Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.703.188ON61761731330.0
KLTH0G16038g3.188ON60962715590.0
Kwal_56.231173.188ON60761414910.0
SAKL0C10472g3.188ON60862514790.0
NCAS0E015903.188ON60851614460.0
TBLA0F007403.188ON65352514340.0
Smik_2.1343.188ON59762014140.0
YBR015C (MNN2)3.188ON59762314140.0
KAFR0C008703.188ON61263214140.0
Suva_2.1423.188ON60362514110.0
ZYRO0A04950g3.188ON61851714030.0
KLLA0E17755g3.188ON63851414010.0
TDEL0D043303.188ON59862413920.0
NCAS0A03650singletonON60761413910.0
Skud_2.1273.188ON59662313890.0
AER018C3.188ON60661413770.0
TPHA0A043803.188ON64252113561e-180
Ecym_53143.188ON61551713431e-179
KNAG0K012903.188ON61152013221e-175
NDAI0G017903.188ON60762313071e-173
TPHA0C04560singletonON57351712961e-172
NDAI0A065003.188ON63752412691e-167
CAGL0I04532g3.188ON61252412641e-167
KAFR0E01030singletonON64062612651e-166
Kpol_1036.503.188ON67652012681e-166
KNAG0K01300singletonON59762412261e-161
Kwal_33.136931.150ON55852410411e-134
KAFR0G002801.150ON57953210341e-133
ZYRO0D17160g1.150ON5795269831e-125
Kpol_2002.571.150ON6055329811e-124
NDAI0A007801.150ON5875109781e-124
NCAS0B084501.150ON5865349741e-124
SAKL0C04598g1.150ON6115269461e-119
TBLA0D030301.150ON6055329311e-117
KLTH0F03938g1.150ON5625419251e-117
TPHA0E034801.150ON7095379121e-113
YJL186W (MNN5)1.150ON5865328901e-111
KNAG0C009001.150ON6235218901e-111
Skud_10.311.150ON5865418841e-110
Smik_10.461.150ON5865428781e-109
KLLA0C16467g1.150ON6075328661e-107
Suva_6.2661.150ON5865408601e-107
CAGL0M02871g1.150ON6005398611e-107
AEL148W1.150ON5734668281e-102
SAKL0H22616gsingletonON7415858411e-102
Ecym_81281.150ON5925298121e-99
KLLA0F24574gna 1ON7116087694e-92
TBLA0J011901.150ON6164567608e-92
TDEL0C03020na 2ON6605887631e-91
ZYRO0F13244gna 2ON6646047612e-91
KLTH0C08976gna 1ON7026007591e-90
TBLA0A002703.188ON9575487258e-84
Kwal_56.22779na 1ON6955966261e-71
SAKL0C08888gna 1ON6795996172e-70
Ecym_3545na 1ON6705525743e-64
CAGL0L08096g1.150ON5644915314e-59
AEL082Wna 1ON6815954724e-50
CAGL0C04004gsingletonON6321701271e-06
Suva_5.322na 3ON5532591243e-06
NDAI0H012707.123ON6562891191e-05
SAKL0D15180gsingletonON5772451126e-05
CAGL0H09240gsingletonON6422471119e-05
CAGL0C03938gsingletonON6372851119e-05
Kwal_23.2926na 4ON5682431111e-04
CAGL0C04026gsingletonON6361501101e-04
KNAG0G01070singletonON6322661082e-04
Kwal_55.209847.123ON6193031082e-04
Smik_9.1807.123ON6301651073e-04
TDEL0B00160singletonON5623661064e-04
TPHA0H00240singletonON829281960.006
Smik_7.4na 3ON562196960.006
KNAG0G010607.123ON694229960.006
CAGL0C03894g7.123ON627253950.007
NCAS0F007807.123ON639172940.010
CAGL0C03960gsingletonON623260940.011
TPHA0L008207.123ON730198930.013
Skud_7.10na 3ON566262920.018
CAGL0C03916gsingletonON628259920.018
AEL345WsingletonON645154900.033
Kpol_298.4singletonON631254870.078
Suva_14.418na 5ON580255860.082
Kwal_23.5454singletonON583274860.095
Smik_14.393na 5ON580248850.10
AFL235WsingletonON381175850.11
CAGL0C03982gsingletonON629254840.14
CAGL0C04048gsingletonON620300840.16
KAFR0K01260singletonON628175830.18
Skud_14.395na 5ON580248830.19
ABR245CsingletonON641297830.20
KLTH0G07986gna 4ON569166820.25
NCAS0I004807.123ON657252820.27
YGL257C (MNT2)na 3ON558233810.32
AAR183CsingletonON64865810.32
TDEL0H032607.123ON641207810.33
KNAG0E03170singletonON746132810.36
KNAG0D05360singletonON533138800.43
YIL014W (MNT3)7.123ON630169790.53
Skud_9.1587.123ON629167790.55
YER001W (MNN1)na 6ON762278780.87
YLR174W (IDP2)1.396ON412123771.0
CAGL0H09262gsingletonON625175761.3
TBLA0C06250singletonON736176751.7
Suva_10.2711.396ON412129751.7
TDEL0F05640singletonON554174751.8
SAKL0H13288g8.415ON88448751.8
NDAI0A085507.123ON664200752.0
Suva_9.1917.123ON625298742.4
SAKL0D08426g1.396ON411123742.4
Skud_12.2391.396ON412123742.4
KLLA0E09813gsingletonON746251742.4
Smik_12.2351.396ON412123732.6
ZYRO0G04048g7.123ON64151732.9
Skud_5.100na 6ON762263733.0
TPHA0F00700singletonON856185733.7
TBLA0G03680singletonON751274724.5
Ecym_13061.396ON415123705.8
KNAG0I013201.396ON412131706.1
Suva_5.87na 6ON766286716.4
TBLA0A011607.123ON66364706.9
KLLA0F21758g5.383ON157287707.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.70
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa] ...  1211   0.0  
KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} simi...   605   0.0  
Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {...   578   0.0  
SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} simila...   574   0.0  
NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188    561   0.0  
TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.1...   556   0.0  
Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON...   549   0.0  
YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}  ...   549   0.0  
KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {O...   549   0.0  
Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON...   548   0.0  
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...   545   0.0  
KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]...   544   0.0  
TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {O...   540   0.0  
NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {O...   540   0.0  
Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON...   539   0.0  
AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON} S...   535   0.0  
TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.1...   526   e-180
Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}...   521   e-179
KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON}             513   e-175
NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188    508   e-173
TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON}              503   e-172
NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa] ...   493   e-167
CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} simila...   491   e-167
KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON}              491   e-166
Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa] ...   493   e-166
KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON}             476   e-161
Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186...   405   e-134
KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150...   402   e-133
ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]...   383   e-125
Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON} (1291...   382   e-124
NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150    381   e-124
NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa] ...   379   e-124
SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} simila...   369   e-119
TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {O...   363   e-117
KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} simila...   360   e-117
TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {O...   355   e-113
YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}  MNN5Alpha-1...   347   e-111
KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.1...   347   e-111
Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W (...   345   e-110
Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W (...   342   e-109
KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} simi...   338   e-107
Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON...   335   e-107
CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} simil...   336   e-107
AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic ho...   323   e-102
SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]...   328   e-102
Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}...   317   1e-99
KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]...   300   4e-92
TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {...   297   8e-92
TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON}              298   1e-91
ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} simi...   297   2e-91
KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly...   296   1e-90
TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}...   283   8e-84
Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {...   245   1e-71
SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly...   242   2e-70
Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {O...   225   3e-64
CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa] ...   209   4e-59
AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-synteni...   186   4e-50
CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {...    54   1e-06
Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C ...    52   3e-06
NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123     50   1e-05
SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]...    48   6e-05
CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {...    47   9e-05
CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {...    47   9e-05
Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}...    47   1e-04
CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {...    47   1e-04
KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {O...    46   2e-04
Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {...    46   2e-04
Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W ...    46   3e-04
TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON}                 45   4e-04
TPHA0H00240 Chr8 (40339..42828) [2490 bp, 829 aa] {ON}                 42   0.006
Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL2...    42   0.006
KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {O...    42   0.006
CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {...    41   0.007
NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123     41   0.010
CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {...    41   0.011
TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {...    40   0.013
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    40   0.018
CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {...    40   0.018
AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic ho...    39   0.033
Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON} (12426..14...    38   0.078
Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059...    38   0.082
Kwal_23.5454 s23 (1171360..1173111) [1752 bp, 583 aa] {ON} YGL25...    38   0.095
Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059...    37   0.10 
AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homol...    37   0.11 
CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {...    37   0.14 
CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {...    37   0.16 
KAFR0K01260 Chr11 complement(261190..263076) [1887 bp, 628 aa] {...    37   0.18 
Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059...    37   0.19 
ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON} N...    37   0.20 
KLTH0G07986g Chr7 complement(646652..648361) [1710 bp, 569 aa] {...    36   0.25 
NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON}                 36   0.27 
YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}  MN...    36   0.32 
AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON} N...    36   0.32 
TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {O...    36   0.33 
KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {O...    36   0.36 
KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON}               35   0.43 
YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}  MNT3Alpha-...    35   0.53 
Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W ...    35   0.55 
YER001W Chr5 (153520..155808) [2289 bp, 762 aa] {ON}  MNN1Alpha-...    35   0.87 
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    34   1.0  
CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {...    34   1.3  
TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON}             33   1.7  
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    33   1.7  
TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa] ...    33   1.8  
SAKL0H13288g Chr8 complement(1140503..1143157) [2655 bp, 884 aa]...    33   1.8  
NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa] ...    33   2.0  
Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W ...    33   2.4  
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    33   2.4  
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    33   2.4  
KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} simila...    33   2.4  
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    33   2.6  
ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {...    33   2.9  
Skud_5.100 Chr5 (150236..152524) [2289 bp, 762 aa] {ON} YER001W ...    33   3.0  
TPHA0F00700 Chr6 (158182..160752) [2571 bp, 856 aa] {ON}               33   3.7  
TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {O...    32   4.5  
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    32   5.8  
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    32   6.1  
Suva_5.87 Chr5 (129322..131622) [2301 bp, 766 aa] {ON} YER001W (...    32   6.4  
TBLA0A01160 Chr1 complement(267341..269332) [1992 bp, 663 aa] {O...    32   6.9  
KLLA0F21758g Chr6 complement(2023805..2028523) [4719 bp, 1572 aa...    32   7.8  

>Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa]
           {ON} complement(162610..164463) [1854 nt, 618 aa]
          Length = 617

 Score = 1211 bits (3133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/617 (95%), Positives = 590/617 (95%)

Query: 1   MVSNRRFSKLFKVSLVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXXX 60
           MVSNRRFSKLFKVSLVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIG       
Sbjct: 1   MVSNRRFSKLFKVSLVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGSLTGSST 60

Query: 61  XXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRSA 120
                      NDDNKETQLE         ELNFVQMEEKRLRENMKTFYSKVYDLLRSA
Sbjct: 61  DTASSSSSTTTNDDNKETQLEDADDDDDDDELNFVQMEEKRLRENMKTFYSKVYDLLRSA 120

Query: 121 GPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYI 180
           GPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYI
Sbjct: 121 GPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYI 180

Query: 181 DGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDEL 240
           DGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDEL
Sbjct: 181 DGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDEL 240

Query: 241 CNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKN 300
           CNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKN
Sbjct: 241 CNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKN 300

Query: 301 IDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTED 360
           IDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTED
Sbjct: 301 IDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTED 360

Query: 361 LKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
           LKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS
Sbjct: 361 LKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420

Query: 421 GEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKTF 480
           GEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKTF
Sbjct: 421 GEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKTF 480

Query: 481 IEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDLM 540
           IEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDLM
Sbjct: 481 IEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDLM 540

Query: 541 QDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKY 600
           QDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKY
Sbjct: 541 QDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKY 600

Query: 601 IKDRHIFMEKTHEEHFS 617
           IKDRHIFMEKTHEEHFS
Sbjct: 601 IKDRHIFMEKTHEEHFS 617

>KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 609

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/627 (48%), Positives = 412/627 (65%), Gaps = 45/627 (7%)

Query: 5   RRFSKLFKVSLVL-VAVLTFVILRHHKD------ETAKVLQNYTDAVSSYIGDSIGXXXX 57
           +RF+K+F+ SLV  +  L FV+   + D      E  + LQNY +  S            
Sbjct: 6   KRFNKIFRFSLVAALCCLIFVLSTRYIDQDLSSLEYVRYLQNYHETYSG----------- 54

Query: 58  XXXXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELN------FVQMEEKRLRENMKTFYS 111
                         N +  E ++E         ++        +  ++++ R+ ++ FY 
Sbjct: 55  --------------NGNKVEPEVETPPAPAANDKIKSPSGGPVLSAQDQKRRQALQEFYK 100

Query: 112 KVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAM 171
           +V+  LR   P G+S R+Y + C L+ DIG R ND + W+ LT  NL  CL++  +   M
Sbjct: 101 QVFKNLRQHSPTGSSSRQYDEKCQLNGDIGARANDYNSWSKLTSKNLGNCLKLSNKEKTM 160

Query: 172 LKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIP 231
           LK +H  +++ LK L      Y GDGIV V GGKFS+LS L+IKT+RNL  +LP+EVFIP
Sbjct: 161 LKETHYDFVESLKSLVLPKGTYKGDGIVTVGGGKFSMLSFLIIKTLRNLGTHLPVEVFIP 220

Query: 232 PMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLL 291
           P DEG++E CNTLLPKYNAKCI++SD LPED I E+    GYQ K ++I ASSF+N+LLL
Sbjct: 221 PNDEGEEEFCNTLLPKYNAKCIYISDVLPEDII-ENFDFKGYQFKSISIIASSFENLLLL 279

Query: 292 DADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDI 351
           DADN+PIK +D+IF  EPY S G++ WPD+WRR+T+P+YY+I D  ++  +RVRN +DDI
Sbjct: 280 DADNFPIKALDNIFEEEPYKSTGMVLWPDFWRRTTNPAYYEIADIAVNYKKRVRNCMDDI 339

Query: 352 TPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWY 411
           TPP  YT+D+KN +++P+HD EGT+PDVSTESGQLMI K +HL ++LL++YYN+ GP WY
Sbjct: 340 TPPQAYTKDMKNLENVPLHDLEGTIPDVSTESGQLMIRKSRHLPTILLSLYYNVNGPTWY 399

Query: 412 YPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVAMFQHDFIQ 469
           YPI +QKASGEGDKETFIA ANF+ LPFYQVK     DGY +P   G+RGVAM QHDF+Q
Sbjct: 400 YPIFSQKASGEGDKETFIAAANFYGLPFYQVKSVTAVDGYHQPDNKGFRGVAMLQHDFVQ 459

Query: 470 DYTAYENAKTFIEKKYPNTKQD--KIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPK 527
           DY+ Y+ AK+ IE KY        K D  YSP      +FE E    V D+MFVH++LPK
Sbjct: 460 DYSRYKWAKSDIENKYAGKVPQFIKQDTSYSPDAMYKTYFEPEDLKEV-DIMFVHSNLPK 518

Query: 528 FEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKL 587
           F+P  LW + DL+ DG H+RSYT   +LN+YDLE+ENFK  +E LC+ +  +FKYL D L
Sbjct: 519 FDPYTLWNDKDLIVDGKHIRSYTNLRRLNNYDLELENFKVFKEYLCVSRT-KFKYLDDSL 577

Query: 588 SDDKEKWQGLCKYIKDRHIFMEKTHEE 614
             D+ +W+ +C YIK+R  F+++TH +
Sbjct: 578 QGDERQWKSMCGYIKERLNFLDQTHSD 604

>Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 183] FULL
          Length = 607

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/614 (47%), Positives = 397/614 (64%), Gaps = 23/614 (3%)

Query: 4   NRRFSKLFKVSLVL-VAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXXXXX 62
            +RFSK+FK+SLV  +  L F+    + D+    L+ Y   V +++ D+           
Sbjct: 5   TKRFSKIFKLSLVAALCCLAFMFSTKYFDKDLTSLE-YGKLVDTFMADAGYGKDAQEVAG 63

Query: 63  XXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRSAGP 122
                    N      ++                  EKR +  M+ FY+ V++ L+   P
Sbjct: 64  SSSDGTADNNGIGAGAKVS-------------TSSNEKR-KIAMRKFYTDVFNSLKKHSP 109

Query: 123 EGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYIDG 182
            G S R+YG  C L  DIG R +D   W+ LT  NL +CL + ++   MLK  HR Y++ 
Sbjct: 110 TGVSKREYGAQCKLSGDIGARADDYDNWSKLTSKNLGQCLIVSDKEKRMLKEKHRGYVES 169

Query: 183 LKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCN 242
           L+ L      Y GDGIV V GGKFS+L+ L+IKT+RNL  +LP+EVFIPP DEG+   CN
Sbjct: 170 LESLVLPKGAYKGDGIVTVGGGKFSMLAFLIIKTLRNLHTSLPVEVFIPPADEGETFFCN 229

Query: 243 TLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNID 302
            LLP+YNAKCI++SD LP++ I ++ +  GYQ K +AI ASSF N+LLLDADN+PIK++D
Sbjct: 230 ELLPQYNAKCIYISDVLPQEII-DNFEFKGYQFKSIAIIASSFDNLLLLDADNFPIKDLD 288

Query: 303 DIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLK 362
           ++F  EPY S+G++ WPD+WRR+T+P YYDI D +++  +RVRN +DD+TPP+VYT+D+ 
Sbjct: 289 NVFNEEPYKSKGMVLWPDFWRRTTNPIYYDIADIEVNYKKRVRNCMDDVTPPAVYTKDMS 348

Query: 363 NHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGE 422
           +  ++P+HD EGT+PDVSTESGQLMI K  HL ++LL++YYN+ GP+WYYPI +QKASGE
Sbjct: 349 DLSNVPLHDLEGTIPDVSTESGQLMIRKSDHLGTILLSLYYNVNGPSWYYPIFSQKASGE 408

Query: 423 GDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVAMFQHDFIQDYTAYENAKTF 480
           GDKETFIA ANF++LPFYQVK     DGY +P   G+RGVAM QHDF+QDY     A+  
Sbjct: 409 GDKETFIAAANFYDLPFYQVKSVTAVDGYHQPHDKGFRGVAMLQHDFVQDYGRQMWAQVE 468

Query: 481 IEKKYP--NTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEEND 538
           I   +   +T+  K D  YSP     KFF D++     D+MFVH++LPKF+P  LW + D
Sbjct: 469 IRSHFAGKDTQYAKYDPSYSPDAVYKKFFSDDNIGET-DIMFVHSNLPKFDPYQLWHDQD 527

Query: 539 LMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLC 598
           L+ DG H+RSY    +LN YDLE+ENFK   E LC  +   FKYL DKL+ D+  W+ +C
Sbjct: 528 LIVDGKHIRSYRNLKRLNGYDLELENFKIFNEYLCTTQA-RFKYLDDKLNGDQRNWKDMC 586

Query: 599 KYIKDRHIFMEKTH 612
            YI +R  ++E+TH
Sbjct: 587 SYIGERLKYLEQTH 600

>SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 608

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/625 (46%), Positives = 402/625 (64%), Gaps = 34/625 (5%)

Query: 4   NRRFSKLFKVSLVLVAVLTFVILRHH-------KDETAKVLQNYTDAVSSYIGDSIGXXX 56
            +RF+K+FK++ +        IL +         DE    LQNY D  +S  G+      
Sbjct: 5   TKRFAKVFKLAAITTLCCLLFILTNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPPAVVP 64

Query: 57  XXXXXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDL 116
                             ++E   +         EL        + R+ ++ FYS+V+  
Sbjct: 65  SPPQKGR-----------DREPMTDVSRQPASKKEL--------QRRQKLQDFYSQVFKY 105

Query: 117 LRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSH 176
           L    P+G S R Y   C LD DIG R +D   W  LT + L +CL +     AMLK +H
Sbjct: 106 LHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENH 165

Query: 177 RKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEG 236
            K+++ L  L    D Y G+GIV V GGKFSLL+ L+IKT+RN+   LP+EV IPP DEG
Sbjct: 166 AKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEG 225

Query: 237 DDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNY 296
           + + C+ LLPKYNAKCI++SD LP+  + ++ +  GYQ K ++I ASSF+N+LLLDADN+
Sbjct: 226 ETDFCDVLLPKYNAKCIYISDVLPQSLV-DNFEFKGYQFKSLSIIASSFENLLLLDADNF 284

Query: 297 PIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSV 356
           PIK +DDIF  EPY S G++ WPD+WRR+T+P+YYDI D  IS N+RVRN +D+ITPP +
Sbjct: 285 PIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPEL 344

Query: 357 YTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILT 416
           YTED+++  ++P+HD +GT+PDVSTESGQLMI+K  HL ++LL++YYN+ GP+WYYPI +
Sbjct: 345 YTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFS 404

Query: 417 QKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVAMFQHDFIQDYTAY 474
           QKA+GEGDKETFIAGANF+ LPFYQVK     DGY +P   G+RGVAM QHDF+QDY  Y
Sbjct: 405 QKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRY 464

Query: 475 ENAKTFIEKKYPNTKQDKI--DKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVA 532
           + A   I  +Y     + I  DK+Y+P  F  K+FE +    V D+MFVH++LPKF+P+ 
Sbjct: 465 QWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKEV-DIMFVHSNLPKFDPLT 523

Query: 533 LWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKE 592
           LW E DL+ +G H+RSYT   +LN YDLE+E+FK  ++ LC+++   FKYL + L ++ +
Sbjct: 524 LWREKDLIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRS-HFKYLDEHLQEEAQ 582

Query: 593 KWQGLCKYIKDRHIFMEKTHEEHFS 617
            WQ +C YI +R  F++ TH++  S
Sbjct: 583 -WQSMCDYIHNRLKFLDSTHKDAVS 606

>NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188
          Length = 608

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/516 (53%), Positives = 363/516 (70%), Gaps = 8/516 (1%)

Query: 104 ENMKTFYSKVYDLLRSAGPEGTSDRKYGQD-CPLDSDIGQRKNDVHKWNVLTQDNLSKCL 162
           E MK F++ V+  +    P+G + + Y ++ C LD D+G R  +   W  L+  NL  CL
Sbjct: 96  EKMKAFFNTVFQHIIDYSPKGKTKKIYNKEKCLLDGDVGSRPENYKDWYKLSYKNLGNCL 155

Query: 163 QIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKI 222
           ++ +     LK SH  + + L +L      Y GDGIVLV GGKFSLLS LVIKTIRNL  
Sbjct: 156 EVSDTEFTNLKTSHASFTENLNKLVLPKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGT 215

