL K + EVE  L  L +FKVINS
Sbjct: 577 ENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  507 bits (1306), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 303/725 (41%), Positives = 415/725 (57%), Gaps = 89/725 (12%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           FDGF PIH IFY++FHPTEG KV +QFP ++L+   I FD+I++YVIPK QLCNKL+T K
Sbjct: 12  FDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVTFK 71

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           +G+YR++ YP+ I    YARN+FSFNLVFVFPY+  TSPYE  I +L KM RVLEEQSQ 
Sbjct: 72  FGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQSQM 131

Query: 124 LSKAEKDLAYFDFK-----AILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXT 178
           LSK E+D  Y+  K     A    + + DSK K                          +
Sbjct: 132 LSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKK-------------------S 172

Query: 179 DSKKNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKL 238
            ++ N++    KY EI + +++DE +  I+D I +LY+DLNNYSECLIP+D+GNA+DIKL
Sbjct: 173 RAQHNAT---TKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKL 229

Query: 239 FPLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTV 298
           FPLL PP + +S EDVPI++VNL  ++DVNWDPTMLKIVP I+G+NSIAKI+K SDS   
Sbjct: 230 FPLLTPPNSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVE 289

Query: 299 LVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQ 358
           LV+ECIKH +YY CV + D+FQFSNIYAPT+LLR+FL D ++  ECQ YV   E   +H+
Sbjct: 290 LVMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHR 349

Query: 359 XXXXXXXXXXXXXXXXXXQN----LRKSKNGIDSRAASFVS-------SRGASSHNENSS 407
                              N    LR++ +   +RA SF S       S G SS  + S 
Sbjct: 350 LPFESRPNGGHSRNQTASTNTVYTLRRTTST--NRADSFSSNAEFSQKSSGISSLAQ-SF 406

Query: 408 LYSRSDLYLNRHRSESSISSQNTNDLNGNVKQ-LPTRSTLFDLYRSLSQGVTLKEWYKEN 466
             S  D Y NR R           +L  N K+ LPTR  LFDLYRSL+QG TLKEWYK N
Sbjct: 407 TQSNKDYYYNRSR-----------NLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKAN 455

Query: 467 FFEIRNNXXXXXXXXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQ 526
           +  IR N             + L+YRC S+PV  +   +  +K+F  +     T  + + 
Sbjct: 456 YSAIRENQIDVRRLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVS----TTDNFIP 511

Query: 527 KQLSQ--DIFSTSDIKVGEDLISGRNRRIQTL--DLDIADSVLKNVYKKLTL-------- 574
              S   ++FSTSDI+V  D  S R+R I       D+A+ VL+  Y+KL++        
Sbjct: 512 TGTSAGNNVFSTSDIRVDFDG-SSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSI 570

Query: 575 ----KTEEENSSNRALNSQELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYS 630
               K  +  S N A       K+S+ +L                 ++++F   +     
Sbjct: 571 DPIAKGYQAPSDNEAAMKGTSRKQSMSTL---------------NTTRITFDIRNRHVSK 615

Query: 631 ASSGDVTENEDINNLEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDF 690
            +     +NEDI  L K ++  E +LL++++S ++ DKI V LE  + EVE +LK   ++
Sbjct: 616 DNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEY 675

Query: 691 KVINS 695
            ++NS
Sbjct: 676 NIVNS 680

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  491 bits (1263), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 296/709 (41%), Positives = 394/709 (55%), Gaps = 132/709 (18%)

Query: 1   MVGFDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLL 60
           M  F+GF PIHT+FY++FHPTEG KVCYQFPP NL +Y INFD+I++Y+IPKPQLC++LL
Sbjct: 2   MSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRLL 61

Query: 61  TLKYGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQ 120
           T+KYGNYRI+ YP+ +  S YARN F FN VFVFPYEC TSPYE  I +LGKMFRVLEEQ
Sbjct: 62  TMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEEQ 121

Query: 121 SQFLSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDS 180
           SQ LS+AE+D                DS  K +K                        +S
Sbjct: 122 SQVLSRAERD----------------DSLFKGDKLPFD-------------------NNS 146

Query: 181 KKNSSYLFEKYKEIQEFVSND---ESDF---SIQDFIMRLYQDLNNYSECLIPIDAGNAV 234
            KN + L        +  S D   E D    S+QD IMR+YQDLNNYSECLIPID GNA+
Sbjct: 147 AKNQAPLTHALISKTKSFSPDKKTEGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAI 206

Query: 235 DIKLFPLLRPPPAT-ISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLS 293
           DIK+FPL+ PP +  +SIEDVP+  V LK+IID+NWDPTM+ I+P I+GVNSI  IA+LS
Sbjct: 207 DIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLS 266

Query: 294 DSDTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPES 353
           DSD  LVIECIKH IYY CV+I+DIFQFSNIYAP+SL+  FLTDP MA +CQ YVT+P+S
Sbjct: 267 DSDPELVIECIKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKS 326

Query: 354 STLHQXXXXXXXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSD 413
           S L                     ++  S+N    ++ S  S+   S  + +    + S+
Sbjct: 327 SRL--------------IHMPLQTSVPGSRNNKHKKSNSLSSTGVLSWQSNSQYSNNSSE 372

Query: 414 LY--LNRHRSESSISSQNTNDL---NGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFF 468
            Y   N+ RSESS+SS+ T      + +    PTR  LFDLYRSLSQG+TL++WY  NF 
Sbjct: 373 FYSMSNKKRSESSLSSEGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFT 432

Query: 469 EIRNNXXXXXXXXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQ 528
            IR+N               ++YR  S+PV         ++K ++    K+  K K+ ++
Sbjct: 433 TIRSNYIDVRKFIQFGTIKKIIYRVLSYPV---------LEKRRNSIIAKQMGKSKMAEK 483

Query: 529 LSQD---IFSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRA 585
                   FSTSDIK                  D  D +  ++Y + +  + E+   N  
Sbjct: 484 APHSKNAFFSTSDIK-----------------FDDGDRLFNSLYARFSKVSFEKRRENAR 526

Query: 586 LNSQELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNL 645
                 E+KS  ++                                ++G   E   +   
Sbjct: 527 ------ERKSFDAV------------------------------GGTNGADKETMILTKE 550

Query: 646 EKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694
           EKL+      LL AL++ E+ DKICV L + R E+  ++  + +++VIN
Sbjct: 551 EKLQ------LLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  492 bits (1267), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/704 (40%), Positives = 402/704 (57%), Gaps = 33/704 (4%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           FDGF P+H I Y++FHPTEG KV +QFPP  L+   I FD+I++YVIPKPQLCNKLLT K
Sbjct: 5   FDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKLLTFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG++R++ YP+ +    YARN+FSF+ VFVFPY+C TSPYES I +LGKMF VLEEQSQ 
Sbjct: 65  YGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEEQSQI 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSKAE    YF              +LK                              ++
Sbjct: 125 LSKAENSHVYF--------------QLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSES 170

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
             Y FEKY EI + ++      S++D I ++Y+DLNNYSECLIPID+GNAVDIKLFPLL 
Sbjct: 171 HGYAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLS 230

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP + +S EDVP+  VNL ++IDVNWDPTMLKIVP+I+G NSIAK+AKLSDSD  LV+EC
Sbjct: 231 PPSSCLSFEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVEC 290

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           I+H +YY CV+++DIFQF NIYAPTS L  FLT+P +ATECQ YVT+ ES+ +       
Sbjct: 291 IRHLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER 350

Query: 364 XXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSES 423
                          +R S + +D +      S   SS         R+      H   S
Sbjct: 351 KPSRTTYNNIP----VRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSH--TS 404

Query: 424 SISSQNTNDLN-GNVKQ-------LPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXX 475
           SI   N +D + GN +          ++S LFD+YRSLSQG T+KEWYK +F +IR    
Sbjct: 405 SIQCHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARI 464

Query: 476 XXXXXXXXXXXNGLLYRCQSFPVTAN--FEEINKVKKFKDIQNRKETRKDKLQKQLSQDI 533
                      +GLLYRC SFP+  N  + E+ K     D  +  E +      + + ++
Sbjct: 465 DVRRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNV 524

Query: 534 FSTSDIKVGEDLISG--RNRRIQTL-DLDIADSVLKNVYKKLTLKTEEENSSNRALNSQE 590
            S ++I++G +  S   R RR     + D A+ +L +VY+KL L   +   S+++ N   
Sbjct: 525 LSAAEIRIGLESSSSKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMM 584

Query: 591 LEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRK 650
               +             V    G+ ++ +   +     ++++ +  +  ++  LE+ ++
Sbjct: 585 RMFGNCSDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKR 644

Query: 651 QNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694
           ++E +LL+++   EN DKIC  L + R EVE+ML+ L  + V++
Sbjct: 645 KDELLLLKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  484 bits (1246), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 303/698 (43%), Positives = 402/698 (57%), Gaps = 64/698 (9%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F+GF  IH+IFYS FHPTEG KV + FPP +L+N  INFDSI++YVIPK  LC++L+T K
Sbjct: 5   FEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLITFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YGNYRI  YP+T+N SIYARN FSFN VFVFP+ C+TSPYE  I +LGKMFRVLE Q+Q 
Sbjct: 65  YGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEIQNQI 124