Query: 223 NLPIEVFIPPMD-EGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIA 281
            LPIEVFIPP + EG+ E C+  +   +AKCI++SD LP+D +++  +  GYQ K +AI 
Sbjct: 216 TLPIEVFIPPNEVEGESEFCSQTISDLDAKCIYISDILPKDMVSK-FEFKGYQFKSLAII 274

Query: 282 ASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQN 341
           ASSF+N+LLLDADN PIKN++ IF  EPY+SRGL+ WPD+WRR+T P YY I    ++  
Sbjct: 275 ASSFENLLLLDADNTPIKNLNTIFKQEPYASRGLVLWPDFWRRTTQPIYYKIAGIPVNLQ 334

Query: 342 ERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAM 401
           +RVRN++DD+TP  VYT+   +  DIP HDFEGT+PDVSTESGQLM+NK KHL ++LLA+
Sbjct: 335 KRVRNDIDDLTPVGVYTK--PDMVDIPFHDFEGTMPDVSTESGQLMVNKSKHLATVLLAL 392

Query: 402 YYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVA 461
           YYN+ GPNWYYPI +QKA+GEGDKETFIAGANF++LP+YQVK  VG DGY R  G+RGVA
Sbjct: 393 YYNVNGPNWYYPIFSQKAAGEGDKETFIAGANFYDLPYYQVKSKVGVDGYHRKEGFRGVA 452

Query: 462 MFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFV 521
           M QHDF+QDY  Y+ A   I ++Y N      DK Y+   F DK+F++   D  IDVMF+
Sbjct: 453 MLQHDFVQDYNRYKLASADIAREYSNPSSVVFDKSYTVQKFYDKYFDNTDED--IDVMFI 510

Query: 522 HAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFK 581
           H++LPKF+P+ LW++NDL++DG  VRSYT   KL ++D+E ENFK L+ELLC EK  +FK
Sbjct: 511 HSNLPKFDPLPLWKDNDLIEDGKPVRSYTNLRKLGYHDIEYENFKTLKELLC-EKNVDFK 569

Query: 582 YLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617
           YL D+   + +     CKYI DR+ ++E+TH+E  S
Sbjct: 570 YLADEFKSNPQARMSFCKYITDRYKYLEETHQEALS 605

>TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.188
           YBR015C
          Length = 653

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/525 (50%), Positives = 365/525 (69%), Gaps = 11/525 (2%)

Query: 98  EEKRLRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDN 157
           +E   ++ +  FY  ++++L++    G SDR Y  +C L  D+G R ++  +W  LT   
Sbjct: 122 DEATRKQKVYKFYQDIFNILKNTTIPGKSDRVYKLECQLKGDVGTRPDNYKEWYKLTSKE 181

Query: 158 LSKCLQIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTI 217
           LS CL++  E+  ML+ SH  Y+D +  L      Y G GIV V GGKFS+L+ L+I+T+
Sbjct: 182 LSNCLEVPYETAKMLQESHADYVDKIGSLVLPKVAYGGKGIVTVGGGKFSVLAFLIIRTL 241

Query: 218 RNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKV 277
           RNL  +LP+EVFIPP DEG+ + CN +LP+YNAKCI+++D LP++ ++E  +  GYQ K 
Sbjct: 242 RNLGTSLPVEVFIPPSDEGETDFCNNVLPQYNAKCIYMTDILPKEFVDE-FEFKGYQFKS 300

Query: 278 VAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRD 337
           +A+ ASSF ++L+LDADN+PIK++D+IF  EPY+S GL+ WPD+WRR+T+P YY I D  
Sbjct: 301 LAMIASSFDDLLMLDADNFPIKDLDNIFEQEPYTSTGLVMWPDFWRRTTNPVYYSIADVP 360

Query: 338 ISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSL 397
           +++ +RVRN  DD+TP  +YTED+ +  D+P HD EGTLPDVSTESGQLMINKEKH+ ++
Sbjct: 361 VNEKKRVRNTFDDLTPVEIYTEDISDLSDVPFHDLEGTLPDVSTESGQLMINKEKHIATV 420

Query: 398 LLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--G 455
           LLA+YYN  GP WYYPI +QKA+GEGDKETFIA ANF+ L +YQV+  VG DGY +    
Sbjct: 421 LLALYYNFNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSYYQVRTSVGVDGYHQSDDK 480

Query: 456 GYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQD-KIDKEYSPFDFTDKFF---EDEH 511
           G+RGVAM QHDF+QDY  YE A+  I+ KY   K+  K D  YSP DF   +F   +D +
Sbjct: 481 GFRGVAMLQHDFVQDYERYERARNEIDIKYGGAKKVMKYDYNYSPDDFYKTYFDSGDDSN 540

Query: 512 AD-PV--IDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKAL 568
            + P+  +D+MFVH++LPKF+P  LW+ENDL  DGSH RSY K   L HYDLE ENFK  
Sbjct: 541 VNQPIKEVDIMFVHSNLPKFDPFTLWDENDLTLDGSHFRSYLKLPHLTHYDLEYENFKIF 600

Query: 569 EELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHE 613
            + LC+ K  +FKYL+DK    +   + +C YI DR  ++  THE
Sbjct: 601 HQSLCVLKN-QFKYLEDKFQGKESNRESMCNYIMDRLKYLTDTHE 644

>Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON}
           YBR015C (REAL)
          Length = 597

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/620 (45%), Positives = 389/620 (62%), Gaps = 34/620 (5%)

Query: 1   MVSNRRFSKLFKVS-LVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXX 59
           M+  +RF+KLFK++ LVL+    FV+   + DE   V ++Y      Y+ D+I       
Sbjct: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSV-KDY----KKYLLDNINSYSSKH 55

Query: 60  XXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRS 119
                        DD+                   ++  +K   E +K+FY+ V++ L  
Sbjct: 56  SSSSDNAGA----DDSSS-----------------LKGNDKVSNEKLKSFYNNVFNFLML 94

Query: 120 AGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKY 179
             P G S RKY + C L  DIG R +   +   L+ + LSKCL++ ++ +A L  SH+ Y
Sbjct: 95  DSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDY 154

Query: 180 IDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDE 239
           +D +  L      Y G GI  V GGKFSL+S L+IKT+RN+   LP+EV IPP DEG+ E
Sbjct: 155 VDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESE 214

Query: 240 LCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIK 299
            CN +LP YNAKCI++SD LP + I E     GYQ K +A+ ASSF+N+LLLDADN+PIK
Sbjct: 215 FCNKILPNYNAKCIYVSDILPLETI-EKFTFKGYQFKSLALVASSFENLLLLDADNFPIK 273

Query: 300 NIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTE 359
            +D+IF  EPY S GL+ WPD+WRR+T P YY+I D  ++   RVRN+ DD+TPP++YT+
Sbjct: 274 PLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTK 333

Query: 360 DLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKA 419
           +  +   +P+ D +GT+PDVSTESGQLMINK KHL + LL+++YN+ GPNWYYPI +QKA
Sbjct: 334 NSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKA 393

Query: 420 SGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKT 479
           +GEGDKETFIA ANF+ L FYQVK   G +GY    G+ GVAM QHDF+QDY+ Y  A  
Sbjct: 394 AGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASK 453

Query: 480 FIEKKYPNTKQD---KIDKEYSPFDFTDKFF--EDEHADPVIDVMFVHAHLPKFEPVALW 534
            I  KY + K     K DK YS   +T +FF  ED  A   +DVMF+H++LPKF+P  L 
Sbjct: 454 SITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLS 513

Query: 535 EENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKW 594
           E N L  D    RS+T   K+ +YD+E+ENFK L+E +C +K   FKYL DKL +DK++W
Sbjct: 514 ETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVC-DKKNPFKYLDDKLGEDKKEW 572

Query: 595 QGLCKYIKDRHIFMEKTHEE 614
           + +C YI  R  F+E TH++
Sbjct: 573 RRMCDYIAKRLQFLESTHDK 592

>YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}
           MNN2Alpha-1,2-mannosyltransferase, responsible for
           addition of the first alpha-1,2-linked mannose to form
           the branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 597

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/623 (45%), Positives = 386/623 (61%), Gaps = 34/623 (5%)

Query: 1   MVSNRRFSKLFKVS-LVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXX 59
           M+  +RFSKLFK++ +VL+    FVI   + DE   V + Y + +  Y+           
Sbjct: 1   MLLTKRFSKLFKLTFIVLILCGLFVITNKYMDENTSV-KEYKEYLDRYVQSYSNKYSSSS 59

Query: 60  XXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRS 119
                       ++D                             E +K+FY+ V++ L  
Sbjct: 60  DAASADDSTPLRDNDEAG-------------------------NEKLKSFYNNVFNFLMV 94

Query: 120 AGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKY 179
             P+G++ ++Y + C L  DIG R +       L+   LSKCL++  + +A L  SH+ Y
Sbjct: 95  DSPKGSTAKQYNEACLLKGDIGDRPDHYKDLYKLSAKELSKCLELSPDEVASLTKSHKDY 154

Query: 180 IDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDE 239
           ++ +  L S    Y G GI  V GGKFSL++ L+IKT+RN+   LP+EV IPP DEG+ E
Sbjct: 155 VEHIATLVSPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETE 214

Query: 240 LCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIK 299
            CN +LPKYN+KCI++SD LP + I E     GYQ K +A+ ASSF+N+LLLDADN+PIK
Sbjct: 215 FCNKILPKYNSKCIYVSDILPRETI-EKFVFKGYQFKSLALIASSFENLLLLDADNFPIK 273

Query: 300 NIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTE 359
            +D+IF  EPY S GL+ WPD+WRR+T P YYDI    + + +RVRN+ DDITPP+VYT+
Sbjct: 274 PLDNIFNEEPYVSTGLVMWPDFWRRTTHPLYYDIAGIAVDKKKRVRNSRDDITPPAVYTK 333

Query: 360 DLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKA 419
           DLK+  D+P+ D +GT+PDVSTESGQLMINK KHL + LL+++YN+ GP WYYPI +QKA
Sbjct: 334 DLKDLSDVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPTWYYPIFSQKA 393

Query: 420 SGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKT 479
           +GEGDKETFIA ANF+ L FYQV+   G +GY    G+ GVAM QHDF+QDY  Y NA  
Sbjct: 394 AGEGDKETFIAAANFYGLSFYQVRTRTGVEGYHDEDGFHGVAMLQHDFVQDYGRYLNAME 453

Query: 480 FIEKKYPNTKQD---KIDKEYSPFDFTDKFF--EDEHADPVIDVMFVHAHLPKFEPVALW 534
            I  KY  TK     K DK YS   +T++FF  ED +A   +DVMF+H++ PKF+P  L 
Sbjct: 454 SIGNKYGGTKSADAIKFDKNYSLEKYTEEFFDNEDLNAKNHVDVMFIHSNFPKFDPYDLS 513

Query: 535 EENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKW 594
           + N L  +G   RSYT   K+ +YD+E+ENFK L E +C+ K   FKYL D L  DK +W
Sbjct: 514 KSNFLTTNGKPARSYTALKKVKNYDIELENFKVLNEYVCVNKN-PFKYLDDLLGQDKTEW 572

Query: 595 QGLCKYIKDRHIFMEKTHEEHFS 617
           + +C YI DR  F+E TH++  +
Sbjct: 573 KRVCGYITDRLAFLESTHDKAIA 595

>KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {ON}
           Anc_3.188 YBR015C
          Length = 612

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/632 (45%), Positives = 403/632 (63%), Gaps = 39/632 (6%)

Query: 2   VSNRRFSKLFKVSLVLVAVLTFVIL--RHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXX 59
           V N+RFSKLF   ++LV++  F +L  R + +  +  +++Y + + SYI ++ G      
Sbjct: 3   VVNKRFSKLF---ILLVSIGFFFLLTNRLYINNDSVSVKDYKEYLQSYINNNAGD----- 54

Query: 60  XXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQME--EKRLRENMKTFYSKVYDLL 117
                       + D + T+             N V M   E   +  ++ FY++V+   
Sbjct: 55  ------------STDAQGTKGGDESVPAASKGKNPVLMSTVESNTKNRLREFYNEVFQYF 102

Query: 118 RSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHR 177
            +  P G S R Y   C L   +G R ++   W  L+   L+KCL I +  +  LK SH+
Sbjct: 103 INYSPSGKSARHYQDACQLSEKMGNRPHEYASWYKLSYTELNKCLSISKSDVLNLKTSHK 162

Query: 178 KYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDE-G 236
           ++++ L +L    + Y G+GIV V GGKFSL+S LVI+T+RNL   LP+EVFIPP +E G
Sbjct: 163 EFVENLGKLVLPKNSYKGNGIVTVGGGKFSLMSLLVIRTLRNLGTTLPVEVFIPPQEEKG 222

Query: 237 DDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNY 296
           + E CN +LP+Y+AKCI++SD LP+  I ++ +  GYQ K +AI ASSF+N+LLLDADN+
Sbjct: 223 EMEFCNKILPQYHAKCIYISDILPQQMI-DNFEFAGYQFKSLAIIASSFENLLLLDADNF 281

Query: 297 PIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSV 356
           PIK +D IF  EPY S GL+ WPD+WRR+T P YY+I D  +    RVRN++DDITPP V
Sbjct: 282 PIKPLDHIFEEEPYVSTGLVLWPDFWRRTTQPLYYEIADVSVDFKTRVRNSIDDITPPPV 341

Query: 357 YTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILT 416
           YT+D+ +  +IP+HD +GT+PDVSTESGQLMI+K KHL ++LLA+YYN+ GP+WYYPI +
Sbjct: 342 YTKDMNDLSNIPLHDLKGTIPDVSTESGQLMISKSKHLPTVLLALYYNVNGPSWYYPIFS 401

Query: 417 QKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVAMFQHDFIQDYTAY 474
           QKASGEGDKETF+A ANF++LP+YQ++  VG DGY +P   G+RGVAM QHDF QDY  Y
Sbjct: 402 QKASGEGDKETFLAAANFYDLPYYQIRTEVGVDGYHQPENKGFRGVAMLQHDFAQDYKRY 461

Query: 475 ENAKTFIEKKYPN---TKQDKIDKEYSPFDFTDKFFEDEHADPV------IDVMFVHAHL 525
             AK  +  KY     + + K D  Y    F   +F D  ++P       +DVMF+H++L
Sbjct: 462 VKAKEEVRLKYGKDRYSSKIKYDPNYDVDSFYRTYF-DSGSEPGQGGAQEVDVMFIHSNL 520

Query: 526 PKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKD 585
           PKFEP+  W+ +DL+ DG H+RS+T   +L +YD+E+ENFK   E+LC E+   FKYL D
Sbjct: 521 PKFEPLTSWKTSDLIIDGKHIRSFTNLKRLKNYDIELENFKIYHEVLC-EQGLHFKYLDD 579

Query: 586 KLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617
            L ++K     +CKYI DR  F++ THE   S
Sbjct: 580 ALGNNKNDKSSMCKYISDRLDFLQSTHEAAIS 611

>Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON}
           YBR015C (REAL)
          Length = 603

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/625 (45%), Positives = 390/625 (62%), Gaps = 32/625 (5%)

Query: 1   MVSNRRFSKLFKVSLV-LVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXX 59
           M+  +RFSKLFK++ + L+    FV+   + DE   V ++Y   + SYI DS        
Sbjct: 1   MLLTKRFSKLFKLAFIALLLCGLFVVTNKYMDENTSV-KDYKSHLQSYI-DSYA------ 52

Query: 60  XXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRS 119
                       N D+  +  E         +   ++  +    E +K+FY+ V++ L  
Sbjct: 53  ------------NKDS--SSPEDAAAAAAADDAASLKGNDNASTEKLKSFYNNVFNFLML 98

Query: 120 AGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKY 179
             P G S R Y + CPL  DIG R +       L+   L+KCL++  + ++ LK SH+ Y
Sbjct: 99  DSPSGKSKRVYNEKCPLKGDIGDRPDQYKDLYKLSAKELAKCLELSPDEVSKLKKSHKDY 158

Query: 180 IDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDE 239
           ++ +  L      Y G GI  V GGKFSL++ L+IKT+RN+   LP+EV IPP DEG+ E
Sbjct: 159 VEHIASLILPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETE 218

Query: 240 LCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIK 299
            C+ +LPKYNAKCI++SD LP + I E     GYQ K +A+  SSF+N+LLLDADN+PIK
Sbjct: 219 FCSKILPKYNAKCIYISDILPAETI-EKFVFKGYQFKSLALITSSFENLLLLDADNFPIK 277

Query: 300 NIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTE 359
           ++D+IF  EPY S GL+ WPD+WRR+T P YYDI    +++  RVRN+ DDITPP+VYT+
Sbjct: 278 SLDNIFLEEPYVSTGLVMWPDFWRRTTHPLYYDIAGIPVNKERRVRNSQDDITPPAVYTK 337

Query: 360 DLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKA 419
           DLK+   +P+ D EG +PDVSTESGQLMINK KHL + LL+++YN+ G NWYYPI +QKA
Sbjct: 338 DLKDLDAVPLSDMEGAIPDVSTESGQLMINKSKHLATALLSLFYNVNGINWYYPIFSQKA 397

Query: 420 SGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKT 479
           +GEGDKETFIA ANF+ LPFYQVK   G +GY    G+ GVAM QHDF+QDY+ Y  A  
Sbjct: 398 AGEGDKETFIAAANFYGLPFYQVKTKTGVEGYHDSDGFHGVAMLQHDFVQDYSRYLTASK 457

Query: 480 FIEKKY-----PNTKQDKIDKEYSPFDFTDKFF--EDEHADPVIDVMFVHAHLPKFEPVA 532
            I  KY      ++   K DK+YS   +  +FF  ED HA   +DVMF+H++LPKF+P  
Sbjct: 458 TINNKYKDLIIKSSAPIKFDKDYSLEKYIKEFFDNEDSHAKDHVDVMFIHSNLPKFDPYD 517

Query: 533 LWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKE 592
           L + N L  D    RS+T   K++ YD+E+ENFKAL E +C+ K   FKYL D L  D++
Sbjct: 518 LSKSNFLTTDNKPARSFTSLGKIHKYDIELENFKALHEYVCVNKN-PFKYLDDALGQDEK 576

Query: 593 KWQGLCKYIKDRHIFMEKTHEEHFS 617
            W+ +C YI  R  F+E THE+  +
Sbjct: 577 GWKKMCDYIAKRLQFLESTHEKAIA 601

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/517 (50%), Positives = 354/517 (68%), Gaps = 8/517 (1%)

Query: 106 MKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQID 165
           +K FY +V+  L++  PEG S R Y +DCPL  DIG R  +  +W  L  D+L  CL+I 
Sbjct: 104 LKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGFRPENYDEWPTLAHDSLENCLEIS 163

Query: 166 EESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLP 225
            E + MLK +H  Y+D L  L    ++Y G GIV V GGKFSLL+ LVI+++R L   LP
Sbjct: 164 PEEVTMLKKNHAAYVDVLGSLRLPKNVYKGKGIVTVGGGKFSLLALLVIRSMRELGTTLP 223

Query: 226 IEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSF 285
           +EVFIPP D G+++ C+ +LP+YNAKC++LSD LP + I  + +  GYQ K +++ ASSF
Sbjct: 224 VEVFIPPSDLGENQFCDEILPQYNAKCVYLSDVLPPNVI-ANSQFTGYQFKSLSLIASSF 282

Query: 286 KNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVR 345
           ++VL LDADN+P+K ++D+F   PY + G + WPD+WRR+T P YYDI D  +++ +R+R
Sbjct: 283 EDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWPDFWRRTTQPIYYDIADITVNRRKRIR 342

Query: 346 NNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNM 405
           N  DD+TPP VYT++ K+  DIP HDFEGT+PDVSTESGQLMI+K  HL ++LLA+YYN+
Sbjct: 343 NCFDDLTPPEVYTKNTKSMDDIPFHDFEGTIPDVSTESGQLMISKSTHLPTILLALYYNV 402

Query: 406 YGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPG--GYRGVAMF 463
            GP+WYYP+ +Q+A+GEGDKETF+A ANF+ LPFYQVK   G +GY R    G+RGVAM 
Sbjct: 403 NGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPFYQVKTATGVEGYHRANNEGFRGVAML 462

Query: 464 QHDFIQDYTAYENAKTFIEKKY--PNTKQDKIDKEYSPFDFTDKFFEDEH-ADPVIDVMF 520
           QHD  QDY  Y+ A   IE KY     K  K DK YS  +F   FF  E+ A    DVMF
Sbjct: 463 QHDLNQDYLRYQAAADAIEAKYGGKTAKSIKYDKLYSLDNFYKTFFGSENSALKECDVMF 522

Query: 521 VHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEF 580
            H+H PKF+P  LW +N+L+QDG H RSYT  +K+N+YDLE+    ++ + +CL+K   F
Sbjct: 523 AHSHAPKFDPYGLWTQNELVQDGKHFRSYTSLEKINNYDLELSAIDSIHKFVCLDK-VNF 581

Query: 581 KYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617
           KYL +K+   K++ Q +C YI  R  F+  TH++  S
Sbjct: 582 KYLSEKIQ-SKQEHQEMCDYISKRREFLLSTHQQAIS 617

>KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 638

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/514 (51%), Positives = 351/514 (68%), Gaps = 10/514 (1%)

Query: 103 RENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCL 162
           ++ ++ FY +V+  L+  GP G +   Y Q C L+ DIG R+ +  +W  LT + L+ CL
Sbjct: 127 KKQVQGFYGQVFKYLKEFGPVGVNIATYNQKCSLNGDIGYRQENTDQWWKLTTEELNNCL 186

Query: 163 QIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKI 222
           Q+ +E   MLK +H  Y+  L +L    D YSGDGIV V GGKFS+++ L+IKT+RN   
Sbjct: 187 QLSQEQRLMLKEAHSNYVHALSKLVLPKDTYSGDGIVTVGGGKFSMMAFLIIKTVRNFGT 246

Query: 223 NLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAA 282
            LP+EVFIPP DEGDDE CN LLP+YNAKCI+LSD  P D I E     GYQ K +AI A
Sbjct: 247 TLPVEVFIPPSDEGDDEFCNVLLPQYNAKCIYLSDAFPPDLI-EKSDFKGYQFKSLAIIA 305

Query: 283 SSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNE 342
           SSFKN+LLLDADN+PIK +D IF  + Y   GLI WPD+WRR+T PSYY I +  IS +E
Sbjct: 306 SSFKNLLLLDADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSYYSIANTPIS-SE 364

Query: 343 RVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMY 402
           R+RN +DD+TPPSVYT+DLK+  D+P+HD +GT+PD STESGQLMINK KH  ++LL++Y
Sbjct: 365 RIRNTMDDVTPPSVYTKDLKDLSDVPLHDLDGTIPDASTESGQLMINKLKHFPTVLLSLY 424

Query: 403 YNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPG--GYRGV 460
           YN+YGP+WYY I +Q++SGEGDKETFIA A+F++LPFYQV+     DGY R    G+RGV
Sbjct: 425 YNVYGPSWYYSIFSQRSSGEGDKETFIAAAHFYDLPFYQVRSEPRVDGYHRHNNEGFRGV 484

Query: 461 AMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMF 520
            M QHDF QDY  Y  A+  I  KY N   D   K     ++  K+F +   DPV DVMF
Sbjct: 485 CMLQHDFAQDYKRYRQAQNEIGTKYTNEPDDYDPKYNYQENYLGKYFTN---DPV-DVMF 540

Query: 521 VHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEF 580
           VH+HLPKF+PV L    DL+QDG H+RSY    ++N YDLE+E FK  +E +C +K   F
Sbjct: 541 VHSHLPKFDPVELALSQDLIQDGKHIRSYRNLKRMNGYDLELEVFKTFKEYVC-DKRVHF 599

Query: 581 KYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
           KY  +K    +  W  +C Y+ +R +++ ++H E
Sbjct: 600 KYF-EKAVKLESNWGIICNYVNERLVYLIESHSE 632

>TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {ON}
           Anc_3.188 YBR015C
          Length = 598

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/624 (43%), Positives = 378/624 (60%), Gaps = 43/624 (6%)

Query: 4   NRRFSKLFKVS-LVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIG-----DSIGXXXX 57
            +R+ K  K++ +VLV  +TF+      DE   V   Y D + SY+G     D+I     
Sbjct: 5   TKRYRKALKLATVVLVLCVTFIATSRFMDEGLSV-SEYQDYIKSYLGNAQPADTISRNPA 63

Query: 58  XXXXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLL 117
                           + K                             +K FY +V++ L
Sbjct: 64  VDVGLNAGREPIANGGNAK-----------------------------LKKFYEQVFEDL 94

Query: 118 RSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHR 177
           ++  P   S R+Y + C L  DIG R  + ++W  LT+  LS+CL +    +A L+ SH 
Sbjct: 95  KNYSPSSKSAREYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHS 154

Query: 178 KYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGD 237
            Y+  L  L    + Y G GIV V GGKFSL++ LVIKT+RNL   LP+EVFIPP DEG+
Sbjct: 155 DYVKALGSLVLPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGE 214

Query: 238 DELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYP 297
            +LC T+  KYNAKCIFLSD LP   + +  +  GYQ K +A+ ASSF++VL LDADN+P
Sbjct: 215 TDLCETVFSKYNAKCIFLSDILPAPSLKK-FQFTGYQFKSLALIASSFEDVLFLDADNFP 273

Query: 298 IKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVY 357
           +K +D IF  +PY S GL+ WPD+WRR+T P +YDI    + + +RVRN  DD+TPP VY
Sbjct: 274 VKTLDHIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVY 333

Query: 358 TEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQ 417
           T++L +  ++P HD EG++P+VSTESGQLMI+K KHL ++LLA+YYN+ GP+WYYP+ +Q
Sbjct: 334 TKNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQ 393

Query: 418 KASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVAMFQHDFIQDYTAYE 475
           +ASGEGDKETF+  A+F+ LP+YQ+K   G +GY RP   G+RGVAM QHD  QDY  Y+
Sbjct: 394 RASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYK 453

Query: 476 NAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFF-EDEHADP-VIDVMFVHAHLPKFEPVAL 533
            A+  I  KY    +   D  YS  +F   +F  DE   P  +D+MF H+H PKFEP  L
Sbjct: 454 TAQKAISNKYGAQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTL 513

Query: 534 WEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEK 593
           W+  DL+ +G H+RSYT   K+N YDLE+ENFKA+ E +C+++    KYL + L+   E 
Sbjct: 514 WKNQDLIWEGKHIRSYTALSKINRYDLELENFKAINEYVCVKRT-NVKYLNENLATSAE- 571

Query: 594 WQGLCKYIKDRHIFMEKTHEEHFS 617
           W  +C YI+DR  +++ TH +  S
Sbjct: 572 WASMCDYIRDRLAYLQSTHVQAVS 595

>NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/614 (45%), Positives = 390/614 (63%), Gaps = 38/614 (6%)

Query: 2   VSNRRFSKLFKVSLVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXXXX 61
           V  RRFSK+FK++L+   +   +I  H    +  V   Y D + SYI             
Sbjct: 25  VLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAVPTQYKDYLKSYI------------- 71

Query: 62  XXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRSAG 121
                     ++       E           N           N+K+F+  V+  +    
Sbjct: 72  ---------TSNSTSSVSAEHDIEQENSSSYN---------DNNIKSFFDTVFQHILDYS 113

Query: 122 PEGTSDRKYGQD-CPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYI 180
           P G S+R Y ++ C L+S +G   ++   W  L+ +NL  CL+I ++    L+++H  +I
Sbjct: 114 PTGKSERIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFI 173

Query: 181 DGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMD-EGDDE 239
           + + +L    D+Y GDGIVLVAGGKFSLLS LV+KTIR     LP+EVFIPP + E + E
Sbjct: 174 EEMDKLTLPNDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAE 233

Query: 240 LCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIK 299
            C T+L +++AKC+++SD LPE  I+      GYQ K +AI ASSF+N+LLLDADN+P+K
Sbjct: 234 FCKTMLNEFDAKCVYISDILPESMISH-FDFKGYQFKSLAIIASSFENLLLLDADNFPVK 292

Query: 300 NIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTE 359
           N+D+IF  EPY++ GLI WPD+WRR+T P +Y+I    ++  +RVRN +D++TP  VY +
Sbjct: 293 NLDNIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDK 352

Query: 360 DLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKA 419
                 D+P HDFEG +PDVSTESG+LM+NK +HLK++LLA+YYN+ GPNWYYPI +Q  
Sbjct: 353 S-DQEMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGL 411

Query: 420 SGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKT 479
           +GEGDKETFIAGA F+NLPFYQVK  VG DGY +  G+RGVAM QHDF+QDY  Y+ A+ 
Sbjct: 412 AGEGDKETFIAGATFYNLPFYQVKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQL 471

Query: 480 FIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDL 539
            I+KKY  + +   DK+Y+   F D++F  E  +   DV+FVH+HLPKF+PV+LW++NDL
Sbjct: 472 KIDKKYLPSNEVLYDKDYTVQKFYDEYFNIEGNE--TDVLFVHSHLPKFDPVSLWKDNDL 529

Query: 540 MQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCK 599
           ++DG H+RSYT  +K  +YD+E ENFK ++ELLC E    F Y+ +   D  E+    CK
Sbjct: 530 IKDGKHLRSYTNLNKFGYYDIEYENFKTMKELLC-ESDTHFYYIDEAFKDKPEEKADFCK 588

Query: 600 YIKDRHIFMEKTHE 613
           YI DR+ F+ +TH+
Sbjct: 589 YIVDRYEFLNETHD 602

>Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON}
           YBR015C (REAL)
          Length = 596

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/623 (45%), Positives = 383/623 (61%), Gaps = 35/623 (5%)

Query: 1   MVSNRRFSKLFKVSLV-LVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXX 59
           M+  +RFSKLFK++ + L+    FVI   + DE   V + Y   +  Y+ DS        
Sbjct: 1   MLLTKRFSKLFKLAFIALILCGLFVITNKYMDENTSV-REYKSYLQDYL-DSHSNKHPST 58

Query: 60  XXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRS 119
                        +DN  T+                          +K FY KV++ L  
Sbjct: 59  DAPVTDDSSSSKVNDNAATR-------------------------KLKDFYDKVFNFLIL 93

Query: 120 AGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKY 179
             P G S R YG+ C L+ DIG R +   + + L+   LSKCL++  + ++ L  SHR Y
Sbjct: 94  DSPTGKSARNYGKACLLNGDIGDRPDQYEELHKLSAKQLSKCLELSPDEISRLTKSHRDY 153

Query: 180 IDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDE 239
           ++ +  L      Y G GI  V GGKFSL++ L+IKT+RN   NLP+EV IPP DEG+ E
Sbjct: 154 VEHIATLLLPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNRGTNLPVEVLIPPGDEGESE 213

Query: 240 LCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIK 299
            CN +LPKYN+KCI++SD LP + I +    +GYQ K +A+ ASSF+N+LLLDADN+PIK
Sbjct: 214 FCNKILPKYNSKCIYVSDILPVETIKK-FHFEGYQFKSLALIASSFENLLLLDADNFPIK 272

Query: 300 NIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTE 359
           ++D+IF  EPY S GL+ WPD+WRR+T P YY+I    ++ N+RVRN+ DDITPP+VYT+
Sbjct: 273 SLDNIFNEEPYVSTGLVMWPDFWRRTTHPLYYEIAGIPVNMNKRVRNSQDDITPPAVYTK 332

Query: 360 DLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKA 419
           DLKN  D+P+ D +GT+PDVSTESGQLMINK K L + LL+++YN+ GPNWYYPI +QKA
Sbjct: 333 DLKNLDDVPLSDLDGTIPDVSTESGQLMINKSKQLATALLSLFYNVNGPNWYYPIFSQKA 392

Query: 420 SGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKT 479
           +GEGDKETFIA ANF+  PFYQV+   G +GY     + GVAM QHDF+QDY+ Y  A  
Sbjct: 393 AGEGDKETFIAAANFYGEPFYQVRTRTGVEGYHENKDFHGVAMLQHDFVQDYSRYLIASK 452

Query: 480 FIEKKYPNTKQD---KIDKEYS--PFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALW 534
               KY   K     K DK YS   +       ED +A   +DVMF+H++LPKF+P  L 
Sbjct: 453 KTNDKYNTMKSSASIKFDKSYSFENYFEEFFENEDTNAKNHVDVMFIHSNLPKFDPYDLS 512

Query: 535 EENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKW 594
           E N L  D    RSYT   K+ +YD+E+ENFKAL+E +C  K   FKYL D L +DK KW
Sbjct: 513 ETNFLTIDKKPARSYTALHKIQNYDIELENFKALKEYVCTNKN-PFKYLDDALGEDKVKW 571

Query: 595 QGLCKYIKDRHIFMEKTHEEHFS 617
           + +C YI +R  F+E TH++  +
Sbjct: 572 KKMCDYITERLEFLESTHDKAIA 594

>AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR015C
           (MNN2)
          Length = 606

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/614 (45%), Positives = 383/614 (62%), Gaps = 18/614 (2%)

Query: 4   NRRFSKLFKVSLVLVAV--LTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXXXX 61
            R++SK  K+SL+ VA+  L  V  R    E   V   Y       +G            
Sbjct: 3   RRKYSKTLKLSLITVALGALFLVTNRWLPGEFPSVYTEYLQNRLPNLGSFGKQQHMEEQE 62

Query: 62  XXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRSAG 121
                        +K ++L          E    + E+   +  +  FY KV++LL    
Sbjct: 63  SQTRQMIEEGEMRSKPSEL---------LEEEAARTEQAERKSQIFAFYQKVFELLAEHS 113

Query: 122 PEGTSDRKYGQDCPLDSDIGQ-RKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYI 180
           P G    K G+ C +   + Q   +D   W +LT+++LSKCL++ ++   M+ + H  Y+
Sbjct: 114 PSGQISHKSGRQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKMTQKDKQMVSDKHMHYV 173

Query: 181 DGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDEL 240
           D L  L  S   YSG GIV V GGKFS+L+ L+IK++R +  +LP+EV IPP +E + + 
Sbjct: 174 DALSNLKLSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLPVEVLIPPGEEEEYDY 233

Query: 241 CNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKN 300
           C+ LLP+  AKCI+L D LP   IN     +GYQ K  AI ASSFK++LLLDADN PI N
Sbjct: 234 CSKLLPEVGAKCIYLKDVLPPAVINNHY-FEGYQLKSAAIIASSFKDLLLLDADNIPILN 292

Query: 301 IDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTED 360
           +DDIF S+PY   GL+ WPD+WRRSTSP YY+I    +  N RVRN++D++TP SVYT++
Sbjct: 293 LDDIFQSKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNRRVRNHIDNLTPASVYTQN 352

Query: 361 LKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
           +K+   IPMHD EGTLPD STESGQL+I+KE+HL ++LL++YYN+ G  WYYP+ +Q A 
Sbjct: 353 MKDLSSIPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLSLYYNVNGETWYYPLFSQGAP 412

Query: 421 GEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKTF 480
           GEGDKETFIA ANF+  P+YQV+   G +GY    G+ GVAM QHDF +DY  YE A+  
Sbjct: 413 GEGDKETFIAAANFYRKPYYQVRTSTGAEGYHTKKGFSGVAMLQHDFREDYRRYEAARED 472

Query: 481 IEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDLM 540
           ++ KY  ++Q   D EY+   F  K+FED +  PV DVMFVHA+LPKFEP+ + E+  LM
Sbjct: 473 VKTKYAKSQQ--YDPEYTVEGFYKKYFEDPNQPPV-DVMFVHANLPKFEPLKMSEKQLLM 529

Query: 541 QDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKY 600
           ++GSH RSY+  DKL++YD+E+E+F+ L E LC+ K  + K+ KDKLS    KW  +CKY
Sbjct: 530 ENGSHFRSYSHLDKLHNYDIELESFRVLNEYLCVRK-VQLKFYKDKLSRPA-KWNSMCKY 587

Query: 601 IKDRHIFMEKTHEE 614
           ++DR  F+E THEE
Sbjct: 588 VEDRLKFLESTHEE 601

>TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.188
           YBR015C
          Length = 642

 Score =  526 bits (1356), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 251/521 (48%), Positives = 365/521 (70%), Gaps = 18/521 (3%)

Query: 106 MKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQID 165
           +K FYS+V+D +R   P G   RKY + C L  +I  R  +   W  LT+  L  CL+  
Sbjct: 127 LKEFYSQVFDSIRKYSPVGKCARKYKESCILTDNIPDRPENSEHWFKLTKKALENCLEFT 186

Query: 166 EESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLP 225
            +   MLK++H  +++ + +L      YS  GIV+V GGKFS+L+ L+IKT+RNL   LP
Sbjct: 187 PDEFKMLKSTHDNFVNSISKLTLPKQGYSKQGIVMVGGGKFSMLAFLIIKTLRNLGTTLP 246

Query: 226 IEVFIPPMDEGD-DELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASS 284
           +EVFIPP+DE + D+ C  +LP +NAKCIF+SD LPE++I +     GYQ K +A+ +SS
Sbjct: 247 VEVFIPPVDEAEKDDFCKDVLPNFNAKCIFISDVLPEEQI-KTFDFKGYQFKSLALISSS 305

Query: 285 FKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERV 344
           F+++LLLDADN+P+KN+D+IF  EPY S+GLI WPD+WRR+T+P YY I D  +   +RV
Sbjct: 306 FEDLLLLDADNFPVKNLDNIFDQEPYKSKGLILWPDFWRRTTTPVYYQIADVPVDYTKRV 365

Query: 345 RNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYN 404
           RN++DD+TPP +YTE+L     +P+HD +GT+PD STESGQL+INK++H+ +LLL++YYN
Sbjct: 366 RNSIDDLTPPEIYTENLDT---VPLHDLQGTIPDPSTESGQLLINKKQHVPTLLLSLYYN 422

Query: 405 MYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVAM 462
           + GPNWYYP+ TQKA+GEGDKETFIA A +++LPFYQVK   G DGY +    G+RGVAM
Sbjct: 423 INGPNWYYPMFTQKAAGEGDKETFIAAAVYYDLPFYQVKTKTGVDGYHQADNKGFRGVAM 482

Query: 463 FQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDF-------TDKFFEDEHADPV 515
            QHDF+QDY  +  AK  I+  Y   +    DK YS  D+       T+ F  D++ +  
Sbjct: 483 LQHDFVQDYKRFLKAKDKIQSIYKTVESRIFDKNYSLEDYYKNYILKTNSF--DKNDEGE 540

Query: 516 IDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLE 575
           +D+MFVH++LPKF+P++LW++N+L+ +G H+R Y   +KLN+YD+E+ENFK   + LC+E
Sbjct: 541 VDIMFVHSNLPKFDPISLWKQNELIVNGEHIRGYRAIEKLNNYDIELENFKTFNQYLCVE 600

Query: 576 KPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHF 616
           K  +F +++  L +++++ + +C YIK R  ++EKTH+  F
Sbjct: 601 KT-KFVHVEKHLENEQDR-KSMCDYIKSRLEYLEKTHDSIF 639

>Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}
           similar to Ashbya gossypii AER018C
          Length = 615

 Score =  521 bits (1343), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 258/517 (49%), Positives = 352/517 (68%), Gaps = 6/517 (1%)

Query: 98  EEKRLRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDN 157
           EE+  +  ++ FY KV+++L    P G+S +  G++C L  DIG R  D   W  L+ ++
Sbjct: 100 EEESRQAKLRGFYEKVFNMLSKHAPSGSSSKIRGENCQLTKDIGGRLEDQKWWYKLSYEH 159

Query: 158 LSKCLQIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTI 217
           LSKCLQ+  +   MLK  H  Y+  L  L    D Y+G+GIV V GGKFS+L+ L+I T+
Sbjct: 160 LSKCLQVSRKDRKMLKKKHSDYVADLASLVLPLDSYTGNGIVTVGGGKFSVLAFLMITTL 219

Query: 218 RNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKV 277
           RN+   LP+EV IPP +E + E CN +LP++NAKCI+LSD LP+  +    ++ GYQ K 
Sbjct: 220 RNVGTTLPVEVLIPPNEESEHEFCNNVLPEFNAKCIYLSDVLPKSVLT-SFEVKGYQLKS 278

Query: 278 VAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRD 337
            AI ASSF+N+LLLDADN PIKN+DDIF S+PY S GL+ WPD+WRR+TSP YY++    
Sbjct: 279 FAIIASSFQNLLLLDADNLPIKNLDDIFESKPYKSTGLVLWPDFWRRTTSPIYYEVAGIP 338

Query: 338 ISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSL 397
           I+ N+RVRN++DD+TP SVYT +  +   +PMHD EG +PD+STESGQLMI+K  HL + 
Sbjct: 339 INYNKRVRNSIDDVTPASVYTSNPYSLSTVPMHDLEGAIPDMSTESGQLMISKRTHLGTA 398

Query: 398 LLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGY 457
           LL++YYN+ GP WYYP+ +Q ASGEGDKETFIA A+F+ LPFYQV+   G DGY R  GY
Sbjct: 399 LLSLYYNVNGPTWYYPLFSQGASGEGDKETFIAAASFYQLPFYQVRTVTGVDGYHRSSGY 458

Query: 458 RGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVID 517
           RGVAM QHDF QDY  Y ++K   E KY        +  Y+  DF + +F   ++   +D
Sbjct: 459 RGVAMLQHDFRQDYERYTHSKEDTEAKYA-AGSAAYESSYNVNDFYNTYFGTYNSQEPLD 517

Query: 518 VMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKP 577
           VMFVH++LPK EP++L    DLM+DG H+RSY+   +L+ YD+E+ +F+   E LC +K 
Sbjct: 518 VMFVHSNLPKLEPLSL--STDLMEDGQHIRSYSNLKRLHGYDIELRSFQTFNEYLC-DKR 574

Query: 578 FEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
            +FKY +  L D+ E W  +C YIK R  F+E+TH+E
Sbjct: 575 VKFKYYEKTLIDE-ESWTSMCDYIKGRLSFLERTHDE 610

>KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  513 bits (1322), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 248/520 (47%), Positives = 342/520 (65%), Gaps = 17/520 (3%)

Query: 106 MKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQID 165
           +K FYS+V+  +    P G + ++Y  +C L+ DIG R +D   ++ L  DNL  CL + 
Sbjct: 92  LKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLS 151

Query: 166 EESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLP 225
              ++ L++SH+ ++D L ++    + Y G GIV V GGKFSL++ L+++ IR +   LP
Sbjct: 152 GADISNLRHSHKSFVDSL-DVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLP 210

Query: 226 IEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSF 285
           +EVFIPP +  + E C  LLPKYNAKCIF+   LP++ I +     GYQ K +A+ ASSF
Sbjct: 211 VEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMI-QKFDFRGYQFKSLALVASSF 269

Query: 286 KNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVR 345
           +N LLLDADN+P+K ++ IF  EP+ S+GL+ WPD+WRR+T P YYDI    ++   RVR
Sbjct: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329

Query: 346 NNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNM 405
           N+ DD+TPP VYTE++ +   +P HD EGT+PDVSTESGQLM+NK KHL ++LLA+YYN+
Sbjct: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNV 389

Query: 406 YGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQH 465
            GP WYYPI +QKA+GEGDKETFIA ANF+ LPFYQVK     DGY   G + GVAM Q+
Sbjct: 390 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQY 449

Query: 466 DFIQDYTAYENAKTFIEKKY--------PNTKQDKIDKEYSPFDFTDKFF-EDEHADPVI 516
           D +QDY  Y+ AK  I+ KY         + K+   DK YS  DF +K+F ED H     
Sbjct: 450 DCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFREDSHN---- 505

Query: 517 DVMFVHAHLPKFEPVALWEENDLM-QDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLE 575
           DVMF+H++ PKF+P++LW+   L+ +DG+H RSYT   K   +D+E+ENFK  +   C +
Sbjct: 506 DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGD 565

Query: 576 KPFE-FKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
           +    F YL D L      W  +C+YI  R +F+EKTH E
Sbjct: 566 QKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLE 605

>NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188
          Length = 607

 Score =  508 bits (1307), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 262/623 (42%), Positives = 385/623 (61%), Gaps = 27/623 (4%)

Query: 1   MVSNRRFSKLFKVSLVLVAVLTFVIL--RHHKDETAKVLQNYTDAVSSYIGDSIGXXXXX 58
           M   R+F++L K++ +L  +  F I     +   ++  +Q Y + +  YI          
Sbjct: 1   MFFTRKFARLLKITTILCLLCFFCIWIPSEYSTNSSISVQEYKEYLQGYIN--------- 51