Query: 124 LSKAEKDLAYFDFK-AILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKK 182
           LSK+E D   F+ K A  + ++D DS                             T  +K
Sbjct: 125 LSKSENDTIMFNLKSADKNFNIDNDSS----------------NYILGDDISSIMTTQQK 168

Query: 183 NSSYLFEKYKEIQEFVSN---DESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLF 239
                 +KY+ +   +SN     S+F+I D +MRLYQDLN YSECLIPID GNAVDIKLF
Sbjct: 169 ------DKYERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLF 222

Query: 240 PLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVL 299
           PLL PP   ISIE VPIS VNL +I+DVNWDP ML I+P+I+G+N+I +I++LS ++  L
Sbjct: 223 PLLTPPTPYISIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESL 282

Query: 300 VIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQX 359
           VIECI+H +YY C+V++DIF+FSN+YAPTS LR FL DP MATECQ+YV +P +S ++  
Sbjct: 283 VIECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMND- 341

Query: 360 XXXXXXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRH 419
                             ++    N + +   SF  +        +S   S+++ Y N+ 
Sbjct: 342 ---LSLYPHHGKHSAFNGDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKK 398

Query: 420 RSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXXX 479
           +SESSIS+ N+N+     K LPTRS LFDLYRSLSQG+TLKEWY +N   IR+N      
Sbjct: 399 QSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRR 458

Query: 480 XXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDI 539
                    ++YRC+++ V  + + +  + K  +++N      + + K  S  I S +  
Sbjct: 459 FITFGVLRRIIYRCETYSVINSTDHLQNLWKLNELEN--PISMENISKLQSNHIDSLA-- 514

Query: 540 KVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSL 599
                                AD  L N YKKL+LK      S  AL S      S    
Sbjct: 515 ---------------------ADEALMNAYKKLSLKVP----SKGALKSHNTSHSSFSLT 549

Query: 600 FESSNPYSKVPKRPGTLSKVSFQ---QNSNMQYSASSGDVTENEDINNLEKLRKQNEQIL 656
             +    +   KR   LSKVSF+   ++ N     S+      E     +KL K   +I+
Sbjct: 550 PTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQE--TTWKKLSKMQRRIM 607

Query: 657 LEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694
           L+AL   E LDKICVLLE PR  V  +L  L + K+IN
Sbjct: 608 LKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  484 bits (1246), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 299/703 (42%), Positives = 415/703 (59%), Gaps = 58/703 (8%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           FDGF PIHT+FY++FHPTEG KV +QFPPN+L+N  I+FD+I++Y+IPKPQLCNKLLT K
Sbjct: 5   FDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG YRI+ YP+ +N   YARN+F+FN VFVFPY+C TSPYE  I +LGKMF+VLEEQSQ 
Sbjct: 65  YGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEEQSQI 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSK+E++  YF  K+   ++ DQ +++                           TD K  
Sbjct: 125 LSKSEQNPVYFQLKSNDSNAADQSTEMG-------------------SITISEHTDIKST 165

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
                EKY EI + ++ ++    I+D +M+L+ DLNNYSECLIPID GN++DIKLFP+  
Sbjct: 166 GDD-GEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRT 224

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP + IS+EDVPI+ VNL +IIDVNWDPTM+KIVP+I+G+NS+A+IA  + SD  LV EC
Sbjct: 225 PPSSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQEC 284

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           IKH +YY CV++SDIFQFSNIYAPTS + NFLT+P +A  CQ +V   +  +L Q     
Sbjct: 285 IKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV---QGDSLKQSLLPF 341

Query: 364 XXXXXXXXXXXXXQNLRKSKNGIDSR------AASFVSSRGASSHNENSSLYSRSDLYLN 417
                        Q    S + + SR       A+  S+      + N    S +  Y  
Sbjct: 342 EGRPNNIYPTGRKQ---ASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFR 398

Query: 418 RHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXX 477
            H SE++  +   N +    + LPTRS LFDLY+SLSQG T+K+WYK+NF  IR+N    
Sbjct: 399 AHASENTSLATGENQMK---RILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDV 455

Query: 478 XXXXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTS 537
                      L+YR  S+P+  N    + +K         +  K       S++IFS +
Sbjct: 456 RKLIMFGITRRLIYRVNSYPIVKNVGTWDILKSL-----VSKEPKTHYGSGSSKNIFSAA 510