Query: 59  XXXXXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLR 118
                        ++ N +TQ E         + +   +++  + +    FY+ V+  + 
Sbjct: 52  ------KLPIQSNSNVNDDTQKEFQHLVSGENKEDIPSIKKNTVED----FYNVVFQNII 101

Query: 119 SAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRK 178
              P G + R Y   C LD  I  R +    W  L+  NL  CL++  E    L  SH  
Sbjct: 102 DYSPSGKTARNYSSKCKLDQGIASRPDSYKDWEKLSMQNLLNCLEVSPEEFTNLSTSHHN 161

Query: 179 YIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDD 238
           +++ + +L      Y+ DGIV+V GGKF+ ++ LV+KT+RN    LP+E+FIPP+D   +
Sbjct: 162 FVEHVNKLVLPKGTYNNDGIVMVGGGKFTFMAYLVLKTLRNQGTTLPVEIFIPPIDTVKE 221

Query: 239 E-LCNT-LLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNY 296
           E  C + +L + +AKCI++S+ LP++ I E     GYQ K +AI ASSF+N+LLLDADN+
Sbjct: 222 ETFCKSEMLSELSAKCIYMSNILPQEMI-EKFDFKGYQFKSLAIIASSFENLLLLDADNF 280

Query: 297 PIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSV 356
           PIK++D IF  EPY+S GL+ WPD+WRR+T P YY + D  ++  +RVRN++DDITP  V
Sbjct: 281 PIKSLDKIFKHEPYNSTGLVMWPDFWRRTTQPIYYKLADIYVNVLKRVRNDIDDITPTKV 340

Query: 357 YTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILT 416
           Y++D  +   IP HDFEGT+PD STESGQLMINK KHL ++LLA+YYN+ GPNWYYPI +
Sbjct: 341 YSDDNFDFTKIPFHDFEGTMPDDSTESGQLMINKSKHLPTVLLALYYNVNGPNWYYPIFS 400

Query: 417 QKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYEN 476
           Q A GEGDKETFIA A F+ LPFYQV+  VG DGY     ++GVAM QHDFIQDY  Y+ 
Sbjct: 401 QNAHGEGDKETFIAAATFYRLPFYQVRTKVGADGYHTKDRFQGVAMAQHDFIQDYEHYQI 460

Query: 477 AKTFIEKKYPNTKQDKIDKEYSPFDFTDKFF-EDEHADPVIDVMFVHAHLPKFEPVALWE 535
           A+  I+K+Y N K  K D EY+   F D+FF +D      ID+MF+H++LPKF+P+ LWE
Sbjct: 461 AQREIKKRYSNVKDIKYDAEYAVQKFYDEFFNKDTTKYGEIDIMFLHSNLPKFDPLKLWE 520

Query: 536 ENDLM-QDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKW 594
           ++ L+ + G H RS++    +  YD+E ENFK +++++C +K   F YL ++L +  + W
Sbjct: 521 DSALIDETGKHFRSFSDPKIVKKYDIEYENFKIIKDVIC-DKGIHFSYLDEELQEKPQDW 579

Query: 595 QGLCKYIKDRHIFMEKTHEEHFS 617
             +C+YIKDR+IF++ TH++  S
Sbjct: 580 VSMCQYIKDRYIFLKDTHQDATS 602

>TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  503 bits (1296), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 247/517 (47%), Positives = 342/517 (66%), Gaps = 12/517 (2%)

Query: 105 NMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQI 164
           ++K  +S ++D ++   P+    RK   +C LD  +G   NDV  W+ L+Q ++  CL++
Sbjct: 55  SIKKTFSSIFDAIKKHSPDKEVVRKKNDNCLLDGTVGTGNNDVKNWHRLSQKSMEGCLEL 114

Query: 165 DEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINL 224
            +  +  LK+ H  YI  L+E+      Y G GI +V GGKFSLL+ LV+KTIR  +  L
Sbjct: 115 SDSEINTLKSKHDAYIQSLEEIAVEKIHYKGKGIAIVGGGKFSLLAFLVVKTIRKFETTL 174

Query: 225 PIEVFIPPMDEGDD-ELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAAS 283
           PIE+FIPP D  D+ E C  LLP+ NAKCI+LSD LP   I +  +   YQ K +AI AS
Sbjct: 175 PIEIFIPPQDVEDELEFCQQLLPEDNAKCIYLSDILPSQDIKK-YEFKRYQYKSLAILAS 233

Query: 284 SFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNER 343
           SF ++LL+DADN+PIKN+D IF +EPY+S GLI WPD+WRRS +P +Y+I   ++   +R
Sbjct: 234 SFDDLLLIDADNFPIKNLDGIFDNEPYTSTGLILWPDFWRRSANPKFYEITGIELDTKKR 293

Query: 344 VRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYY 403
           VRN +DD+TPP VYTED     D+P HDF GTLPD STESGQ+MINK KH+K+LLLA+YY
Sbjct: 294 VRNAIDDLTPPEVYTEDFSKLADVPFHDFSGTLPDPSTESGQMMINKGKHMKTLLLALYY 353

Query: 404 NMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPG--GYRGVA 461
           N+ GP+WYYPIL+Q A+GEGDKET IA A      FYQVK   G +GY +    G+RGVA
Sbjct: 354 NVNGPSWYYPILSQGAAGEGDKETVIAAALHNKAKFYQVKFKTGVEGYHQSNGRGFRGVA 413

Query: 462 MFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHAD-----PVI 516
           M QHDF+QD+  YE+A   I++ Y      + D  YS   F +K+    + D       I
Sbjct: 414 MLQHDFVQDFARYEDATARIKELYSTESFKQFDSGYSIDAFYEKYISQVNTDIPEEKRKI 473

Query: 517 DVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEK 576
           DV+FVH+HLPKF+PV LW+  DL++DG H RSYT   K+N++D+E++NF+  ++ +C + 
Sbjct: 474 DVLFVHSHLPKFDPVPLWQSQDLIEDGKHFRSYTSLKKINYFDIELQNFEIFDKYIC-QD 532

Query: 577 PFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHE 613
              F Y+K+++ D       LC YIK+R  ++++THE
Sbjct: 533 TIAFPYIKNEVKD--ADMPDLCNYIKNRLSYLQETHE 567

>NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa]
           {ON} Anc_3.188
          Length = 637

 Score =  493 bits (1269), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 248/524 (47%), Positives = 351/524 (66%), Gaps = 11/524 (2%)

Query: 95  VQMEEKRLRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLT 154
              EEK   E +  F+ +V++ +    PE   D KY     +   IG R+NDV  +  L+
Sbjct: 115 ASTEEKPSTETIHKFFDQVFNYINEFSPETKLDIKYNPSRLVTDAIGSRRNDVKNFFKLS 174

Query: 155 QDNLSKCLQIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVI 214
           +++L  CLQI ++ + MLKN H+ + + +  L    + Y  DGIV+V GGK+SLLS L I
Sbjct: 175 RNSLYDCLQISDQEIDMLKNYHQGFTNSIAPLELPKNTYQNDGIVIVGGGKYSLLSLLAI 234

Query: 215 KTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQ 274
           KT+R     LP+EV+I   +EGD E C+ +LP+YNAKCI + + L  D IN   K  GYQ
Sbjct: 235 KTLRKFNTTLPVEVYISQDEEGDLEFCDEILPQYNAKCISIKNILSNDLINT-FKFAGYQ 293

Query: 275 TKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDIL 334
            K +A+ +SSF+N+LLLDADN+PIK +DDIF  EPY S+ ++ WPD+WRR+T PSYYDI 
Sbjct: 294 YKSLAVLSSSFENLLLLDADNFPIKPLDDIFKQEPYLSKRMVMWPDFWRRTTHPSYYDIA 353

Query: 335 DRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHL 394
              ++++ R+RN+ DD+TP +VYT+  K+  +IP HDFEGTLPD+STESGQL++NK++HL
Sbjct: 354 HIFVNKSSRIRNSYDDVTPSNVYTDYSKSLDEIPFHDFEGTLPDLSTESGQLLLNKKEHL 413

Query: 395 KSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGY--T 452
           K++LLA+YYN+ GPNWYYPI +Q  +GEGDKETF+AGANF+NL +YQVK +    G+   
Sbjct: 414 KAILLALYYNVNGPNWYYPIFSQGVAGEGDKETFLAGANFYNLTYYQVKTYPRVSGHFNK 473

Query: 453 RPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQD--KIDKEYSPFDFTDKFFEDE 510
             G YRGVA+ Q DF+ DY  Y +A   I  KY +   +  K+D++Y   +F DK+FE E
Sbjct: 474 EDGSYRGVAILQSDFVDDYKRYSHAMDDINSKYKDLSPNEIKLDEDYDLQNFLDKYFELE 533

Query: 511 HADPVIDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEE 570
                 DVMF+HA+ PKF+PV L   +  + +G H RS+     + +YDLE+E FK L  
Sbjct: 534 GKQA--DVMFIHANFPKFDPVDLESGSSFIHEGKHFRSFDNLKDIKYYDLELETFKILNN 591

Query: 571 LLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
           ++C+E+   FKY+ DK  +++ K   +CKYI+DR  F+E+THEE
Sbjct: 592 IICVERK-HFKYIDDKGVEERGK---VCKYIEDRLKFLEETHEE 631

>CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
           type II membrane protein
          Length = 612

 Score =  491 bits (1264), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 247/524 (47%), Positives = 335/524 (63%), Gaps = 22/524 (4%)

Query: 106 MKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQID 165
           +K FY  V++ +    P G + R++   C    DI  R +    W  L+   LS C++I 
Sbjct: 86  IKDFYKTVFEHILDYSPAGKTAREFDDSCFDSGDISTRPDSYKNWKKLSYHQLSHCMKIS 145

Query: 166 EESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLP 225
              +  L+ +H+ Y+D + EL      Y G+GIV V GGKF+L++  +IK +R L   LP
Sbjct: 146 PSEINHLRGNHKSYVDKINELVLPKGSYKGEGIVTVGGGKFTLMALTMIKALRTLGTTLP 205

Query: 226 IEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSF 285
           +EVFIPP DEG+   C ++LP+YNAKCI++SD LP+D I +     GYQ K +A+  SSF
Sbjct: 206 VEVFIPP-DEGESTFCESVLPQYNAKCIYISDILPDDMI-QKFTFKGYQFKSLAMITSSF 263

Query: 286 KNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVR 345
           +N+LLLDADN P+K ID IF S+ + S GLI WPD+WRR+T P+YY+I +   +QN+RVR
Sbjct: 264 ENLLLLDADNIPVKKIDHIFESQIFRSAGLILWPDFWRRTTMPAYYEIANLPYNQNKRVR 323

Query: 346 NNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNM 405
           N  DDITPP VYT+   +  ++P HD EGTLPD STESGQL+I+K KHL +LLL++YYN+
Sbjct: 324 NAFDDITPPEVYTKPDGDLSEVPFHDMEGTLPDPSTESGQLLISKAKHLPTLLLSLYYNV 383

Query: 406 YGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTR--PGGYRGVAMF 463
            GPNWYYPI +Q+ +GEGDKETFI+ A+F++L +YQVK  VG DGY R    GYRGV M 
Sbjct: 384 NGPNWYYPIFSQRTAGEGDKETFISAASFYSLSYYQVKTSVGVDGYFRHDGSGYRGVGML 443

Query: 464 QHDFIQDYTAYENAKTFIEKKYPNTKQDK----IDKEYSPFDFTDKFFEDEHAD----PV 515
           QHDFIQD   Y  A  +   KY N + +K     D  Y P +F DKFF  +  D      
Sbjct: 444 QHDFIQDSKQYMEAFEYSNTKYNNLRSEKGSISYDPSYDPNEFFDKFFSRKKPDGGDESK 503

Query: 516 IDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLE 575
            DVMFVH +LPKF+P   W+ NDL+    H RS+     +  +D+E+ENFK   E LC  
Sbjct: 504 ADVMFVHCNLPKFDPYVSWDTNDLVYQTKHFRSFNNKKVIAQFDIELENFKFFNETLC-- 561

Query: 576 KPFE-----FKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
            P+E     FKYL +KLS+  E+W  +C YI  R  +++++H E
Sbjct: 562 -PYENGKGKFKYLDNKLSE--ERWPQMCDYISKRLQYLKESHNE 602

>KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON} 
          Length = 640

 Score =  491 bits (1265), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 261/626 (41%), Positives = 384/626 (61%), Gaps = 22/626 (3%)

Query: 4   NRRFSKLFKVSLVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIG--DSIGXXXXXXXX 61
           +R+FS++ K++++ + +LT  I+    +     L +Y   V SY+    +          
Sbjct: 5   SRKFSRVAKLTVLFLCLLTIFIVTT-SNYQQDTLDSYKSKVKSYLNYYTNGNMPTTHVAE 63

Query: 62  XXXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRSAG 121
                        ++E  L          EL  VQ + ++  + ++ FY ++++ + S  
Sbjct: 64  EEEEEEEEEVAPSSQEAPLFDNDDDDNNDELVEVQEQVEKF-DTIQEFYDEIFNAIISNS 122

Query: 122 PEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYID 181
           P   S + YG++C +D+ IG R  D   W+ LT DNLSKCLQ+ +E + ML   H+ Y+ 
Sbjct: 123 PTEESKKVYGKECIVDTSIGGRPGDHKDWHKLTYDNLSKCLQLSDEEVDMLHTKHKSYVS 182

Query: 182 GLKELGS-SPDMYSG-----DGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDE 235
            + ++   S ++ +G     +GIV+V GGK+SLLS L + TIR     LP+EVFIP  DE
Sbjct: 183 AINQIVEDSKELLNGQRTKKNGIVMVGGGKYSLLSLLSVMTIRKFGTTLPVEVFIPRDDE 242

Query: 236 --GD-DELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLD 292
             GD    CN LLP+YNAKCIF S+ L E K+ E+   +GYQ K +A+ ASSF N+LLLD
Sbjct: 243 LKGDFQSFCNELLPQYNAKCIFTSNVLSE-KLIENFHFNGYQHKSLALLASSFDNILLLD 301

Query: 293 ADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDIT 352
           +DN+PIKN+D IF +EP+   G++ WPD+WRR+TSP +Y I    I++N RVRN +DD+T
Sbjct: 302 SDNHPIKNLDSIFKAEPFVKNGMVLWPDFWRRTTSPKFYQIAGIPINKNTRVRNCIDDLT 361

Query: 353 PPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYY 412
           P  VY  +  N  D+P HD EGT PD+S+ESGQL+IN+ +HLKS+LLA+YYN  GP WYY
Sbjct: 362 PLEVYNNEEINIYDVPFHDTEGTFPDMSSESGQLLINRNRHLKSILLALYYNYNGPAWYY 421

Query: 413 PILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGG--YRGVAMFQHDFIQD 470
            I +Q A+GEGDKETFIAGA+F+ LP+YQVK      GY +PG   +RGVA+ QHD +QD
Sbjct: 422 SIFSQGAAGEGDKETFIAGAHFYGLPYYQVKTFPSVSGYHQPGNSEFRGVAILQHDLVQD 481

Query: 471 YTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADP---VIDVMFVHAHLPK 527
           Y  Y+ A   + K Y   +    D+ YS   F +K+F+  + +P    +D  FVHA+ PK
Sbjct: 482 YQRYQEASIGLGKTYEFPENVTYDENYSLGTFYNKYFDGGNNEPDVKEVDFAFVHANFPK 541

Query: 528 FEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKL 587
           F+PV+L E +  + +G H RS+T   KLN YD+E ENF  L + +C+ + + F Y++  +
Sbjct: 542 FDPVSLAEGSSFIFEGQHFRSFTDLTKLNGYDIEYENFVTLHDFVCVNRKY-FPYIEKSI 600

Query: 588 SDDKEKWQGLCKYIKDRHIFMEKTHE 613
           S  KE+++ +C+YI DR  F+  + E
Sbjct: 601 S--KEEYEKMCRYISDRLQFLRLSKE 624

>Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa]
           {ON} complement(135897..137927) [2031 nt, 677 aa]
          Length = 676

 Score =  493 bits (1268), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 259/520 (49%), Positives = 352/520 (67%), Gaps = 9/520 (1%)

Query: 104 ENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQ 163
           +++K FY +V++L+++  P G S R Y + C L+ DIG R      W  L+   L  CL+
Sbjct: 156 KSLKQFYGRVFELIQAHSPLGKSKRNYKEACLLNGDIGDRPEFYEVWYKLSMKELGNCLE 215

Query: 164 IDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKIN 223
           I +  ++ LK  H KYI  +  L    + + G GIV+V GGKFSLLS L+I  IRN    
Sbjct: 216 ISKAEMSKLKAKHAKYIADISSLSLPRNSFRGKGIVIVGGGKFSLLSFLIINAIRNQGTT 275

Query: 224 LPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAAS 283
           LP+EVF+P  D+G+D     LLP+ NAKCI+LSD LPE+ I++  K  GYQ K +A+  S
Sbjct: 276 LPVEVFMPN-DKGEDAEFCKLLPELNAKCIYLSDVLPEETIDQ-FKFGGYQFKSIALLLS 333

Query: 284 SFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNER 343
           SF ++LLLDADNYPIKN+D+IF  EPY S GL+ WPD+WRR+T+P YY I    ++  +R
Sbjct: 334 SFDDLLLLDADNYPIKNLDEIFTKEPYKSTGLVLWPDFWRRTTTPFYYKIAGITVNSKKR 393

Query: 344 VRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYY 403
           VRN++DDITPP VYTE++ N  ++P+HD EG++PD STESGQLMINK KHL ++LL++YY
Sbjct: 394 VRNSIDDITPPEVYTENMGNLVNVPLHDLEGSIPDGSTESGQLMINKSKHLATILLSLYY 453

Query: 404 NMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVA 461
           N+ GPNWYYP+ +QKA+GEGDKETF+A A F  LPFYQVK + G DGY +    G+RGVA
Sbjct: 454 NVNGPNWYYPMFSQKAAGEGDKETFVAAAVFNKLPFYQVKTNTGVDGYHQADNKGFRGVA 513

Query: 462 MFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFF----EDEHADPVID 517
           M Q DF QDY  Y+ AK  IE +Y +      DK YS  DF  K+     +        D
Sbjct: 514 MLQFDFHQDYLRYKRAKEAIEYQYQDKNLRTYDKRYSLNDFYRKYIMINDDRNGGTSEAD 573

Query: 518 VMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKP 577
           VMFVH++LPKF+PV LW   DL++ G H+RS+    +LN+YD+E+ENF    + LCL++ 
Sbjct: 574 VMFVHSNLPKFDPVGLWRGQDLIEHGKHIRSFRNLQRLNNYDIELENFTIFYKHLCLKRR 633

Query: 578 FEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617
             FKYL+D+L D++E W+ +CKYIKDR  F+  +H+   +
Sbjct: 634 -SFKYLEDELGDNEEDWKDMCKYIKDRVTFLNMSHQRAIT 672

>KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  476 bits (1226), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 253/624 (40%), Positives = 360/624 (57%), Gaps = 58/624 (9%)

Query: 4   NRRFSKLFKVSLVLVAV-LTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGXXXXXXXXX 62
           NRR +KLFK    LV V L    L HH  +  K +  Y + +  Y+G +           
Sbjct: 11  NRRLAKLFKAVFFLVIVCLVCAGLTHHFHDGPKTVDEYKEFLQGYLGGNANTTVTVV--- 67

Query: 63  XXXXXXXXXNDDNKETQLEXXXXXXXXXELNFVQMEEKRLRENMKTFYSKVYDLLRSAGP 122
                    ND +K                             +K++Y+ V++ L    P
Sbjct: 68  ---------NDADK-----------------------------IKSYYNTVFENLLLFSP 89

Query: 123 EGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYIDG 182
           +G + R YG  C L+  IG   +++ K+  L+ +NL  CL++  E L+ LK SH  ++  
Sbjct: 90  KGETARAYGDKCILNEAIGTTSDNIPKFERLSYENLLDCLKLSNEELSALKLSHNFFVQS 149

Query: 183 LKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCN 242
           L ++     MY GDGIV+V GGK+SL++ LVIK +R+   +LP+EVFIPP +E + E C 
Sbjct: 150 L-DVKYPKGMYQGDGIVMVGGGKYSLMAYLVIKHLRSSGTSLPVEVFIPPNEEDETEFCE 208

Query: 243 TLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNID 302
           T LP+ NA+CIF+   LP   I +     GYQ K +A+ +SSF+NVLLLDADNYP++ +D
Sbjct: 209 TALPELNAQCIFIDRILPSAMI-KTFHFKGYQFKSLALVSSSFENVLLLDADNYPVRRLD 267

Query: 303 DIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLK 362
           DIF  EP+ S GLI WPD+WRR+T+P +Y+I    I     VR + DD+TPP VY     
Sbjct: 268 DIFKQEPFKSTGLILWPDFWRRTTTPLFYNISGVAIDLTSPVRYSFDDLTPPEVYFNSTM 327

Query: 363 NHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGE 422
           +   IP++DF G +PDVSTESGQL+INK  HLK++LL++YYN+ GP WYYPI+ Q+A GE
Sbjct: 328 DRSKIPVNDFAGAMPDVSTESGQLLINKRTHLKTILLSLYYNVNGPAWYYPIIAQRAPGE 387

Query: 423 GDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKTFIE 482
           GDK+TFIA ANF+ LP+YQVK  VG DGY+  G Y GV M Q+DF+QDY  Y++A+  I 
Sbjct: 388 GDKDTFIAAANFYGLPWYQVKTRVGIDGYSEDGQYHGVGMLQYDFVQDYELYQSARRDIT 447

Query: 483 KKYPNTKQDKI---------DKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVAL 533
            KY      K          D+ YS   F +K+F  E +     VMF+HA+ PKF+P++L
Sbjct: 448 AKYGVAGPSKTGQLRSEIAYDENYSLDTFEEKYFNKEKSGH--KVMFIHANFPKFDPLSL 505

Query: 534 WEENDLM-QDGSHVRSYTKYDKLNHYDLEMENFKALEELLC--LEKPFEFKYLKDKLSDD 590
           W++   + + GS  R+Y    K N++D+E+ NF + E L C   +    F Y+   L  +
Sbjct: 506 WQDKKFINKQGSTYRTYNNLGKFNYWDIELYNFNSFETLFCSGADSVTWFPYMNRALQGN 565

Query: 591 KEKWQGLCKYIKDRHIFMEKTHEE 614
               + +C YI+ R   +E+TH E
Sbjct: 566 TNDRESMCSYIRMRLDHLEQTHHE 589

>Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186W
           (MNN5) - putative Golgi alpha-1,2-mannosyltransferase
           [contig 114] FULL
          Length = 558