Query: 538 DIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQ 597
           DIKV    +  +    Q+  LD AD +LK++Y+KL+LK +  N+ ++     + +  S  
Sbjct: 511 DIKV----VDTKEEGNQSDKLDAADELLKSLYQKLSLKQDVPNTMSKFARYYD-DSPSNN 565

Query: 598 SLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINN-----LEKLRKQN 652
           +  ES++  S          KVSF   +  Q       VTE  D+ +     + K +K+ 
Sbjct: 566 AFTESTSRKSSSGSH----QKVSFDFGTAGQQKT----VTEVPDLGDGEKVEVWKKKKEE 617

Query: 653 EQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695
           E ILLE+L + E  DK+C  L+K R EVE +LK L  + ++NS
Sbjct: 618 ELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  485 bits (1249), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 303/719 (42%), Positives = 403/719 (56%), Gaps = 60/719 (8%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           FDGF P+H IFYSVFHPTEG KV +QFP   L+   I FD+I++YVIPKPQLCNKLLT K
Sbjct: 5   FDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKLLTFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG +R++ YP+ +    YARN+FSF+ VFVFPY+C TSPYE  I +LGKMF VLEEQSQ 
Sbjct: 65  YGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEEQSQI 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSKAE    YF  KA                                           +N
Sbjct: 125 LSKAENSSVYFQLKA--------------RNTQKHGNTETAKGTEQPSSLDIGEIAQPEN 170

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
             Y   KY EI + +       +I D I ++Y+DLN+YSECLIPID+GNAVDIKLFPLL 
Sbjct: 171 QGYASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLS 230

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP +  SIEDVPIS VNL ++IDVNWDPTMLKIVPHI+G+NSIAK+AK SDSD  LV+EC
Sbjct: 231 PPSSCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVEC 290

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           IKH IYY CV+++DIFQFSNIYA T+ L  FLT+P +A ECQ YV   ES+ L       
Sbjct: 291 IKHLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHL------P 344

Query: 364 XXXXXXXXXXXXXQNLR-KSKNG-IDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRS 421
                         N+R +S NG +D      +  +G  +    +S  S  D   N+H+ 
Sbjct: 345 NLPFERGPSRSGQGNIRDRSSNGTLD------ILRKGKQTPLRENSFNSGMDFLSNKHQH 398

Query: 422 -----ESSISSQNTND---------LNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENF 467
                 SSI   NT+D         L G +    ++S LFDLYRSL+QG T++EWYK +F
Sbjct: 399 TPQSRSSSIPYHNTSDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHF 458

Query: 468 FEIRNNXXXXXXXXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQK 527
            +IR               +GL+YR  S+PV  N      V+      + +  +   L K
Sbjct: 459 EKIRAARIDVRRFITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLK 518

Query: 528 --QLSQDIFSTSDIKVGED--LISGRNRRI-QTLDLDIADSVLKNVYKKLTL---KTEEE 579
             Q   ++ S +DI++G +      R+ ++ Q    D A+ VL +VY+KL L   KT+  
Sbjct: 519 TNQPLNNVLSAADIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHV 578

Query: 580 NSSNRALN---SQELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDV 636
              N  ++    +  E  +  S  ES+N      K     +KV+F     +  ++S+ + 
Sbjct: 579 AQGNNPISKVFGRNSEDSTDISTRESANSMGSDIK-----NKVAFDVRKTLA-TSSADER 632

Query: 637 TENEDINNLEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695
             +E + ++E+ R + E ILL+++ S  N DKIC LL K R  VE ML  L  + V++S
Sbjct: 633 RRSEILRSIEEKRNE-ELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  479 bits (1232), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 259/500 (51%), Positives = 327/500 (65%), Gaps = 13/500 (2%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL N+ INF++ ++Y+IPKP LC+KL+T K
Sbjct: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLITFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG YRI+ YP+TIN  IYARN FSFN VFVFPY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 65  YGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQL 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSK+E+D  +FD K +L +S    S   P                         T  K  
Sbjct: 125 LSKSERDPVFFDLK-VLENSTTTPSTAGPSSTPNPSSNTTPTHP----------TSEKDT 173

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
                 +Y ++ + +   +S FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 174 KDMRSSRYSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR 233

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP   +S+EDVP+S VNLK+IIDVNWDPTM+ IVP+IDG+NSIAKI+KLS+SD  LVIEC
Sbjct: 234 PPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIEC 293

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           I+H IYY CV +SDIFQFSNIYAP+SL+RNFLTDPLMA++CQ+YVT PE S +       
Sbjct: 294 IRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNK 353

Query: 364 XXXXXXXXXXXXXQNLRKSKNGIDSRA--ASFVSSRGASSHNENSSLYSRSDLYLNRHRS 421
                           +   + I S     +   S  +     +S   S S +Y +  +S
Sbjct: 354 SLGSGDQDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQS 413

Query: 422 ESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXXXXX 481
           ++S SS N + +N   + LPTRS LFDLYRSLSQG TLK WY+  +  ++ N        
Sbjct: 414 QTSCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFI 473

Query: 482 XXXXXNGLLYRCQSFPVTAN 501
                  ++YRC SFPV  N
Sbjct: 474 TFGLEKRIIYRCYSFPVMIN 493

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 51/88 (57%), Gaps = 16/88 (18%)

Query: 610 PKRPGTLSKVSFQQNSNMQY--SASSGDVTENEDINNLEKLRKQNEQILLEALESTENLD 667
           P+RP   SKVSF+    MQ   S ++G  T       + KL  + E IL E++ + E  D
Sbjct: 542 PERP---SKVSFE----MQRVSSLATGKST-------MPKLSDEEEGILEESIRNAETFD 587

Query: 668 KICVLLEKPRSEVEEMLKHLVDFKVINS 695
           KICVLL KP+ EVE  L  L +FKVINS
Sbjct: 588 KICVLLSKPKLEVESYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  474 bits (1219), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 275/593 (46%), Positives = 360/593 (60%), Gaps = 19/593 (3%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL N+ INF++I++Y+IPKP LC+KL+T K
Sbjct: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLITFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG YRI+ YP+TIN  IYARN FSFN VFVFPY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 65  YGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQL 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSK+EKD  +FD KA+ +S++   +   P                         T  K  
Sbjct: 125 LSKSEKDPVFFDLKALENSTIAPSTACPP-----------ATSNTSSNTTPTHPTSDKDA 173

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
                 +Y ++ +     ES FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 174 KDLRNSRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR 233

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP   +S+EDVP+S VNL++IIDVNWDPTM+ IVP+IDG+NSIAKI+KLS+SD  LVIEC
Sbjct: 234 PPTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIEC 293

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           I+H IYY CV +SDIFQFSNIYAP+S +RNFLTDPLMA +CQ YVT PE S +       
Sbjct: 294 IRHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNK 353

Query: 364 XXXXXXXXXXXXXQNLRKSKNGIDSRAA--SFVSSRGASSHNENSSLYSRSDLYLNRHRS 421
                           +   + I S     +   S  +     +S   S S  Y +  +S
Sbjct: 354 NLTSGDLDSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQS 413

Query: 422 ESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXXXXX 481
           ++S SS N +  N   + LPTRS LFDLYRSLSQG TLK WY+  +  I++N        
Sbjct: 414 QTSCSSSNIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFI 473

Query: 482 XXXXXNGLLYRCQSFPV--TANFEEINKVKKF--KDIQNRKETRKDKLQKQLSQDIFSTS 537
                  ++YR  S+PV  +    E  +      KD  N   + + K  +  S  I  + 
Sbjct: 474 TFGLEKRIIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEH-SFSIIRSK 532

Query: 538 DIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQE 590
           +  +  ++ SGR  ++ + D+  A S++        L  +EE     ++ S E
Sbjct: 533 NAVLFNNIKSGRPSKV-SFDMQKASSLITGESTIPKLSDDEERILEESVRSAE 584

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 51/84 (60%), Gaps = 13/84 (15%)

Query: 614 GTLSKVSFQQNSNMQYSAS--SGDVTENEDINNLEKLRKQNEQILLEALESTENLDKICV 671
           G  SKVSF    +MQ ++S  +G+ T       + KL    E+IL E++ S EN DKICV
Sbjct: 543 GRPSKVSF----DMQKASSLITGEST-------IPKLSDDEERILEESVRSAENFDKICV 591

Query: 672 LLEKPRSEVEEMLKHLVDFKVINS 695
           LL KP+ EVE  L  L +FK+INS
Sbjct: 592 LLGKPKLEVENYLNELGEFKIINS 615

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  468 bits (1204), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 299/699 (42%), Positives = 397/699 (56%), Gaps = 109/699 (15%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F+GF PIHTIFYS+FHPTEG KVCY+FPP NL N+ INFD+I++Y+IPK QLCN+LLT K
Sbjct: 12  FEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTFK 71

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           Y NYRI+ YPITIN   YARN FSFN VFVFPYEC+TSPYE  I +LGKMF++LEEQSQ 
Sbjct: 72  YENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQSQI 131

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSKAE D  YF    +     +  + + P+                         D+   
Sbjct: 132 LSKAENDPIYFKSDYV---PTEPTTTIIPQ-----------ISPSHRNKRNNDHNDNNDG 177