 Score =  405 bits (1041), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 216/524 (41%), Positives = 314/524 (59%), Gaps = 29/524 (5%)

Query: 112 KVYDLLRSA--------GPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQ 163
           KVY  L SA         P+   +    Q C +   +G  K D     V   +NL  C +
Sbjct: 38  KVYSDLFSALEKHKPIDAPKNMREAVKQQGCNMKG-VGVNKGDDVSPTVY--ENLDACFR 94

Query: 164 IDEESLAMLKNSHRKYIDGLK-------ELGSSPDMYSGD-GIVLVAGGKFSLLSTLVIK 215
             +     L+  H  Y+  L+       E G   +++  D G V V GG+FSLLS  +I+
Sbjct: 95  PSKAQFEGLQAPHTAYLAALRSTFNYQNEPGVFNELFPNDKGFVTVGGGRFSLLSYTMIR 154

Query: 216 TIRNLKINLPIEVFIPPMDE-GDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQ 274
           T+R     LPIEV IPP DE G++  C  +LPK N +C+F  D LP   I ED K   YQ
Sbjct: 155 TMRERGSTLPIEVVIPPQDEKGEEHFCQEILPKLNGRCVFFGDTLPPS-IVEDWKFKSYQ 213

Query: 275 TKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDIL 334
            KV+A+  SSFK ++ +DAD+ P+KN+DD+F S+ +   GL+ WPD WRR T+P +Y + 
Sbjct: 214 IKVMALLLSSFKKIVFIDADDLPLKNLDDVFESKVFKKNGLVLWPDLWRRMTAPVFYRLA 273

Query: 335 DRDISQNERVRNNLDDITPPSVY-TEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKH 393
           + D    +RVRN  DDI+P S Y   + K  K IP HDF GT+PD +TESGQ++I+K +H
Sbjct: 274 NIDTDLTKRVRNLGDDISPVSRYLNPNAKEQKPIPFHDFAGTIPDPTTESGQMVIDKVRH 333

Query: 394 LKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTR 453
            ++LLLA+YYN+YGP+WYY + +Q  +GEGDKETF + A+   LP+YQV+  +  DGY+ 
Sbjct: 334 FQTLLLALYYNVYGPDWYYALFSQGTAGEGDKETFASAAHVLELPYYQVRTKLSFDGYSD 393

Query: 454 P--GGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEH 511
           P  GG+RGVA++QHD  QDY  YE A+  ++ +       K D +  P DF     + E 
Sbjct: 394 PKDGGFRGVALYQHDCTQDYETYEQARELVKSQPDKYSAFKEDYDSEP-DFYQSLMKPE- 451

Query: 512 ADPVIDVMFVHAHLPKFEPVALWEEND-LMQDGSHVRSYTKYDKLNHYDLEMENFKALEE 570
             P ++VMF HA   KF+P  L++E   L +DG+  RS+ +  ++ H+D+E+ NF+ LEE
Sbjct: 452 GKPEVEVMFAHASFHKFDPWQLFKEKVYLNEDGTQFRSFRRLHRIKHFDIELFNFEVLEE 511

Query: 571 LLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
            +C E+P  F+Y +DK    +E+W  +C+Y+KDR  +++KTH+E
Sbjct: 512 AMCSEQPIRFRYFEDKFK--REEWPKVCQYVKDRVEYLKKTHDE 553

>KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150
           YJL186W
          Length = 579

 Score =  402 bits (1034), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 218/532 (40%), Positives = 328/532 (61%), Gaps = 32/532 (6%)

Query: 108 TFYSKVYDLLRSAGP-EGTSDRKYGQ--DCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQI 164
            FYS+VY+LL S+ P +  SD+   +   C L  D+G   ND+ ++  L+ DNL +C  +
Sbjct: 47  AFYSEVYELLISSKPMDPPSDKNSFRLTSCDLPKDVGI--NDLDRFEKLSFDNLQRCYHL 104

Query: 165 DEESLAMLKNSHRKYIDGLKEL-GSSPDMYSGD-----GIVLVAGGKFSLLSTLVIKTIR 218
             E    L+ +H  Y+  +K+L  +  ++ S D     GI+ V GG++S+L   +I+ +R
Sbjct: 105 SNEQAQDLQKAHSSYVKSIKDLIDNHSNIISKDDEKKKGILTVGGGRYSVLLFTMIQKLR 164

Query: 219 NLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVV 278
                LP+EV IPP DEGDDE CN +LP++NAKCI+  D+LP + +++ + +  YQ K +
Sbjct: 165 ETGTTLPVEVLIPPQDEGDDEFCNVILPQFNAKCIYFKDYLPPNLLDK-LVLKSYQIKAL 223

Query: 279 AIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDI 338
            +  +SF  +L LDADNYP+KN++ IF +E +   GLI WPD WRR T P+YY+I D D 
Sbjct: 224 GLLMTSFNQILFLDADNYPMKNLNYIFETESFQKYGLITWPDIWRRYTPPAYYNIADIDF 283

Query: 339 SQNERVRNNLDDITP--------PSVYTEDLK----NHKDIPMHDFEGTLPDVSTESGQL 386
           +  +RVR   DDI+P        P++  ++ K        +P HD EGT+ D++TESGQ+
Sbjct: 284 NLEKRVRFETDDISPVSRYDDIFPTLLNDERKLTEYTSSKVPFHDLEGTISDLTTESGQM 343

Query: 387 MINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHV 446
           +I+K+KHL +LLLA YYN YGP+WYY + +  +SGEGDKETFI+ A+    P+YQVK  V
Sbjct: 344 LIDKKKHLDTLLLAFYYNFYGPSWYYNMFSLGSSGEGDKETFISAAHALGKPYYQVKSKV 403

Query: 447 GTDGYTR-PGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYS-PFDFTD 504
             DG+     G++G+ + QHDF QDY  ++NA   +E      K  K + +Y     FTD
Sbjct: 404 EFDGFFHDKDGFQGLGLMQHDFEQDYQVHKNA--MLEVAGNPDKYSKYESDYKLETSFTD 461

Query: 505 KFFED-EHADPVIDVMFVHAHLPKFEPVALWEEND-LMQDGSHVRSYTKYDKLNHYDLEM 562
           +F     +   ++D+MFVHA   KFEP+ L  +N   M D S +R + + D++N++DLE+
Sbjct: 462 QFLRKYNNKKDLVDIMFVHASFFKFEPLELHSKNRYYMSDNSPLRGFKRMDRMNNFDLEL 521

Query: 563 ENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
            NF+ L + LC  KP  FK  +DK   D ++W+ +C+Y+  R  F++KTHEE
Sbjct: 522 FNFQILRDNLCSTKPVAFKVYEDKY--DTDEWKSVCEYLDKRVTFLKKTHEE 571

>ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]
           {ON} similar to uniprot|P46982 Saccharomyces cerevisiae
           YJL186W MNN5 Alpha-1 2-mannosyltransferase responsible
           for addition of the second alpha-1 2-linked mannose of
           the branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 579

 Score =  383 bits (983), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 198/526 (37%), Positives = 315/526 (59%), Gaps = 27/526 (5%)

Query: 107 KTFYSKVYDLLRSAGPEG--TSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQI 164
           + FYS ++  ++   PEG    D    ++   D DI     D  K    + +NL  C  +
Sbjct: 65  RNFYSALFQAIQDGTPEGQLIMDSVRDKEKCRDGDISAFSTDFEK---SSYENLDACFHL 121

Query: 165 DEESLAMLKNSHRKYIDGLKELGSSPD-----MYSGDGIVLVAGGKFSLLSTLVIKTIRN 219
            ++ L ML + H K+++ +     S         +  GIV + G K+S++S  +++T+R+
Sbjct: 122 SDDRLGMLASKHEKFVEAINSWKFSKSDIDKLFPNESGIVTIGGSKYSVISLTMLETLRD 181

Query: 220 LKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVA 279
               LP+EV IPP DEGD++ CN +LPK  AKC+++++ LP D + +++KI+ YQ K+V 
Sbjct: 182 RGSKLPVEVMIPPGDEGDEDYCNVVLPKLGAKCVYMAEKLPPDVV-KNVKIERYQNKIVG 240

Query: 280 IAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDIS 339
           +  SSFKNV+ +DAD  P+K +DD+F S  Y   GLI WPD W+R T+P++Y + +  + 
Sbjct: 241 LLLSSFKNVVYIDADCLPLKPLDDVFNSPAYKKHGLILWPDIWKRVTAPAFYKLANIPLD 300

Query: 340 QNERVRNNLDDITP-----PSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHL 394
             +RVR   DD++P     PS    +++  K +P HD EGT+ D +TESGQ++INK  HL
Sbjct: 301 LKKRVRFGADDVSPLSRYEPSSEASEVRMLKKVPFHDLEGTMSDPTTESGQMLINKVDHL 360

Query: 395 KSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP 454
           +SLLL+ YYN++G  WYY +L+Q  SGEGDKET IA A+   LP+YQVK  V  DG++  
Sbjct: 361 RSLLLSAYYNIHG-KWYYKMLSQGTSGEGDKETLIAAAHALKLPYYQVKTDVRFDGFSDH 419

Query: 455 GGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFED--EHA 512
            G+ G++++Q DF QDY AY+ A  ++ +      + ++      +D   +F+E   +  
Sbjct: 420 EGFHGISLYQQDFQQDYEAYKKAIRWVRR-----HKSELSAYEQNYDVKKQFYEKLLKPG 474

Query: 513 DPVIDVMFVHAHLPKFEPVALWEENDLM-QDGSHVRSYTKYDKLNHYDLEMENFKALEEL 571
           D  ++ +F H    KFEP+ L E++  + + G H R + + + + H+DLEM NF+ LE+ 
Sbjct: 475 DKEVESLFGHISYHKFEPIELAEKSIYIDEKGKHFRGFRRKEVIRHFDLEMFNFEVLEKY 534

Query: 572 LCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617
           LC E P +F Y KD++  D  +W+ +C Y+K    +++ THEE FS
Sbjct: 535 LCKENPVKFVYYKDRM--DTPEWERMCNYLKSHVSYLQDTHEELFS 578

>Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON}
           (129140..130957) [1818 nt, 606 aa]
          Length = 605

 Score =  382 bits (981), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/532 (39%), Positives = 312/532 (58%), Gaps = 32/532 (6%)

Query: 104 ENMKTFYSKVYDLLRSAGPEGTSDRKYGQD---CPLDSDIGQRKNDVHKWNVLTQ-DNLS 159
           +N K FY K++D L ++ P         +D   C L         + H   +LT  ++LS
Sbjct: 75  KNSKDFYYKLFDALAASKPVRPPKDANFRDEDKCNLKDIASYSSKEDH---LLTSYESLS 131

Query: 160 KCLQIDEESLAMLKNSHRKYIDGLKEL-----GSSPDMYSGD-GIVLVAGGKFSLLSTLV 213
            C  + +     L NSH  + + +++       ++  M+  D GIV + GGKFS+    +
Sbjct: 132 NCYNLTQSQYDDLHNSHELFTEHVEKSFQLSNSAAKSMWPNDKGIVAIGGGKFSVYILSM 191

Query: 214 IKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINE-DIKIDG 272
           IKT+R    +LP+E+ +P     D E C+  LP  NAKC++  D LP++   +  IKI  
Sbjct: 192 IKTLRAKGTHLPVEILMPLASPEDKEFCDKFLPPLNAKCVYFKDVLPKEFTGKYPIKISR 251

Query: 273 YQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYD 332
           +Q KV +I  SSF+NV+ +D+DN  +K++D +F +  Y   GLI WPD WRR T+P YY 
Sbjct: 252 FQYKVFSILFSSFRNVMYIDSDNLALKSLDKVFDTVAYRENGLILWPDIWRRVTAPIYYS 311

Query: 333 ILDRDISQNERVRNNLDDITPPSVY--TEDLKN---HKDIPMHDFEGTLPDVSTESGQLM 387
           +     +  +RVRN +DD++P S Y   E+  N    + +P HDFEGTLPD++TESGQL+
Sbjct: 312 VAGVPYNLEKRVRNMVDDLSPVSRYDNVENPGNDYRTRKVPFHDFEGTLPDLTTESGQLV 371

Query: 388 INKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVG 447
           ++K +H K+LLLA YYN YGP+WYY I +Q  +GEGDKETFIA A+ F LP+YQVK ++ 
Sbjct: 372 VDKVRHFKTLLLATYYNFYGPDWYYRIFSQGGAGEGDKETFIAAAHKFGLPYYQVKTNLK 431

Query: 448 TDGYTRPG-GYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKF 506
            DGY     G+RG+ ++QHDF QDY  Y+ AK+++ + Y   K  + D EYS    ++K 
Sbjct: 432 FDGYNDAKEGFRGIGLYQHDFDQDYKQYQAAKSYVSRNY--AKLSQYDPEYS----SEKS 485

Query: 507 FEDEHADPV----IDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEM 562
           FE E   P     ID MFVH    KF+P  L +E   M+DG H R + +++ L  +DLE+
Sbjct: 486 FEKELMKPSNGKDIDAMFVHVSFYKFDPFVLAKEKRYMRDGKHFRGFGRFELLKGWDLEL 545

Query: 563 ENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
           + F    +  C +   EF Y K K+S  + +W+ +C Y+  R  F+E+THEE
Sbjct: 546 DTFTLFRDTFCSDNVIEFSYYKPKMS--QPEWKDMCNYLSSRVAFLEETHEE 595

>NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150
          Length = 587

 Score =  381 bits (978), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/510 (40%), Positives = 313/510 (61%), Gaps = 28/510 (5%)

Query: 122 PEGTSDRKYGQDCPLDSDIGQRKNDVHKWN-VLTQDNLSKCLQIDEESLAMLKNSHRKYI 180
           P    D +  + C    DI    +D  K+N  L+ +NL++C ++    L  LK SH  ++
Sbjct: 82  PSNPDDLRDTEKCKWHGDISV--HDFDKFNEYLSYNNLNECYKLSNIQLNNLKRSHSGFV 139

Query: 181 DGLKELGSSPD--MYSG-----DGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPM 233
           + +    S+ D  + SG     +GIV V GGK+++L   +I+ +R     LP+EV IPP 
Sbjct: 140 ESILSEFSTKDDKLTSGLFPNNEGIVTVGGGKYTVLLMTMIEKLRQSGTTLPLEVIIPPQ 199

Query: 234 DEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDA 293
           DEGDDE CN +LP YN KCI+  D LP D++++ + I G+Q K +AI  SSFK  L LDA
Sbjct: 200 DEGDDEFCNNVLPNYNGKCIYFKDVLP-DQLSDKLVIKGFQLKPLAILLSSFKKALFLDA 258

Query: 294 DNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITP 353
           DN  +K++D+IF ++ +  + LI WPD WRR T+P+YY I +  +   +R+RN  DD++P
Sbjct: 259 DNLAMKDLDNIFNTQAFKQKRLIVWPDVWRRFTAPAYYKIANIKLDLGKRIRNLNDDVSP 318

Query: 354 PSVYTEDLKNH----KDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPN 409
           PS Y ++ +N     +++P HD +GT+PD ++ESGQ++I+K +H  +L+L++YYN+YGP 
Sbjct: 319 PSRYDDNSENSAQYLENVPFHDLKGTIPDPTSESGQMVIDKIEHFHTLILSLYYNLYGPP 378

Query: 410 WYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYT-RPGGYRGVAMFQHDFI 468
           WYY + +Q  SG+GDKETFIA A+    P+YQV   +G  GY     G++GV + QHDF 
Sbjct: 379 WYYRMFSQGTSGQGDKETFIAAAHALGKPYYQVHTKMGFKGYNDEKLGFQGVGLLQHDFE 438

Query: 469 QDYTAYENAKTFI---EKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHL 525
           QD+   + A   I   E +Y   KQD      +  DF D   +    D  ID+MF+HA  
Sbjct: 439 QDFKQLQLASKTINENESEYSKFKQDY----KATVDFDDSLMKP--IDGPIDIMFLHASF 492

Query: 526 PKFEPVALWEENDLM-QDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLK 584
            K+EP+ L  E+  + +DGSH R ++  ++LN++DLE+ NFK L + LC E+   FKY K
Sbjct: 493 FKYEPLDLIREHRYVKEDGSHFRVFSGLERLNYFDLELFNFKILNKFLCTEEMIHFKYYK 552

Query: 585 DKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
           +   + K +W  +CK++K+   ++E TH+E
Sbjct: 553 N--VESKPEWSDMCKFLKEHTEYLESTHKE 580

>NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa]
           {ON} Anc_1.150
          Length = 586

 Score =  379 bits (974), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/534 (40%), Positives = 316/534 (59%), Gaps = 38/534 (7%)

Query: 106 MKTFYSKVYDLL---RSAGPEGT-SDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKC 161
           ++ FY  +++ +   R   P G   D +    C    DI    +       L+ +NL +C
Sbjct: 57  VEAFYLDLFNSINQYRPLNPPGNWEDLRDKDKCKWSGDISVNDDGRDANERLSMENLDEC 116

Query: 162 LQIDEESLAMLKNSHRKYIDGLK-------ELGSSPDMYSGDGIVLVAGGKFSLLSTLVI 214
            ++    L  LK +H  Y+  ++       E  ++    +  GIV + GG++++L   +I
Sbjct: 117 FKLSSIQLNNLKRAHSGYVKNIRDKFDDKNERLTNSLFPNNVGIVTIGGGRYTVLLMTMI 176

Query: 215 KTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQ 274
             +R+   +LPIEV IPP DEGDD+ CN +LPK+N KC+F  D LP D++N+ + +  YQ
Sbjct: 177 AKLRDTGTSLPIEVIIPPEDEGDDDFCNVILPKWNGKCVFFKDVLP-DELNKKLMLQSYQ 235

Query: 275 TKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDIL 334
            K +A+  SSFK +L LDADNY +K++D IF SEP+   GLI WPDYWRR T P+YY I 
Sbjct: 236 IKPLAVLLSSFKKILFLDADNYAMKDLDHIFESEPFIENGLIVWPDYWRRVTPPAYYKIA 295

Query: 335 DRDISQNERVRNNLDDITPPSVYTEDLKNH----KDIPMHDFEGTLPDVSTESGQLMINK 390
           D +IS+ +R+RN  DDITPPS Y   LK+     K++PMHD EGT+PD ++ESGQ++I+K
Sbjct: 296 DINISKKKRIRNINDDITPPSYYDNKLKDRDHLLKEVPMHDLEGTIPDPTSESGQMVIDK 355

Query: 391 EKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDG 450
            KH  +LLL++YYN+YGP+WYY I +Q  SG+GDKETFIA A+  N P+YQV   +G  G
Sbjct: 356 VKHFHTLLLSLYYNLYGPSWYYQIFSQGTSGQGDKETFIAAAHALNKPYYQVTTSLGLKG 415

Query: 451 YTRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPF--------DF 502
           +     +RG+ + Q DF QDY  ++  K         T QD ++ EYS F        +F
Sbjct: 416 FFYENEFRGIGLLQRDFQQDYAQHQLVK--------QTIQDHLE-EYSEFKEDYKVADEF 466

Query: 503 TDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDLM-QDGSHVRSYTKYDKLNHYDLE 561
             K     +  P +DVMFVHA   K+EP  L+ E   +  DG+H R ++   + N++D+E
Sbjct: 467 NKKLMIPPNGQP-LDVMFVHASFYKYEPWDLYNERRYVNSDGTHFRGFSDLKEFNYFDME 525

Query: 562 MENFKALEELLCL-EKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
           + NFK L + LC   K  EFK+  DK+     +W  +C Y+KD   F+++TH E
Sbjct: 526 LFNFKILRDTLCSPNKKVEFKFYNDKVF--SPEWDNMCTYLKDHVNFLQETHSE 577

>SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 611

 Score =  369 bits (946), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/526 (40%), Positives = 312/526 (59%), Gaps = 28/526 (5%)

Query: 109 FYSKVYDLLRSAGPEGTSDRKYG--QDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDE 166
            YSK++  L+   P      K    Q   +  D+G    D  +++ L  +NL +C  +  
Sbjct: 89  LYSKLFGYLQRYKPVAPPKDKAALRQSGCVMRDVGLA--DDSRFSNLAYNNLDRCYNLSP 146

Query: 167 ESLAMLKNSHRKYIDGLK---ELGSSPDMY-----SGDGIVLVAGGKFSLLSTLVIKTIR 218
           E    L ++H KY+  LK   ELG    +      +  GIV V GG+FSLLS  +I+ +R
Sbjct: 147 EQFDSLHSNHAKYVSKLKKEFELGPDSPLLDKLFPNEKGIVTVGGGRFSLLSLTMIRVLR 206

Query: 219 NLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVV 278
                LP+EV IPP DEG+D+ CN +LP  N  C++ SD L +  +N+ +  + YQ K V
Sbjct: 207 ERGTTLPVEVVIPPADEGEDDFCNNVLPALNGTCVYFSDVLSKSTLNQ-VTFERYQIKGV 265

Query: 279 AIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDI 338
           A+  SSFKN + LDADN+ IK +D+IF SE Y   GL+ WPD WRR T+P +Y++ D ++
Sbjct: 266 ALLLSSFKNTIFLDADNFAIKPLDNIFESEAYLEHGLVLWPDLWRRVTAPVFYNVSDVEL 325

Query: 339 SQNERVRNNLDDITPPSVYTE---DLK-NHKDIPMHDFEGTLPDVSTESGQLMINKEKHL 394
              +R R   DD+TP S Y +   DL  N  ++P+HD +G +PD S+ESGQ++++K +H 
Sbjct: 326 DLTKRARFIGDDVTPASKYHKPDADLAYNKAEVPLHDLDGAIPDPSSESGQMIVDKREHF 385

Query: 395 KSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGY--- 451
           ++LLLA+YYN YGP+WYY + +Q  SGEGDKETF+A A+  + P+YQVK  +G  GY   
Sbjct: 386 QTLLLALYYNYYGPDWYYRMFSQGTSGEGDKETFVAAAHVLSKPYYQVKSKLGFAGYWDE 445

Query: 452 TRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEY-SPFDFTDKFFEDE 510
              GG++G A+ QHDF+QDY  ++ A   +   Y   +  + D  Y S  DF  K    +
Sbjct: 446 YTDGGFKGAALLQHDFVQDYGQHKKALEVVRSNY--DEYTRFDPNYNSEKDFYKKLMVPD 503