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
           S +  + + E ++ V+     FS+QD IMR+YQDLNNYSECLIPID GN ++IK+FPLL+
Sbjct: 178 SRFETDFFGEEEDGVTK----FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLK 233

Query: 244 PPP-ATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIE 302
           PPP   IS+EDVP+S +NL  +IDVNWDPTML IVP+I+GVN I+KIAKL+ +D +LVIE
Sbjct: 234 PPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIE 293

Query: 303 CIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXX 362
           CIKH +YY CV+I+DIFQFSN+YAPTSL+ +FLTD  MAT+CQ YV +P  S L      
Sbjct: 294 CIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSH---- 349

Query: 363 XXXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSE 422
                          N + S        +   S  G+ + +E+S + +     + +  + 
Sbjct: 350 --------LPFENNGNKQPSTPKHSRTTSLSSSMSGSVNSHEHSYMDT-----IQKSETS 396

Query: 423 SSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXXXXXX 482
            S+SS + N+ +  +  LPT++ LFDLYRSLS GVTL+ WY+ N   I  N         
Sbjct: 397 LSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIK 456

Query: 483 XXXXNGLLYRCQSFPVT--ANFEEINKVKKFKDI-QNRKETRKDKLQKQLSQDIFSTSDI 539
                GL+YRC S+P+    + E I ++++  DI  +R + R             S S  
Sbjct: 457 FGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRS------------SGSAA 504

Query: 540 KVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSL 599
           +      SG +    ++++D AD +LKNVYKKL                           
Sbjct: 505 RSNSGSGSGSSASPSSINVDGADELLKNVYKKLERH------------------------ 540

Query: 600 FESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLR-----KQNEQ 654
                            SKVSF             D  +NE +   EK R     K+   
Sbjct: 541 -----------------SKVSFM------------DKEKNESMKTDEKGRPSTMTKEERS 571

Query: 655 ILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVI 693
           +LL+++ES ENLDKICV L K R +VE  L  L ++K+I
Sbjct: 572 VLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  465 bits (1197), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 305/758 (40%), Positives = 426/758 (56%), Gaps = 120/758 (15%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F+GF PIHT+FYS+FHPTEG KV Y+FPP NL  Y+INFD+I++Y+IPKPQLC+KLLTLK
Sbjct: 5   FEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKLLTLK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG+YR++ YP+TIN S+YARN FSFN VFVFP  C+TSPYE +I +LGKMFRVLEEQ+Q 
Sbjct: 65  YGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEEQNQL 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LS+AE D  YFD    L SS +QDS +  +K                         SK+ 
Sbjct: 125 LSRAENDSVYFDNSHSLLSS-EQDSIMHQDKNTSILGFSRKRFSF-----------SKRP 172

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
           +     +Y +     +   S+FS+QD IMR++QDLNNYSECLIPID GN+VDIK+FP + 
Sbjct: 173 TDLSLSEYPD-----NESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMV 227

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP  +IS EDVP++ V+L  ++DVNWDPTMLKIVP ID +NSI++IA LS+SD   V+EC
Sbjct: 228 PPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVEC 287

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXXX 363
           I+H +YY  V++SDIFQF+NIYAPTS LR+FLTD  +AT+CQTYV +P++S   +     
Sbjct: 288 IRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLP--- 344

Query: 364 XXXXXXXXXXXXXQNLRKSKN-GIDSRAASFVSSRGASSHNENSSLYSRSDL-YLNRHRS 421
                          L KS N  +D  + S     G++ +  N  L +   L +   ++ 
Sbjct: 345 ---------------LEKSINTDLDEYSNS-----GSAIYPNNEILENDDRLRWPMYYKP 384

Query: 422 ESSISSQNTNDLNGNVKQ---LPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXX 478
            +S SS ++   +GN +    LPT+S LFDLYRSLSQG  L +WY E++  I  N     
Sbjct: 385 RNSQSSLSSGISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIR 444

Query: 479 XXXXXXXXNGLLYRCQSFPV----------------------------------TANFEE 504
                    GLLYRC + P+                                  TAN   
Sbjct: 445 RFITFGLVRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRF 504

Query: 505 INKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDIK----------------------VG 542
           +N +    DI + K+   D++    S  I  + D+                         
Sbjct: 505 LNSITD-SDIHDLKD---DEINNSGSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDAS 560

Query: 543 EDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLFES 602
           E L S   +R Q L+  IAD VL ++++KL    +   S         + K+   +  + 
Sbjct: 561 EHLFSPPPKR-QILNSGIADKVLSDIHRKLAKFDDTPRS--------PIVKRKEDTFRDF 611

Query: 603 SNPYSKVP-KRPGTLSKVSFQQNSNMQYSASSGD-----VTENEDINNLEKLRKQNEQIL 656
           SN  + V      T +KVSF  + +   + ++ D     +  ++DI   ++ +    ++L
Sbjct: 612 SNGSNIVGYGSSNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLL 671

Query: 657 LEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694
           LE+L   +N+DKIC+ L+KPR EVEE+L  + D+ +IN
Sbjct: 672 LESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  458 bits (1179), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 303/710 (42%), Positives = 403/710 (56%), Gaps = 76/710 (10%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F+GF PIHTIFYS+FHPTEG KV Y+FPP+NL    I+FD+I++Y+IPK QLCNKLLT K
Sbjct: 13  FEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLTFK 72

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           Y NYRI+ YPITIN   YARN FSFN VFVFPY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 73  YANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQNQI 132

Query: 124 LSKAEKDLAYF--DFKA-----ILHSSLDQDSK-----LKPEKX--XXXXXXXXXXXXXX 169
           LSKAE D  YF  D+       I+ ++ D D K     +K E                  
Sbjct: 133 LSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNRILE 192

Query: 170 XXXXXXXXTDSKKNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPID 229
                   ++S  N +     Y  I+++++N+ S  S+QD IMR+YQDLNNYSECLIPID
Sbjct: 193 ENSNSNSNSNSNSNGNENDNNYNTIEQYLNNN-SRISVQDLIMRIYQDLNNYSECLIPID 251

Query: 230 AGNAVDIKLFPLLRPPPA-TISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAK 288
            GN VDIK+FPLL+PPPA ++SIEDVP+S V+L +I DVNWDPTMLK++P I+G+N I+K
Sbjct: 252 DGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDISK 311

Query: 289 IAKLSDSDTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYV 348
           I+KLS+S  +LVIECIKH IYY CV+I+DIFQFSN Y+ TSL+  FLTDP MAT CQ YV
Sbjct: 312 ISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQNYV 371

Query: 349 TVPESSTLHQXXXXXXXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSL 408
            +P  S L +                   +  + +    S  +S  S+ G SS       
Sbjct: 372 VLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEK-TPSFGSSITSNNGRSS------- 423

Query: 409 YSRSDLYLNRHRSESSISSQNTNDLNGNV--KQLPTRSTLFDLYRSLSQGVTLKEWYKEN 466
           +S  D    R +SE+S++S N    +  +    LPT+ +LF+LYRSL+Q   LK WYK N
Sbjct: 424 FSADD----RKQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNWYKLN 479

Query: 467 FFEIRNNXXXXXXXXXXXXXNGLLYRCQSFP--VTANFEEINKVKKFKDIQNRKETRKDK 524
           +  I  N              GL+YRC S+P  +T         K      +        
Sbjct: 480 YTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITPVVSAPESAKSTSPFVSSSGISSSV 539

Query: 525 LQKQLSQDIFSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNR 584
             KQ +Q    +    +G  + S   R       D  D ++K+ Y+KL            
Sbjct: 540 DSKQHTQKGPISRFPGLGSHVPSSGVR-------DTRDKLMKSFYEKL------------ 580

Query: 585 ALNSQELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINN 644
                           E    +SKV        K++FQ + N  +SA+S D   N+D + 
Sbjct: 581 ----------------EKGKNHSKV----SFSDKIAFQNDEN-DHSATSSD---NDDKSK 616

Query: 645 LEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694
            +   KQ   ILL+++ + +N+DKICV L +PRS++EE L    D+KVIN
Sbjct: 617 SQLTLKQ-RNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  441 bits (1135), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 220/353 (62%), Positives = 268/353 (75%), Gaps = 6/353 (1%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL ++ INF++I++Y+IPKP LC+KL+T K
Sbjct: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKLITFK 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           YG YRI+ YP+TIN  IYARN FSFN VFVFPY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 65  YGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQL 124

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
           LSK+E+D  +FD KAI      ++S L P                             ++
Sbjct: 125 LSKSERDPVFFDLKAI------ENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRS 178

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
           + +  EKY +I + +   ES FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 179 NRFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLR 238

Query: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303
           PP   +S+EDVP+S VNLK+IIDVNWDPTM+ IVP+IDG+NSIAKI+K S SD  LVIEC
Sbjct: 239 PPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIEC 298

Query: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTL 356
           I+H IYY CV +SDIFQFSNIYAP+SL+RNFLTDPLMAT+CQ+YVT PE S L
Sbjct: 299 IRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKL 351

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 11/80 (13%)