Query: 511 HADPVIDVMFVHAHLPKFEPVALWEENDLMQ-DG-SHVRSYTKYDKLNHYDLEMENFKAL 568
             +   DVMFVHA   KF+P  L+     ++ DG S  RSY    +L  +DLE+ NF+ L
Sbjct: 504 GKEET-DVMFVHASFHKFDPWDLYRRKTYLKPDGKSQFRSYRDLKRLGGFDLELFNFEVL 562

Query: 569 EELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
           E+ LC  K   FKYL+DK++   ++W G+C+Y+ DR  F+++TH E
Sbjct: 563 EDALCAGKQIGFKYLQDKVT--SQEWPGMCEYVHDRVQFLKETHAE 606

>TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {ON}
           Anc_1.150 YJL186W
          Length = 605

 Score =  363 bits (931), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/532 (38%), Positives = 297/532 (55%), Gaps = 38/532 (7%)

Query: 109 FYSKVYDLLRSAGPEGTSDRKYGQ----DCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQI 164
           FY+ ++  +    P   S +   Q    +C L+SDI    N     + ++ ++L  CL I
Sbjct: 76  FYTFMFSAIARGKPVNPSVKDLKQSKRSECKLESDISMTDNSPGSLSRVSFNSLLNCLSI 135

Query: 165 DEESLAMLKNSHRKYIDGLKELGS---SPDMY-----SGDGIVLVAGGKFSLLSTLVIKT 216
               L  LK  H  +I  L+   S    P+       +G GIV + GGKFS+L+  VIK 
Sbjct: 136 SRPQLDNLKYVHSNFIQLLEAKMSELTKPEFLDQIFPNGRGIVTIGGGKFSVLAMNVIKV 195

Query: 217 IRNLKINLPIEVFIPPMDEGDD-ELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQT 275
           +R     LP+EV IPP DE ++ + CN  LP YNAKC+F  D LP+    E++++ GYQ 
Sbjct: 196 LRKTGSTLPVEVVIPPQDEKNEVDFCNNFLPNYNAKCVFFKDVLPK-HYAENLRLKGYQI 254

Query: 276 KVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILD 335
           KV+A+  SSFK ++ LD+DNYP+K++D +F ++ Y   GLI WPD WRR T+P YYDI +
Sbjct: 255 KVMALLISSFKEIIFLDSDNYPLKSLDHVFDADIYKEAGLILWPDIWRRVTNPMYYDIAN 314

Query: 336 RDISQNERVRNNLDDITPPSVYT---------EDLKNHKDIPMHDFEGTLPDVSTESGQL 386
             +  N+RVR   DDI+PP+ YT         ++++N   IP HD  GT+PD STESGQ+
Sbjct: 315 VSVDINQRVRYGTDDISPPNRYTIPRVHKNNEKEIENKNTIPFHDLLGTVPDASTESGQM 374

Query: 387 MINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHV 446
           ++NK KHL +LLLA YYN YGP WYY + +Q  +GEGDKETFI+ A+  N P+YQVK  V
Sbjct: 375 IVNKAKHLDTLLLAAYYNFYGPAWYYRLFSQGTAGEGDKETFISAAHTLNKPYYQVKSKV 434

Query: 447 GTDGYTRPG-GYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDK 505
           G DG+     G++G+ + QHDFIQDY  Y  AK  +   Y +    K D     ++    
Sbjct: 435 GFDGFWDSKLGFQGIMLLQHDFIQDYEHYSKAKNQVIDHYDDYYHFKSD-----YNLDRD 489

Query: 506 FFEDEHADPVIDVMFVHAHLPKFEPVALWEENDLM--QDGSHVRSYTKYDKLNHYDLEME 563
           F+++   +  I +MF H    K+EP  L+ E   +  +   HVR      +   +DLE+ 
Sbjct: 490 FYDNLIHEKDISIMFGHTSFFKYEPWVLYHERRYIDHETQQHVRGLRSIGRALDFDLELF 549

Query: 564 NFKALEELLCL-----EKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEK 610
            F  L + LC      +    F + KD        W  +C+Y+ +R  +++K
Sbjct: 550 CFDNLLQTLCKGNANDKSSIRFAFYKD--IQGTPLWDSMCEYLDNRVSYLQK 599

>KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 562

 Score =  360 bits (925), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 199/541 (36%), Positives = 304/541 (56%), Gaps = 39/541 (7%)

Query: 97  MEEKRLRENMKTFYSKVYDLLRSAGP-EGTSDRKYG---QDCPLDSDIGQRKNDVHKWNV 152
           ++   LRE +   YS V+D L    P     DR+       C +   +G  + D    + 
Sbjct: 31  LDTPSLRERV---YSDVFDALLQYRPVRPPKDRQAAVRQAGCEMKG-VGVNRGDA--VDA 84

Query: 153 LTQDNLSKCLQIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGD------------GIVL 200
           +  +NL +C +  +     L+  H  ++  L+   +    Y  D            G V 
Sbjct: 85  MLYENLDRCYRPTKAQFEGLQAPHSAFLTQLRTTFA----YEADSPVFERLFPRERGFVT 140

Query: 201 VAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDE-GDDELCNTLLPKYNAKCIFLSDFL 259
           V GG+FSLL+  +++ +R     LP EV IPP D  G++  CN +LP+ NA+C+F  D L
Sbjct: 141 VGGGRFSLLAYSMLRALRARGSKLPAEVVIPPQDAAGEEHFCNEVLPELNARCVFFEDAL 200

Query: 260 PEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWP 319
           P   + E    + YQ K VA+  SSFK ++ +DAD++PI+N+D +F SE     GL+ WP
Sbjct: 201 PR-ALVETWDFERYQIKAVALLLSSFKKIVFIDADDFPIQNLDSLFDSEVLREHGLVLWP 259

Query: 320 DYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKN----HKDIPMHDFEGT 375
           D WRR+T+P +Y + + D+    RVRN  D+++P S YT+  ++     K  P HDF GT
Sbjct: 260 DLWRRATAPVFYRLANIDVDLRRRVRNMGDNLSPASRYTDPDQDPEQLQKIAPFHDFAGT 319

Query: 376 LPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFF 435
           +PD +TESGQ++I+K +H ++LLLA+YYN+YGP WYY + +Q  +GEGDKETF   A+  
Sbjct: 320 VPDPTTESGQMVIDKVRHFQTLLLALYYNVYGPEWYYSLFSQGTAGEGDKETFATAAHVL 379

Query: 436 NLPFYQVKKHVGTDGYTRPG--GYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKI 493
            LPFYQVK  +  DGY  P   G+RGVA++QHD ++DY  Y  A+  I++   +    K 
Sbjct: 380 GLPFYQVKNKLAFDGYFHPNGDGFRGVALYQHDCVEDYLLYCRARDIIKENQDSFSAYKP 439

Query: 494 DKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDLM-QDGSHVRSYTKY 552
           D +  P DF       E   P I VMF HA   KF+P  L+ E   +  DG+H RS+   
Sbjct: 440 DYDPEP-DFYKSLMAPE-GHPEIPVMFAHASFHKFDPWQLYHEKVYLDNDGAHFRSFHNI 497

Query: 553 DKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTH 612
            ++ ++D+E+  F+ L++ +C + P  FKYL+DK       W  +C+Y++DR  +++ TH
Sbjct: 498 KRIGNFDIELFVFEGLQKAICSDNPIRFKYLEDKFI--HADWPKVCQYVEDRVKYLQDTH 555

Query: 613 E 613
           +
Sbjct: 556 D 556

>TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {ON}
           Anc_1.150 YJL186W
          Length = 709

 Score =  355 bits (912), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/537 (38%), Positives = 309/537 (57%), Gaps = 38/537 (7%)

Query: 104 ENMKTFYSKVYDLLRSAGP------EGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDN 157
           +N+  FY K+++ +  A P      +  + RK G      +   +++N    +++L+  N
Sbjct: 94  KNVHDFYYKLFNAISKARPVTPPKDKMAAYRKEGCKIKDVASYDKKEN----FSLLSYSN 149

Query: 158 LSKCLQIDEESLAMLKNSHRKYID----GLKELGSS--PDMYSGD-GIVLVAGGKFSLLS 210
           L +C ++ +     L+ +H ++++     + E+  +    ++  + GIV+V GGKFS++S
Sbjct: 150 LDECFKLSDSQTKDLQVNHERFVNFIDTDIAEMDPAIKEQLWPNEKGIVIVGGGKFSIIS 209

Query: 211 TLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKI 270
              IK IR     LPIEV IP     ++E CN  LP +NAKC++L D LP ++  E + +
Sbjct: 210 INTIKAIRERGSTLPIEVIIPRSSVPEEEYCNRFLPSFNAKCVYLDDTLP-NEFKERLTL 268

Query: 271 DGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSY 330
             YQ K  A+  SSFKNVL +DADN P+ N+D+IF S+ Y   GLI WPD WRR T+P+Y
Sbjct: 269 KKYQYKSFALLVSSFKNVLYIDADNIPLVNLDNIFDSKAYKDNGLITWPDIWRRVTAPAY 328

Query: 331 YDILDRDISQNERVRNNLDDITPPSVYTEDLK---NHK--DIPMHDFEGTLPDVSTESGQ 385
           Y I + + + + RVR   DD+TP S Y   +    N+K    P HDFEGTLPD+++ESGQ
Sbjct: 329 YKIANINYNLDNRVRYMADDVTPTSYYDNIVNPGNNYKLRRTPFHDFEGTLPDLTSESGQ 388

Query: 386 LMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKH 445
           LM+NKE H ++LLLA YYN YGP WYY I +Q  SGEGDKETF+A A+    P+YQVK  
Sbjct: 389 LMVNKETHFRTLLLAFYYNYYGPRWYYTIFSQGTSGEGDKETFLAAAHALGEPYYQVKST 448

Query: 446 VGTDGY-TRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSP-FDFT 503
           +  DGY     G++G+ ++Q DF +DY  Y  AK  +EK       DK   EY+P +DF 
Sbjct: 449 IEFDGYFDHKDGFQGIGLYQKDFNKDYENYLAAKAKVEK-------DKKYGEYNPNYDF- 500

Query: 504 DKFFEDEHADPV---IDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDL 560
           D  FE    +P    ++ MF+H    KF+P  L +    +  G   R ++K+  L ++DL
Sbjct: 501 DADFEKALMNPPGNEVEAMFIHVSFHKFDPHNLAKNKRYILQGKQYRVFSKFKNLRNWDL 560

Query: 561 EMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617
           E+E  + +   LC +   EF + KD     K+ W+ +C Y+ +R  ++  TH+   S
Sbjct: 561 ELEANRNMHFYLCTDNAVEFIFYKD--LQGKDSWKDMCNYLSERVEYLASTHDAALS 615

>YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}
           MNN5Alpha-1,2-mannosyltransferase, responsible for
           addition of the second alpha-1,2-linked mannose of the
           branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 586

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/532 (36%), Positives = 307/532 (57%), Gaps = 57/532 (10%)

Query: 115 DLLRSAGPEGTS--DRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAML 172
           DL +  G EG S  +     D   DSD             L+ ++LSKC  +++     L
Sbjct: 74  DLSKLHGAEGCSFANNVAAHDSGHDSD-------------LSYESLSKCYNLNKTVQESL 120

Query: 173 KNSHRKYIDGLK-----ELGSSPDMYSG-DGIVLVAGGKFSLLSTLVIKTIRNLKINLPI 226
           +  H K+ D L       +     ++SG +GIV + GGK+S+L+  +IK +R+    LPI
Sbjct: 121 REVHSKFTDTLSGKLNFSIPQREALFSGSEGIVTIGGGKYSVLAYTMIKKLRDTGTTLPI 180

Query: 227 EVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFK 286
           EV IPP DEG+D+ C   LPK+N KCI+ SD +P   ++ D+K+  +Q KV  +  SSFK
Sbjct: 181 EVIIPPQDEGEDDFCKNWLPKFNGKCIYFSDIVPSKPLS-DLKLTHFQLKVFGLIISSFK 239

Query: 287 NVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRN 346
            ++ LDADNY +KN+D  F +  ++  GLI WPD+WRR T P++Y+I+   I+  +RVR 
Sbjct: 240 RIIFLDADNYAVKNLDLAFNTTSFNDTGLILWPDFWRRVTPPAFYNIIGSSINIGKRVRF 299

Query: 347 NLDDITPPSVYTEDLKNHKD-------------IPMHDFEGTLPDVSTESGQLMINKEKH 393
             DDI+P S Y   + N  D             +P+HD +GT+PD+S+ESGQ++I+K +H
Sbjct: 300 VSDDISPVSRYDPFVSNSNDYTPKERQEHFLKHVPLHDLDGTMPDLSSESGQMVIDKIRH 359

Query: 394 LKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDG-YT 452
             +LLLA+YYN+YGP WYY +++Q  +GEGDK+TF+A A+  N+P+YQV+ +   DG + 
Sbjct: 360 FNTLLLALYYNVYGPTWYYKMISQGTAGEGDKDTFVAAAHALNMPYYQVRTNFEFDGFFY 419

Query: 453 RPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQ-DKIDKEYSPFDFTDKFFE--- 508
           +   Y+G+A+ QHDF QDY  Y+ A+   +K   N ++  K+D +Y+     + F +   
Sbjct: 420 QKDDYKGLALLQHDFEQDYKQYQKAQ---QKVKANIEEFSKLDPDYT---LDNGFLKTLM 473

Query: 509 --DEHADPVIDVMFVHAHLPKFEPVALWEENDLMQ-DGSHVRSYTKYDKLNHYDLEMENF 565
             D+ +D  +D+MF+HA   K +P  L+ EN  +  +G  VR + K  +    D E+  F
Sbjct: 474 VNDDGSD--LDIMFIHASFYKADPWTLYHENRFIGPNGEQVRGFRKPHRYG-MDFELFLF 530

Query: 566 KALEELLCL---EKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
             +    C     +  +FKY  DK+  +  +W  +C+Y+ +   ++E TH+E
Sbjct: 531 NDMRGSFCTTPKSQVIKFKYFTDKV--NTPEWDAMCEYLTNHVNYLESTHKE 580

>KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.150
           YJL186W
          Length = 623

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/521 (38%), Positives = 291/521 (55%), Gaps = 30/521 (5%)

Query: 107 KTFYSKVYDLLRSAGP----EGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCL 162
           + F+  ++  L++A P    E  +  K    C L   +     +  K   ++ D+L  C+
Sbjct: 113 RVFFRNIFTTLKNAKPRDPPEDFTAFKDEARCKLRDPMFASDGEREKLEAVSYDSLDGCM 172

Query: 163 QIDEESLAMLKNSHRKYIDGLKELGSSP--DMYSGD-GIVLVAGGKFSLLSTLVIKTIRN 219
            + ++ L  L   H K++  +K + SS    +Y  D GIV V GG++S+L   ++  +R 
Sbjct: 173 HVPDQYLESLTKMHTKFVGTIKSISSSTVRQLYPEDSGIVAVGGGRYSVLLATMLPKLRK 232

Query: 220 LKINLPIEVFIPPMDE-GDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVV 278
              +LP+E+FIP  D  GD   C    P+YNAKCI+    +   KI  DIK++ +Q K V
Sbjct: 233 NCTSLPVEIFIPDEDAAGDASFCQVFAPRYNAKCIYAKAIV--GKI--DIKLERFQYKPV 288

Query: 279 AIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDI 338
           AI  SSFKNVL LDADNY +KNID IF +E Y   GLI WPD W+R TSPS+Y I   + 
Sbjct: 289 AILLSSFKNVLFLDADNYVMKNIDKIFSAESYHDTGLIIWPDIWKRCTSPSFYKIAGINF 348

Query: 339 SQNERVRNNLDDITPPSVYTEDLKNHKD-----IPMHDFEGTLPDVSTESGQLMINKEKH 393
              +RVR   D+I+P S YT   +N  +     +P HD +G +PD S+ESGQL+INK KH
Sbjct: 349 DLTKRVRWGGDEISPVSRYTSAEQNSPEYLKTKVPFHDLDGPMPDSSSESGQLLINKVKH 408

Query: 394 LKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTR 453
           + +LLLA+YYN+YG  WY+P+ +Q+  GEGDKE++I+ A     P YQVK  +   GY  
Sbjct: 409 MDTLLLALYYNVYGKQWYFPLASQRGPGEGDKESYISAAYALKKPVYQVKTPLEFSGYFT 468

Query: 454 PGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYS-PFDFTDKFF---ED 509
              + GV + QHDF QDY  Y+ A+  +       +    D EY+    F  +FF   E 
Sbjct: 469 -DEFNGVGLLQHDFEQDYQLYKKAEELVAAN--QIRYGFYDPEYTYSSSFLKEFFHVGES 525

Query: 510 EHADPVIDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALE 569
            H+    DVMF+HA   KF+P  L +       G  VR ++  D++N  D E+E F+ ++
Sbjct: 526 AHS----DVMFIHASFFKFDPWELSQNERFTYRGKQVRGFSLRDRINGEDFELEVFELMK 581

Query: 570 ELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEK 610
           E  C++K  ++ YL+ K    KE W+  C YI D+HI   K
Sbjct: 582 EAFCIDKTVKYGYLEKKFK-SKEDWEKACSYI-DKHIVFLK 620

>Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  345 bits (884), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/541 (35%), Positives = 309/541 (57%), Gaps = 50/541 (9%)

Query: 109 FYSKVYDLLRSAGPEGT----SDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQI 164
           FYS + D +    P G+    +     + C    ++    ++  + + L+ ++L+KC ++
Sbjct: 55  FYSVLVDAIVQCKPMGSPPDLAKLHDAEGCTFAGNVAAHTSE--RDSELSYESLNKCYRL 112

Query: 165 DEESLAMLKNSHRKYIDGLK-----ELGSSPDMY-SGDGIVLVAGGKFSLLSTLVIKTIR 218
           +      L   H K+ D L             ++   +GIV + GGK+S+L+  +IK +R
Sbjct: 113 NTTVQEGLTAMHNKFTDILSGKLNFSFAQREALFPESEGIVTIGGGKYSVLAYTMIKKLR 172

Query: 219 NLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVV 278
                LPIEV IPP DEGDD+ C   LPK+N KCI+ SD +P   +  D+++  +Q KV 
Sbjct: 173 ETGTTLPIEVIIPPQDEGDDDFCKNWLPKHNGKCIYFSDIVPAKSL-RDLELTHFQLKVF 231

Query: 279 AIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDI 338
            +  S+FK ++ +DADNY +KN+D  F +  +   GLI WPD+WRR T P +Y+I+   I
Sbjct: 232 GLIISNFKRIIFIDADNYAVKNLDLAFNTTSFEDTGLILWPDFWRRVTPPVFYNIIGSTI 291

Query: 339 SQNERVRNNLDDITPPSVY-----------TEDLKNH--KDIPMHDFEGTLPDVSTESGQ 385
           +  +RVR   DD++P S Y            E+++NH  + +P+HD +GT+PD++TESGQ
Sbjct: 292 NTGKRVRFVSDDVSPVSRYDPFVSDSKDYNPEEIQNHFLRHVPLHDMDGTMPDLTTESGQ 351

Query: 386 LMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKH 445
           ++I+K +H  +LLLA+YYN+YGP WYY +L+Q  +GEGDKETFIA A+  N+P+YQVK  
Sbjct: 352 MVIDKIRHFHTLLLALYYNVYGPTWYYKMLSQGTAGEGDKETFIAAAHALNVPYYQVKTK 411

Query: 446 VGTDG-YTRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQ-DKIDKEYSPFDFT 503
              DG Y +   ++G+A+ QHDF QDY  Y+ A+   +K   N  +  K++ EY+     
Sbjct: 412 FEFDGFYYKKDDFKGLALLQHDFEQDYRHYQTAQ---QKVKANIGEFSKLNPEYT----L 464

Query: 504 DKFF------EDEHADPVIDVMFVHAHLPKFEPVALWEENDLMQ-DGSHVRSYTKYDKLN 556
           DK F       D+ +D  +D+MF+HA   K +P  L+ E   +  DG  +R + K  +  
Sbjct: 465 DKGFLKNLMLNDDGSD--LDIMFIHASFYKADPWNLYHEKRFIGPDGKQLRGFKKLGRYG 522

Query: 557 HYDLEMENFKALEELLCL---EKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHE 613
             D E+  F  +++  C     +   FKY +DK++    +W  +CKY+ D   ++E+TH+
Sbjct: 523 -MDFELFLFDDMKKSFCTTPKNQVLRFKYFEDKIT--TPEWDAMCKYLADHVDYLERTHK 579

Query: 614 E 614
           +
Sbjct: 580 D 580

>Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  342 bits (878), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/542 (35%), Positives = 306/542 (56%), Gaps = 48/542 (8%)

Query: 107 KTFYSKVYDLLRSAGPEGT----SDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCL 162
           K FY+ +   +  A P G+    +     + C    ++    +D  +   L+ ++LSKC 
Sbjct: 53  KNFYTALIQAIVQAKPAGSPPDLNKLHNAEGCTFADNVA--AHDSGRDGDLSYESLSKCY 110

Query: 163 QIDEESLAMLKNSHRKYIDGLK-----ELGSSPDMY-SGDGIVLVAGGKFSLLSTLVIKT 216
           ++D      L   H ++ D L       +     ++   +GIV + GGK+S+L+  +IK 
Sbjct: 111 RLDSTVQENLVEMHNQFTDVLSGRLNFSIPQREALFPESEGIVTIGGGKYSVLAYTMIKN 170

Query: 217 IRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTK 276
           +R     LPIEV IPP DEGDDE CN  LP +N +C++ SD +P   +  D+K+  +Q K
Sbjct: 171 LRKTGTTLPIEVIIPPQDEGDDEFCNNWLPNFNGRCLYFSDIVPPKPLG-DLKLTHFQLK 229

Query: 277 VVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDR 336
           V  +  S+FK ++ +DADNY +KN+D  F +  +   GLI WPDYWRR T P++Y+I+  
Sbjct: 230 VFGLLISNFKRIIFMDADNYAVKNLDLAFNATSFQDTGLILWPDYWRRVTPPAFYNIIGS 289

Query: 337 DISQNERVRNNLDDITPPSVY-----------TEDLKNH--KDIPMHDFEGTLPDVSTES 383
            I+  +RVR   DDI+P S Y           +E++++H  + +P+HD +GT+ D+++ES
Sbjct: 290 SINTGKRVRFISDDISPVSRYDSFISNSEDYTSEEMQDHFLRHVPLHDLDGTMSDLTSES 349

Query: 384 GQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVK 443
           GQ++I+K +H  +LLLA+YYN+YGP WYY I++Q  +GEGDK+TFIA A+  N  +YQVK
Sbjct: 350 GQMVIDKIRHFHTLLLALYYNVYGPTWYYNIISQGTAGEGDKDTFIAAAHALNASYYQVK 409