Query: 617 SKVSFQ-QNSNMQYSASSGDVTENEDINNLEKLRKQNEQILLEALESTENLDKICVLLEK 675
           SKVSF+ Q +N   S ++G        N + KL  + ++IL +++ S EN DKICVLL K
Sbjct: 550 SKVSFEMQRAN---SLATGK-------NKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599

Query: 676 PRSEVEEMLKHLVDFKVINS 695
            + EVE  L  L +FKVINS
Sbjct: 600 SKQEVENYLSELGEFKVINS 619

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  417 bits (1073), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 272/696 (39%), Positives = 370/696 (53%), Gaps = 164/696 (23%)

Query: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63
           F+GFEPIHTIF+S+FHPTEG KVCYQFPP NL  Y+INFDSI+++VIPKPQLC++LLTL+
Sbjct: 5   FEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRLLTLE 64

Query: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123
           Y NYR++ YP+ ++ S YARN FSFN VF+F Y+C+T PYE  I +LGK           
Sbjct: 65  YKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGK----------- 113

Query: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKXXXXXXXXXXXXXXXXXXXXXXXTDSKKN 183
                           +  +L++ S++                             SK  
Sbjct: 114 ----------------MFKTLEEQSQIL----------------------------SKSQ 129

Query: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243
            +  F K  E  +FV   ++ FSIQD +MRLYQDLNNYSECLIPID GN ++IK+FP+L+
Sbjct: 130 RTSAFFKDGEDVDFV---DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLK 186

Query: 244 PPPAT-ISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIE 302
           PP +  ISIEDVP+S VNL +I+D+NWDPTML I+P IDGVNSI  I+ LSDSD  LVIE
Sbjct: 187 PPTSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIE 246

Query: 303 CIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQXXXX 362
           CIKH IYY CV+I+DIFQFSNIYAP+SL+ NFL DP++A  CQ+YV +P  S ++     
Sbjct: 247 CIKHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKIND---- 302

Query: 363 XXXXXXXXXXXXXXQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSE 422
                         +   +  N   ++ A   S    SS+  + S Y+R     + H+S 
Sbjct: 303 ---------LPLASEQDDEINNSDMTQKALSSSRSSFSSYFSHKSAYARVSETAHHHQST 353

Query: 423 SSISS---QNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNXXXXXX 479
           S++SS   Q  N   G V  LP++ TLFDLYRSL+ G T++ WYK+NF  I+ N      
Sbjct: 354 STLSSSEGQQDNPRQGQV--LPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRK 411

Query: 480 XXXXXXXNGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDI 539
                  N ++YR   +P+  +  +  K     D QN      DK+       + STSDI
Sbjct: 412 FIKFGVINKIIYRVHQYPIMEH--KTFKSPLLSDRQN------DKI-------VLSTSDI 456

Query: 540 KVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSL 599
           K                  D+ D +L ++Y K                            
Sbjct: 457 K-----------------FDVGDRILNSIYNK---------------------------- 471

Query: 600 FESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRKQNEQILLEA 659
                           LSKV+F ++  ++             I N   L +  + IL  A
Sbjct: 472 ----------------LSKVTFDRDKKLE-----------SKIGNSRNLGESEKNILFNA 504

Query: 660 LESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695
           LE  E+ D+IC  L K ++EVE ++  + ++  INS
Sbjct: 505 LERHESFDRICSKLGKSKNEVESIISEIGEYMTINS 540

>Ecym_1184 Chr1 complement(374705..380218) [5514 bp, 1837 aa] {ON}
            similar to Ashbya gossypii ADR051C
          Length = 1837

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 12/117 (10%)

Query: 242  LRPPPATISIEDVP-ISRVNL----KEIIDVNWDPTMLKIVPHIDGVN-SIAKIAKLSDS 295
             RP P  ++    P  +RV+        I   +DPT+ K++ H    N +I K+AK  D 
Sbjct: 980  FRPSPGLLTEVQFPKWARVDTWISKGTRISAEYDPTLAKVIVHAKDRNEAILKMAKALDE 1039

Query: 296  DTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDP--LMATECQTYVTV 350
              V++  CI +  Y   ++ S++F+ + +   T +L ++   P  +  T    Y TV
Sbjct: 1040 --VVIQGCITNIDYLRSIITSEMFKTAKV--ATKVLDSYAYKPRAIEITSPGAYTTV 1092

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,030,544
Number of extensions: 3231948
Number of successful extensions: 17786
Number of sequences better than 10.0: 300
Number of HSP's gapped: 18726
Number of HSP's successfully gapped: 334
Length of query: 695
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 578
Effective length of database: 40,065,477
Effective search space: 23157845706
Effective search space used: 23157845706
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)