Query: 444 KHVGTDG-YTRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDF 502
                DG + +   Y+G+A+ QHDF QDY  Y+ A+  ++      K  K+D +Y+    
Sbjct: 410 TKFEFDGFFYKKNDYKGIALLQHDFEQDYKQYQKAQQKVKADV--EKFSKLDPDYT---- 463

Query: 503 TDKFF------EDEHADPVIDVMFVHAHLPKFEPVALWEENDLMQ-DGSHVRSYTKYDKL 555
            DK F       ++  D  +D+MF+HA   K +P  L+ EN     DG  +R + K  + 
Sbjct: 464 LDKGFLKSLMLNEDGTD--LDIMFIHASFYKADPWTLYRENRFTDPDGKQLRGFRKPYRY 521

Query: 556 NHYDLEMENFKALEELLCL---EKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTH 612
              D EM  F+ ++E  C     +  +FKY  DKL  +  +W  +C+Y+ +   ++E TH
Sbjct: 522 -AMDFEMFLFRDMKESFCTPPKNQVIKFKYFNDKL--NTPEWDKMCQYLTNHLDYLEATH 578

Query: 613 EE 614
            E
Sbjct: 579 NE 580

>KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 607

 Score =  338 bits (866), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/532 (37%), Positives = 301/532 (56%), Gaps = 36/532 (6%)

Query: 109 FYSKVYDLLRSAGPE----GTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQI 164
           F+  ++  L  A P     G  D K  ++C +  D+G   N   +   L+ DNL+KCLQ+
Sbjct: 71  FFKTLFAQLEGAAPMKREFGWGDIK-AKECDM-GDVGFDSNG--RDERLSYDNLAKCLQL 126

Query: 165 DEESLAMLKNSHRKYIDGLKELGSSPDMY-----SGDGIVLVAGGKFSLLSTLVIKTIRN 219
            E +   LKN H K++  L  + +S         +  GIV V G ++SLLS L+I  +R 
Sbjct: 127 PESNYNSLKNGHEKFVKYLSTVDTSASQLEQIYATKRGIVTVGGRRYSLLSYLMINMVRR 186

Query: 220 LKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVA 279
               LPIEV IPP DE + E C ++L ++NA+CI+  D LP   +  ++ +  YQ K +A
Sbjct: 187 SGSKLPIEVVIPPDDEPETEFCESIL-QFNARCIYFKDRLPTSLL-ANLSVKSYQVKGIA 244

Query: 280 IAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDIS 339
           +  SSF+  +L+D+DN P+KNID++F    +   G++ WPD WRR TSP +Y + +  I 
Sbjct: 245 LLLSSFQEFVLIDSDNMPLKNIDEVFDYNVFRDHGMVIWPDIWRRMTSPQFYQLAEVPID 304

Query: 340 QNERVRNNLDDITPPSVY----TEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLK 395
             +RVRN  D+++P S Y        +N   +PMHDF GTLPD +TESGQ+++NK+ HLK
Sbjct: 305 FTKRVRNAGDELSPVSRYDKLENTVSENKAKVPMHDFLGTLPDPTTESGQMIVNKKTHLK 364

Query: 396 SLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP- 454
            LLLA+YYN YGP +YY + +Q  SG+GDKETF   A+    PFYQVKK  G   Y  P 
Sbjct: 365 MLLLALYYNQYGPEYYYQLFSQGTSGQGDKETFAMAAHILKEPFYQVKKTFGFAAYMDPR 424

Query: 455 ---GGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEH 511
                ++G  + QHD  QDY  +   KT IE +    K    D++Y       K F D+ 
Sbjct: 425 EGKSEFQGAGLLQHDPEQDYRYWNILKTEIEGQ--QEKYGTFDEDYH----IKKTFYDKM 478

Query: 512 ADPVIDV----MFVHAHLPKFEPVALWEENDLMQ-DGSHVRSY-TKYDKLNHYDLEMENF 565
              V D     +F+HA   K++P  L+ E +LM  DG   R+Y         +D+E+  +
Sbjct: 479 LGKVGDQPREHLFLHASYHKYDPWNLYNEKNLMHSDGKQFRAYPCSSTAFKGFDVELFLW 538

Query: 566 KALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617
           + + +++C E P +  Y+ DKL +D +K++ +C++ KDR   + +TH+E+ S
Sbjct: 539 EIVNKIVCSENPVKMAYI-DKLKEDTDKFKAVCQFTKDRVNHLNETHDEYVS 589

>Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON}
           YJL186W (REAL)
          Length = 586

 Score =  335 bits (860), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/540 (35%), Positives = 307/540 (56%), Gaps = 40/540 (7%)

Query: 105 NMKTFYSKVYDLLRSAGPEGT----SDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSK 160
           N   FY+ + D +    P  T     +    + C    ++    +D    + L+ ++LS+
Sbjct: 51  NRNIFYTLLVDAIVRTKPLDTLPDLRELHAAEGCEFADNVAA--HDTTHDDNLSYESLSR 108

Query: 161 CLQIDEESLAMLKNSHRKYIDGLKELG----SSPDMYS----GDGIVLVAGGKFSLLSTL 212
           C +++   LA L   H ++ D L  LG    S P   +     +GIV + GGK+S+L+  
Sbjct: 109 CYKLNRTLLANLAEMHNEFTDIL--LGKLNYSIPQREALFPESEGIVTIGGGKYSVLAHT 166

Query: 213 VIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDG 272
           +IK +R     LPIEV IPP DEGDD+ C   LP+ N KC++ SD +P   +  D+++  
Sbjct: 167 MIKKLRETGTTLPIEVIIPPQDEGDDDFCKNWLPRQNGKCLYFSDIVPSKPL-RDLELTH 225

Query: 273 YQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYD 332
           +Q KV  +  S+FK ++ +DADNYP+ N+D +F +  +   GLI WPD WRR T P++Y+
Sbjct: 226 FQLKVFGLIISNFKRIIFIDADNYPVTNLDLVFNTTSFQDTGLIMWPDLWRRVTPPAFYN 285

Query: 333 ILDRDISQNERVRNNLDDITPPSVY-----------TEDLKNH--KDIPMHDFEGTLPDV 379
           I+   I+ ++RVR   DD++P S Y           +E++++H  + +P+HD +G +PD+
Sbjct: 286 IIGSTINTSKRVRFVSDDVSPVSRYDPFVSKSKEYTSEEMQDHFLRHVPLHDMDGAMPDL 345

Query: 380 STESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPF 439
           ++ESGQ++I+K +H  +LLLA+YYN+YGP WYY +L+Q  +GEGDKETFIA A+  N P+
Sbjct: 346 TSESGQMVIDKVRHFHTLLLALYYNVYGPTWYYKMLSQGTAGEGDKETFIAAAHALNAPY 405

Query: 440 YQVKKHVGTDG-YTRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYS 498
           YQVK     DG + + G Y+G+A+ QH+F QDY  Y+ AK  ++       Q  +D    
Sbjct: 406 YQVKTKFEFDGFFYKEGDYKGLALLQHNFEQDYKQYQKAKKKVKANIDQFSQLDVDYSLD 465

Query: 499 PFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDLMQ-DGSHVRSYTKYDKLNH 557
                     D+ +D  +D+MF+HA   K +P  L+ EN  +  DG  +R + K  +   
Sbjct: 466 GGFLKSLMLNDDGSD--LDIMFIHASYYKADPWNLYHENRFIGPDGEQLRGFRKPQRYA- 522

Query: 558 YDLEMENFKALEELLCL---EKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614
            D E+  F  ++E  C    +K  +FKY +DK+  +   W  +CKY+ D   +++ TH+E
Sbjct: 523 MDFELFLFDDMKESFCTPAKDKVIKFKYFEDKI--NTPDWDKMCKYLADHVDYLQSTHKE 580

>CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186w MNN5
           or uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
          Length = 600

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/539 (35%), Positives = 293/539 (54%), Gaps = 54/539 (10%)

Query: 113 VYDLLRSAGPEGTSDRKYGQD------CPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDE 166
           + ++LR+A     S  K  +D      CP   D+     D   W   +  NL  CL +D+
Sbjct: 69  IGNVLRAALDAKPSPFKLDRDALKTSSCPKKGDVSSGGIDQFHWT--SAKNLKACLNLDD 126

Query: 167 ESLAMLKNSHRKYIDGL----KELGSSPD----MYSGD-GIVLVAGGKFSLLSTLVIKTI 217
            ++  L  +H +Y+  L     E   S      +Y  + GIV + GG++++L+ L+I+T+
Sbjct: 127 YAIKTLSEAHSRYMKTLFNDKGEFAISKSDFKKLYPNEKGIVTLGGGRYTILAMLMIETV 186

Query: 218 RNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINED--IKIDGYQT 275
           R     LP+EV  PP DEG+ + CN  LPK+N +C+ +S  +P + + +D  ++   YQ 
Sbjct: 187 RRHGSTLPVEVMFPPEDEGEFDFCNNWLPKHNGRCVMMSQEVPFEILQKDKEVRFKSYQI 246

Query: 276 KVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILD 335
           K +A+  +SFK  + +DADN  +KNID IF +E + + GLI WPD W+R T+P +YDI  
Sbjct: 247 KSLALLLTSFKQFVFIDADNNAMKNIDHIFDTEAFKTHGLILWPDLWKRFTNPGFYDIAG 306

Query: 336 RDISQNERVRNNLDDITPPSVY--------TEDLKNHKDIPMH--------DFEGTLPDV 379
                 +RVRN  DD +PP  Y        T DLK  ++I  H        D +GT+ D 
Sbjct: 307 VKYDLGKRVRNVNDDASPPETYDPNHSIYTTHDLKQREEIAKHLYEDVSLADLDGTIADT 366

Query: 380 STESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPF 439
           +TESGQ+M++ +KHL +LLLA+YYN+YGP+ YY +++   +GEGDKETFI+ A+  +LP+
Sbjct: 367 TTESGQMMVDNKKHLSTLLLALYYNIYGPDLYYYMMSMGTAGEGDKETFISAAHVLHLPY 426

Query: 440 YQVKKHVGTDGYTR--PGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEY 497
           YQVK ++G DGY       ++GV + Q DF QDY  ++             K+   +K  
Sbjct: 427 YQVKTNIGFDGYVNDVDNQFKGVGLMQTDFEQDYQRHKQV----------LKELATEKPL 476

Query: 498 SPFDFT-DKFFEDEHADP---VIDVMFVHAHLPKFEPVALWEEND-LMQDGSHVRSYTKY 552
            P  +     F+D+  +P    +D+MF+HA   KF+P  L +      Q+G  VR Y + 
Sbjct: 477 EPVKYQLPNHFQDKMKNPDGTSLDIMFLHASFHKFDPADLAKSKQYFKQNGEQVRGYNRI 536

Query: 553 DKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKT 611
           D   ++D E+ +FK L + LC      FK LK    +  E W  +C Y K R  F+ KT
Sbjct: 537 DAYKNFDFELFSFKKLYDNLCTSDHISFKSLKKH--EGTEFWTSMCSYFKQRVDFLTKT 593

>AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL186W (MNN5)
          Length = 573

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 168/466 (36%), Positives = 273/466 (58%), Gaps = 26/466 (5%)

Query: 156 DNLSKCLQIDEESLAMLKNSHRKY---IDGLKELGSSPDMYSG-----DGIVLVAGGKFS 207
           D L+KC +++ + L  L+  H ++   I G   + +   ++        GIV V GG++S
Sbjct: 103 DGLAKCFRLERDHLEGLRQGHSEFLRTIHGELAISAKSALFKTLYPLPAGIVTVGGGRYS 162

Query: 208 LLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINED 267
           +L+ ++I+ +R     LP+EVF+   D+ DDE   + +  +NAKC+  SD LP+  +   
Sbjct: 163 ILAMVMIRALRKRGTTLPVEVFLTD-DDADDEAFCSYIEHFNAKCVLFSDRLPKSVLASQ 221

Query: 268 IKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTS 327
            K+ G++ K VA+  SS++ V+ +DADN P+K +DD+F S+P +  GL+ WPD W+R T+
Sbjct: 222 -KLSGFELKAVALLLSSYQQVIFIDADNVPLKPLDDVFKSKPLAEYGLVLWPDIWKRVTA 280

Query: 328 PSYYDILDRDISQNERVRNNLDDITPPSVYTEDLK-----NHKDIPMHDFEGTLPDVSTE 382
           P++YDI    +    RVR + DD++PPS YT+  +     N   +P+HDF GT+P++S+E
Sbjct: 281 PAFYDIAGIPVDFKRRVRFSADDVSPPSRYTKPGEVDESFNRAHVPLHDFAGTMPELSSE 340

Query: 383 SGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQV 442
           SGQL+I+K +H+ +LLL +YYN++G + +Y + TQ  SGEGDKETF   A     P+YQV
Sbjct: 341 SGQLLIDKARHMDTLLLILYYNVHGKHLFYRLSTQGTSGEGDKETFAMAAQALGKPYYQV 400

Query: 443 KKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDF 502
           K  +   GY  P  Y G A+ QHDF+QD+  +  A+  + ++            Y+P   
Sbjct: 401 KTKLRFQGYHTPSQYVGAALLQHDFVQDHEQWLRAREEVARRPSEL------AAYNPAYN 454

Query: 503 TDKFFEDEHADP--VIDVMFVHAHLPKFEPVALWEENDLM-QDGSHVRSYTKYDKLNHYD 559
            D+ F +    P   +DVMFVHA   K  P+ L+ E   + +DG   RS+     ++++D
Sbjct: 455 VDEHFYNTLMRPEKPLDVMFVHASYHKLVPIDLFREKVYIGEDGKQFRSFPDLAAMDNFD 514

Query: 560 LEMENFKALEELLC-LEKPFEFKYLKDKLSDDKEKWQGLCKYIKDR 604
           +E+   + L E +C      EFKY +DK+    E+++ +C Y++DR
Sbjct: 515 IELFAIQILNEAICSATTKIEFKYNRDKIK-SPEEFEDMCTYVRDR 559

>SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 741

 Score =  328 bits (841), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 208/585 (35%), Positives = 331/585 (56%), Gaps = 86/585 (14%)

Query: 104 ENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQ 163
           +N+K FY+ +   ++   PEGT DR  G DC +  DIG    ++  +  L++  LSKC+Q
Sbjct: 159 QNLKAFYTSILKEIKDYSPEGTLDRTKGSDCKI-GDIGA--TNIKDFGKLSESELSKCIQ 215

Query: 164 IDEESLAMLKNSHRKYIDGLK-----ELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIR 218
           I +++  MLK+ H ++ + +K        S    Y G+GIV+V GGKFSL+    IK IR
Sbjct: 216 IPKDTSDMLKDLHTRFYETVKTKILPSFNSIEAPYKGEGIVIVGGGKFSLIGLPAIKAIR 275

Query: 219 -----NLKINLPIEVFIPPMDEGDDELCNTLLPKYN----AKCIFLSDFLPEDKINEDIK 269
                 L+ ++P+E+ IPP D+ D E C  +LPK +     +C+F SD   E++I +DIK
Sbjct: 276 VNSGHRLQSSIPVEIMIPPSDDEDVEFCKNVLPKVDPTGLTRCVFFSDIF-EEEILKDIK 334

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPS 329
             GYQ K +A+  SSF+ VL+LDADNY + +I++ F S  ++ +GL+ WPD+WRR   P 
Sbjct: 335 --GYQLKALALLVSSFRKVLMLDADNYVVNSIENFFDSPVFNEKGLVLWPDFWRRLHHPK 392

Query: 330 YYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMIN 389
           +Y+I+  D+++NE +R ++D++TPP VY ++  +   IP HD   ++PD+STESGQL+++
Sbjct: 393 FYEIIGIDVNRNESIRYSIDNVTPPEVYRDN--DDDSIPFHDLANSIPDISTESGQLLVD 450

Query: 390 KEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNL----PFYQVKKH 445
           K+KHL +LLL+ YYN  GP++YYP+L Q  +GEGDK+TFIA A+  +      ++Q++  
Sbjct: 451 KQKHLDTLLLSCYYNYNGPSFYYPLLGQGYAGEGDKDTFIAAAHVTHPSESGSYHQIQTP 510

Query: 446 VGTDGY-------------------TRPGGYRGVAMFQHDFIQDYTAYENAKTF----IE 482
           V   G+                    +   YRGVAM Q ++I+D+   + A++     I+
Sbjct: 511 VRVQGHWCDEFEISIDDNPDDIIAEVKNKKYRGVAMLQSNYIEDHERLKEAQSAIPKDIK 570

Query: 483 KKYPNTKQDKIDKEYSPFDFTDKFFED-----------EHADPVIDVMFVHAHLPKFEPV 531
           K+    +Q+  D+  +  D   KF+E            E+ D   +V F+H+HLPK++P 
Sbjct: 571 KRLDKFRQEHKDEFNNEDDLYKKFYESLRGHYSLNDYLEYFDST-EVSFIHSHLPKYDPW 629

Query: 532 ALWEENDLMQDG------------------SHVRSY-TKYDKLNHYDLEMENFKALEELL 572
            + ++ D   DG                   H R Y + + K+ +YDLE+ N+   +E L
Sbjct: 630 VISQDEDFKYDGKRAKKLRGDKDSPSSKLSGHYRIYNSAFPKVTNYDLELANWAVFQEFL 689

Query: 573 CL---EKPFEFKYLKDKLS---DDKEKWQGLCKYIKDRHIFMEKT 611
           C    E    FKYLK ++S   +     + +CKYI +R  F+ KT
Sbjct: 690 CSGDKENYKNFKYLKTQVSKADNPTVAVENMCKYIDERVEFLRKT 734

>Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii AEL148W
          Length = 592

 Score =  317 bits (812), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 196/529 (37%), Positives = 297/529 (56%), Gaps = 23/529 (4%)

Query: 107 KTFYSKVYDLL-RSAGPEGTSDRKYGQDCPLD-SDIGQRKNDVHKWNVLTQDNLSKCLQI 164
           ++FY  ++  L +   P+G  D+   +D   D  D+     D      L+     KC + 
Sbjct: 65  ESFYKDLFLALEKFKPPKGPEDKNSLKDKTCDLHDVSFGSTDPTDGEYLSYAARRKCFRP 124

Query: 165 DEESLAMLKNSHRKYIDGLKE---LGSSPDMYSG-----DGIVLVAGGKFSLLSTLVIKT 216
            E S A LK SH  +I  +     + +   +++       GIV V GGK+S+L+  +++ 
Sbjct: 125 SEVSTAELKKSHLGFIKHINRHLTVDTKSALFNELFPKEAGIVTVGGGKYSILALTMLRA 184

Query: 217 IRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTK 276
           +R     LP+EV IP  D GD   C  +  K+NA+CI L   LP + +++      Y+TK
Sbjct: 185 LREHGTKLPVEVLIPEGDIGDIHFCRAI-RKWNAECILLPKALP-NTVSKLHDFKSYETK 242

Query: 277 VVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDR 336
           + A+  SSFK+V+L+DADN PIK +DD+F SEPY   GLI WPD WRR T+P +Y+I D 
Sbjct: 243 LAALLLSSFKDVILIDADNIPIKPLDDVFESEPYKETGLILWPDIWRRQTAPVFYEIADI 302

Query: 337 DISQNERVRNNLDDITPPSVYT-----EDLK-NHKDIPMHDFEGTLPDVSTESGQLMINK 390
           DI    R+RN+ DD++PPS Y       D K N   +P+HD  G +PD+S+ESGQL++NK
Sbjct: 303 DIDFRNRIRNSYDDLSPPSRYKNPDVPNDAKYNMAHVPLHDLAGAIPDLSSESGQLLVNK 362

Query: 391 EKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDG 450
            KHL +LLLA+YYN YG  W+Y + +   SG+GDKETFI  A+    P+YQVK  +  DG
Sbjct: 363 GKHLSTLLLALYYNYYGEQWFYQMSSLGTSGQGDKETFIFAAHALKKPYYQVKNPLLFDG 422

Query: 451 Y-TRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFED 509
           Y    G ++GV + QHDF QDY  ++ AK ++ +   +      D   +  DF D+    
Sbjct: 423 YFGDDGSFKGVGLLQHDFTQDYANWKKAKEYMTENIAHLGTYNSDYNVNQ-DFKDEMLHH 481

Query: 510 EHADPVIDVMFVHAHLPKFEPVALWEENDLM-QDGSHVRSYTKYDKLNHYDLEMENFKAL 568
           +  D V D+MF+HA   K  P  L+ E   + + G   RS+     +N++D+E+  F+ L
Sbjct: 482 KDFDGV-DIMFIHASFHKLIPWDLYREKIYLDKSGKQFRSFKNLKNINYFDVELFAFEGL 540

Query: 569 EELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617
           ++ +C +   +F+Y   +++   E +  +C YI DR   + +THEE  S
Sbjct: 541 QKYICSDDAIKFEYHTLQVT-STESFNAMCAYIDDRVKMLRETHEEAIS 588

>KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 711

 Score =  300 bits (769), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 203/608 (33%), Positives = 311/608 (51%), Gaps = 100/608 (16%)

Query: 102 LRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKC 161
           +  ++K FY ++   L+    +G  + K  + C L SD G    D  K + LT+DNL KC
Sbjct: 111 ISSDLKDFYQEIMTTLKETALKGKLEVKKPEGCKL-SDTGVENTDSEKLSTLTKDNLLKC 169

Query: 162 LQIDEESLAMLKNSHR--------KYIDGLKELGSSPD-MYSGDGIVLVAGGKFSLLSTL 212
           L I +E +  +K +H         K +   K+L +  D +Y G+GI +V GGK++L++  
Sbjct: 170 LPISDEDVKEVKEAHNNFKKLLQDKLMPNFKKLNTEKDPVYKGEGISIVGGGKYTLMALP 229

Query: 213 VIKTIR-----NLKINLPIEVFIPPMDEGDDELCNTLLPKYN----AKCIFLSDFLPEDK 263
           VIK+IR      LK ++PIE+ IPP D  D ++C  ++P  +     KC++LS+F   + 
Sbjct: 230 VIKSIRMNSGLTLKSSVPIEIVIPPSDNADRKVCENIIPTIDPSGLTKCVYLSEFFDSEI 289

Query: 264 INEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWR 323
           + +   I GYQ K +++  SSF+ VLLLDADNY I ++ + F  + +   GLI WPDYWR
Sbjct: 290 LKD---ITGYQLKSLSLLISSFEKVLLLDADNYVINSLGNFFDGDIFRETGLILWPDYWR 346

Query: 324 RSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTES 383
           R  SP  YDI+D  + Q++  R + D IT   ++ E   +   IP HD EG +PD STES
Sbjct: 347 RVHSPKLYDIVDIKV-QDKLARYSTDYITNSRLFPE--SDPAKIPFHDLEGAIPDGSTES 403

Query: 384 GQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVK 443
           GQL++NK  HL +L+L++YYN  GP++YY +L Q  SGEGDK+TFI  A      +YQV+
Sbjct: 404 GQLLVNKASHLDALILSLYYNYNGPSYYYRLLGQGISGEGDKDTFILAATVLKHRYYQVR 463

Query: 444 KHVGTDGY-------------------TRPGGYRGVAMFQHDFIQDYTAYENAKTFIEKK 484
             V   GY                   +    YRG+AM QHD+ +D T    A+  I   
Sbjct: 464 TPVRPQGYWGKIENEVRIQDDLVDDTPSNEKKYRGIAMIQHDYNEDRTFDSIARDAIRGS 523

Query: 485 YPN--------------------TKQDKIDKEYSPFDFTDKFFEDEHADPVI-------- 516
             N                     ++D ++K     + +DKF++       I        
Sbjct: 524 VNNKLKAHRLEYIKNHKSEFKDMNEKDALEKVSKMSEVSDKFWDSMKGKYTIKDFFTIFQ 583

Query: 517 --DVMFVHAHLPKFEPVALWEENDLMQDG------------------SHVRSYT-KYDKL 555
               +F+H++LPK+ P  L    DL+ DG                   H R Y+  +  L
Sbjct: 584 FTTPVFLHSNLPKYNPWELSISGDLLYDGKKATKKMDDPSKYVPNGKGHHRMYSPTFKDL 643

Query: 556 NHYDLEMENFKALEELLCLEKP---FEFKYLKDKLSDDKEKWQ---GLCKYIKDRHIFME 609
            +YDLE+ N+K  +++LC + P     F YL + +   ++  Q    +CKYIKDR  +++
Sbjct: 644 TNYDLELANWKLFDDVLC-KNPDDYLNFSYLSEVIGATEKPEQEVKNMCKYIKDRVEYLK 702

Query: 610 KTHEEHFS 617
            +  E+ S
Sbjct: 703 LSTWENSS 710

>TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {ON}
           Anc_1.150 YJL186W
          Length = 616

 Score =  297 bits (760), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 178/456 (39%), Positives = 266/456 (58%), Gaps = 24/456 (5%)

Query: 134 CPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYID-GLKELGSSPDM 192
           C L +DI        + + ++ +NL  C  + E     +  S  +YI+  + +L      
Sbjct: 96  CLLQNDITFDATSKEQLSTVSYNNLKNCYSLQEHDFKKISKSQLEYINKCVTKLSKKKKS 155

Query: 193 YS------GDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDE---GDDELCNT 243
           Y+      G GIV V GGK+SLL+ L+IK +R     LP+EV IPP D+    D  LCN 
Sbjct: 156 YTDILFPKGRGIVTVGGGKYSLLAYLMIKLLREKGTTLPVEVVIPPSDKEMYDDTWLCND 215

Query: 244 LLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDD 303
           +LP  NAKCI+ +D LP + I +D+ I G+Q K +AI  SSFK  L LD+DN+P+K++D+
Sbjct: 216 VLPTLNAKCIYFTDRLPAE-ILQDLDIHGFQYKSLAIWISSFKKTLFLDSDNFPLKDLDN 274

Query: 304 IFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTED--L 361
           +F +  +   GLIFWPD WRR+  P +YDI +      +RVR   DD++   +Y +D  +
Sbjct: 275 VFDTPAFEEVGLIFWPDLWRRTIPPDFYDISNIKYDLKKRVRYVQDDLSSVPLYDKDNSV 334

Query: 362 KNHK-DIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
           K+++ +IP HD +GT+ D STE+GQ++++KE H ++LLL++++N +G   YY + +Q  +
Sbjct: 335 KDYEYNIPFHDLDGTISDPSTETGQMLVDKETHFETLLLSIFFNYFGFAIYYDMFSQAGA 394

Query: 421 GEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPG-GYRGVAMFQHDFIQDYTAYENAKT 479
           G GDK+TFIA A+    P+YQVK     DG+  P  G++G+A+ QHDF QDY  Y+ A+ 
Sbjct: 395 GIGDKDTFIAAAHVLGQPYYQVKTPPEFDGFWHPTMGFQGLALLQHDFNQDYKNYQVAR- 453

Query: 480 FIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHAD-PVIDVMFVHAHLPKFEPVALWEEND 538
            IE K  + K +    +Y+      K FE++  D   IDVMF H  L K EP++L E   
Sbjct: 454 -IEAKGDDAKYENYITDYN----LKKHFEEDMMDINNIDVMFAHYSLHKAEPMSLLEGQL 508

Query: 539 LM-QDGSHVRSYTKYDKLNHYDLEMENFKALEELLC 573
              Q+G  ++   K DK    +LE   F  L E LC
Sbjct: 509 YFDQNGKPLKGLYKNDKYGM-NLEYYIFNTLHEFLC 543

>TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON} 
          Length = 660

 Score =  298 bits (763), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 192/588 (32%), Positives = 300/588 (51%), Gaps = 84/588 (14%)

Query: 98  EEKRLRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPL-DSDIGQRKNDVHKWNVLTQD 156
           + + LRE + +    V + +R   P+G  DR  G DC L D ++G  +ND      +++ 
Sbjct: 81  DARTLREALGS----VMNQIRELSPQGELDRSKGDDCSLGDLNVGVPQND----EKVSKS 132

Query: 157 NLSKCLQIDEESLAMLKNSHRKYIDGL--KELGSSP-DMYSGDGIVLVAGGKFSLLSTLV 213
            L KC+QI  ++   LKN H+ ++  L  K +   P  MY GDGIV V GG+F++     
Sbjct: 133 ELLKCIQITPDAEDELKNLHKSFLSVLEKKIMPKYPISMYRGDGIVFVGGGRFTMFVMPA 192

Query: 214 IKTIR-NLKINLPIEVFIPPMDEGDDELCNTLLPKYN----AKCIFLSDFLPEDKINEDI 268
           I+ IR N   ++PIE+ IPP +  +   C  +LP  +     +C+F+     + K  +++
Sbjct: 193 IQAIRANAGRDIPIEIMIPPGNNHESGFCENILPLVDPSGLTRCVFMETLF-DSKTMKNV 251

Query: 269 KIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSP 328
           K  GYQ K +A+ ASSF+  LLLDADNY + +ID  F SE     G+  WPDYW+R   P
Sbjct: 252 K--GYQLKALALLASSFRKTLLLDADNYVVNSIDSFFDSEIIEDYGMALWPDYWKRLHHP 309

Query: 329 SYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMI 388
           + YDI+   +  + R R  +D ++P  +Y  D  +   +P HD +GT+PD  TESGQL++
Sbjct: 310 AVYDIVGSHVDSSRRARFIMDTVSPSQLYQSD--DISKVPFHDLDGTIPDGGTESGQLLV 367

Query: 389 NKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLP-----FYQVK 443
           +K KHL +++L++YYN  GP++YYP+L Q  +GEGDK+TF   A   +       FYQ++
Sbjct: 368 DKYKHLDTIILSLYYNYNGPSYYYPLLGQGLAGEGDKDTFALAARALSAHGLQRYFYQLR 427

Query: 444 KHVGTDGY-TRPG----------------GYRGVAMFQHDFIQDYTAYENAKTFIEKKYP 486
             VG  GY   P                  +RGVAM QHD   D+ AY+ A T I+ K  
Sbjct: 428 APVGALGYWAHPKDNVPILDDEHVPEDQRSFRGVAMLQHDLDLDFKAYKKAYTEIKSKLV 487

Query: 487 N-----TKQDKIDKEYSPFDFTDKFFEDEHADPVID------------VMFVHAHLPKFE 529
                  K+  +    +     D+ F  E      D            V F+H+H PK+ 
Sbjct: 488 QDLKTFRKKATLSDASADLANVDELFWKERRKDGYDVNEFLSYFSDVPVTFIHSHFPKYN 547

Query: 530 PVALWEENDLMQDG------------------SHVRSYT-KYDKLNHYDLEMENFKALEE 570
           P    ++ + + DG                   H R Y   + KL++YDLE+ N+ + +E
Sbjct: 548 PWEFAQDQEFIFDGKKVMSDHKDDPNFKPTHHGHFRMYDHTFQKLSNYDLELANWLSFKE 607

Query: 571 LLCLEKPF-EFKYLKDKLSDDK---EKWQGLCKYIKDRHIFMEKTHEE 614
            +C E     F YL +++   +   ++++ +CKYI +R   ++ T  E
Sbjct: 608 HICREDGHTNFSYLAEEIEKTEHGLQRYEEMCKYIDERVKMLKSTTWE 655

>ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 664

 Score =  297 bits (761), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 210/604 (34%), Positives = 316/604 (52%), Gaps = 103/604 (17%)

Query: 92  LNFVQ-----------MEEKRLRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDI 140
           LNF+Q            ++ +L E MK    +V    RS       DR   + C L  D+
Sbjct: 59  LNFLQNGFGGTNQAHYFDQDKLTEMMKYTMERV----RSHSSTAVVDRTKNKGCQL-GDV 113

Query: 141 GQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYIDGLKE--LGSSP-DMYSGDG 197
           G   N V K++ +T++ L KC+   +E+   LK+SH  ++D L    L   P D+Y G G
Sbjct: 114 G--ANAVDKFSKVTKEQLLKCIDFPQETFEQLKDSHTTFLDTLTNDILDEYPTDLYGGKG 171

Query: 198 IVLVAGGKFSLLSTLVIKTIR-NLKINLPIEVFIPPMDEGDDELCNTLLPKYN----AKC 252
           IV+V GGK++L +   IK +R N    +PIE+ IPP ++G+D  C  +LP+ +     +C
Sbjct: 172 IVIVGGGKYTLYAMPAIKAVRTNGDPTIPIELMIPPENDGEDAFCENVLPELDPSGLTRC 231

Query: 253 IFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSS 312
           I+++    E  + +   + GYQ K +A+ ASSF+ VLLLDADNY + +I DIF  + +  
Sbjct: 232 IYMNQVFDEQTLKD---VKGYQLKALALLASSFEKVLLLDADNYVVNSIRDIFELDVFKE 288

Query: 313 RGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDF 372
            GLI WPDYWRR   P  YDI+   +++N+RVR ++DD++P  +Y E  K+   IP HDF
Sbjct: 289 FGLILWPDYWRRLHHPRLYDIVGISVNENKRVRYSMDDVSPTELYEE--KDQSKIPFHDF 346

Query: 373 EGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGA 432
           EG +PD  TESGQL+++K KHL +++L++YYN  GP+ YYP+L Q  +GEGDK+TF   A
Sbjct: 347 EGAIPDGGTESGQLLVDKSKHLGTIILSLYYNYNGPSQYYPLLGQGFAGEGDKDTFALAA 406

Query: 433 NFFNL-----PFYQVKKHVGTDGYTRPG---------------GYRGVAMFQHDFIQDYT 472
                      ++QVK  VGT GY                    YRGVAM QHD + D+ 
Sbjct: 407 TALTQRGIVSAYHQVKTPVGTSGYWANSKDETPFEKGLPDAQRSYRGVAMLQHDLLGDFE 466

Query: 473 AYENA------------KTFIEKKYPNT--KQDKIDKEYSPFDFTDKFFEDEHADPVID- 517
           AY NA            K +  ++      ++D  +      ++  K  ED      +D 
Sbjct: 467 AYMNAIHDLSDSYDEDFKIYYHRRLGQRPLEEDNSESREKVANWEKKIREDFWKSHKVDY 526

Query: 518 -------------VMFVHAHLPKFEPVALWEENDLMQDG------------------SHV 546
                        V+FVH+HLPK+ P  L +  DL  DG                   H 
Sbjct: 527 DLKSFLQHFKDVPVLFVHSHLPKYNPWLLSQFGDLKYDGKRVLEKHADDPNFKPSRHGHY 586

Query: 547 RSYT-KYDKLNHYDLEMENFKALEELLC-LEKPFE-FKYLKDKLS-DDK--EKWQGLCKY 600
           R Y  ++ +  +YDLE+ NF  + + +C +E  ++ F YL  +++ +DK  EK++ +C Y
Sbjct: 587 RMYGDEFKEKINYDLELANFITMRDHICAVEDGYKNFSYLSKEVNQEDKGFEKYRAMCDY 646

Query: 601 IKDR 604
           I +R
Sbjct: 647 IAER 650

>KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 702

 Score =  296 bits (759), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 204/600 (34%), Positives = 315/600 (52%), Gaps = 95/600 (15%)

Query: 98  EEKRLRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDN 157
           ++ ++ E  K  + +V D +++  PEG      G +C L  DIG    D  K++ LT+++
Sbjct: 105 DDPQVSEATKKAFKEVLDAIQANSPEGQLQVSKGSECNL-MDIGV--TDTSKFDRLTKES 161

Query: 158 LSKCLQIDEESLAMLKNSHRKYIDGLKE------LGSSPDMYSGDGIVLVAGGKFSLLST 211
           L KCLQI EE    L  +H+K+   + E             +SGDGI++V GGK+S+ + 
Sbjct: 162 LEKCLQIPEEMTKTLHEAHKKFRAAIGEKLMPMFRKLDTPAFSGDGILIVGGGKYSVFAL 221

Query: 212 LVIKTIR-----NLKINLPIEVFIPPMDEGDDELCNTLLPKYN----AKCIFLSDFLPED 262
             IK IR      LK ++PIE+ IPP D+ D   C+ +LPK +     KC+FL +    D
Sbjct: 222 PAIKAIRENSGFKLKSSIPIEIIIPPSDKADRGFCDNVLPKVDPLGLTKCVFLDEMFDAD 281

Query: 263 KINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYW 322
            ++    I+GYQ K +A+  S F+ VL+LDADNY + +I+D F S   + +GLI WPDYW
Sbjct: 282 TLSH---IEGYQIKALALLVSRFERVLMLDADNYVVNSINDYFTSSALNDKGLILWPDYW 338

Query: 323 RRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTE 382
           RR   P  Y I+D  +S +   R ++DD++P  +Y    K+  D P HDF   LPD  TE
Sbjct: 339 RRLHHPKLYGIVDLGVSPDHISRYSVDDVSPDYMYK---KSVTDTPFHDFRDALPDGGTE 395

Query: 383 SGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLP--FY 440
           SGQL+++K+KHL S+++++YYN  G ++YYPIL Q  +GEGDK+TF   +   + P  FY
Sbjct: 396 SGQLLVDKKKHLDSIIMSLYYNYNGKSYYYPILGQGFAGEGDKDTFALASRVMHGPGSFY 455

Query: 441 QVKKHVGTDGYTRPG----------------GYRGVAMFQHDFIQDY------------T 472
           QVK  V T G+                     +RG AM QHD+I+D             T
Sbjct: 456 QVKTPVDTLGHWADAKDEIRLLEEEYENVEKKFRGCAMLQHDYIEDSKFSSLAREVLGNT 515

Query: 473 AYENAKTFIEK-------KYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVID-------- 517
              N + F ++       K+   ++ + ++     +  D   E   A   +D        
Sbjct: 516 IRNNEEKFCDEWAAKNKGKFSAEEKARREECKKSKEVQDALHEKMRASYKLDDYLAFFSF 575

Query: 518 --VMFVHAHLPKFEPVALWEENDLMQDG---------------SHVRSY----TKYDKLN 556
             V FVH+HLPK++P   +E  D+M DG               +H  +Y    +K+++++
Sbjct: 576 TGVSFVHSHLPKYDPWEWYENGDMMFDGKKAKKNHKNDPDYVPAHSGNYRMYDSKFNQIS 635

Query: 557 HYDLEMENFKALEELLC-LEKPFE-FKYLKDKLSDDKEKWQG---LCKYIKDRHIFMEKT 611
            YDLE+ N+ A +  LC LE  ++ F YL +K+   K   Q    +CKYI++R  +++ T
Sbjct: 636 SYDLELANWSAFKSYLCDLEGGYKNFGYLSNKIDSTKSPKQSNKDMCKYIEERVEYLKST 695

>TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}
           Anc_3.188 YBR015C
          Length = 957

 Score =  283 bits (725), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 185/548 (33%), Positives = 293/548 (53%), Gaps = 44/548 (8%)

Query: 100 KRLRENMKTFYSKVYD-LLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNL 158
           K L+++ K     ++  L+ S+   G ++ +   +CP+   +  +     +W  LT +NL
Sbjct: 97  KLLKKSGKPILKSIFQKLIISSSSSGQNNIQLSPNCPIKRPVASKSIREDEWEYLTFNNL 156

Query: 159 SKCLQIDEESLAMLKNSHRKYIDGLKELGSSP-DMYSGDGIVLVAGGKFSLLSTLVIKTI 217
           ++CL ID+ +L  LK  H+ +++ L  L   P +MY G GIVL+ GGK +L +++V K I
Sbjct: 157 NQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFI 216

Query: 218 RNLKINLPIEVFIPPMDEGDD-----------ELCNTLLPKYNAKCIFLSDFLPEDKINE 266
           R+    +P+E+FIPP  + D            + CN +  + N  CIF+SD + E    E
Sbjct: 217 RDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNCIFISDIIDE----E 272

Query: 267 DIKI---DGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWR 323
           D  +       T ++A+  SSF + L+L   N+P+K +D IF  +PY   G I WP +WR
Sbjct: 273 DFHLPELTESTTLLLALLTSSFDDTLVLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWR 332

Query: 324 RSTSPSYYDILDRDISQNERVRNNLDDITPPSVYT-EDLKN---HKDIPMHDFEGTLPDV 379
           R+  PS YDI+ + I+ ++R+R  LDDITPP VYT E+ KN      IP+HD EGTLPD 
Sbjct: 333 RAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDP 392

Query: 380 STESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPF 439
            T   Q +I K K++ ++LLA+YY++ GP+WYY +  QK S    K+     A+  + PF
Sbjct: 393 VTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPF 452

Query: 440 YQVKKHVGTDGYTRPGGYRGVAMFQ----HDFIQDYTAYENAKTFIEKKYPNTKQDKIDK 495
           YQVK     DG  +    +   MF     HDF QD+  Y  AK  I+  Y    +D  D 
Sbjct: 453 YQVKATPFLDGIVK---TKERPMFSSTLYHDFQQDFAFYTFAKMNIKSTY--DLKDSNDI 507

Query: 496 EYSPFDFTDKFFEDEHADPVID-------VMFVHAHLPKFEPVALWEENDLMQDGSHVRS 548
           ++ P  +T + F + + D   +       +MF H++L   +P  L     L+ D S    
Sbjct: 508 QFDP-SYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDDISKEPL 566

Query: 549 YTKYD--KLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHI 606
              ++       ++E+E+FK + E LC EK + F YL+D+  D+     G+C +IK R  
Sbjct: 567 LMTWNIAIFEKQNIELESFKTMHEYLC-EKAYYFDYLEDEYVDETNALPGMCLFIKQRLD 625

Query: 607 FMEKTHEE 614
           F++ + ++
Sbjct: 626 FLQSSADD 633

>Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 184] FULL
          Length = 695

 Score =  245 bits (626), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 194/596 (32%), Positives = 293/596 (49%), Gaps = 112/596 (18%)

Query: 110 YSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESL 169
           ++   +L++   P+G  D   G DC +  DI  R  D  +++ LT+++L KCL + +E++
Sbjct: 107 FNDALELVKKYSPDGKLDTTKGDDCEI-GDI--RITDTSQFHKLTKESLEKCLNVPDETV 163

Query: 170 AMLKNSHRKYIDGL-KELGSSPDMYSGDG--------IVLVAGGKFSLLSTLVIKTIR-- 218
             L   H  +   + K +  S D+    G        IV+V GG+FS+ +   IK IR  
Sbjct: 164 KKLNKLHEDFKGAIRKSILPSFDVLEAQGNPAFKGDGIVIVGGGRFSVFALPAIKAIREN 223

Query: 219 ---NLKINLPIEVFIPPMDEGDDELCNTLLPKYN----AKCIFLSDFLPEDKINEDIKID 271
                K  +PIE+ IPP D+GD   C  +LPK +     KC+FL + L  + ++    I+
Sbjct: 224 SGVKTKNTIPIEIIIPPHDKGDRGFCENVLPKVDPSGLTKCVFLDEILSPETLSH---IE 280

Query: 272 GYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYY 331
           GYQ K VA+  S F+ VL+LDADNY + ++D+ F  +    +GLI WPDYWRR   P  Y
Sbjct: 281 GYQIKAVALFVSQFERVLMLDADNYVVNSLDEYFTHQKLKEKGLILWPDYWRRLHHPKTY 340

Query: 332 DILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKE 391
           DI++  +S   + R ++D+ TP  VY +D K   + P HDF   LPD STESGQ++I+K+
Sbjct: 341 DIVNLGVSTKSQ-RYSIDNATPDFVYKKDAK---ETPFHDFFDALPDGSTESGQVLIDKK 396

Query: 392 KHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLP--FYQVKKHVGTD 449
           KHL SLL+ +YYN  G +++YP+L Q  +GEGDK+TF  G    + P  +YQVK  V T 
Sbjct: 397 KHLDSLLMTLYYNFNGKSYFYPLLGQGFAGEGDKDTFALGCRVMHGPEAYYQVKTPVDTL 456

Query: 450 GY-----------------TRPGGYRGVAMFQHDFIQDYTAYENAKTFI----------- 481
           G+                      +RG AM QHDF  D      A+  I           
Sbjct: 457 GHWADKDEIRIPDEDLEKSIDGKQFRGTAMIQHDFTDDVRFSSLAREVIGNAIRDRFHSF 516

Query: 482 -----------------EKKYPNTKQDKI-----DKEYSPFDFTD--KFFEDEHADPVID 517
                            E++    K D++     DKE   +   D   FF          
Sbjct: 517 CDEWARSHEGKLSKDQKERREQCDKSDEVKKAFNDKESPSYGLKDYLSFFH------FTK 570

Query: 518 VMFVHAHLPKFEPVALWEENDLMQDGS------------------HVRSY-TKYDKLNHY 558
           V F+H+HLPK++P       D+M +G+                  H R Y +K  +L  Y
Sbjct: 571 VSFIHSHLPKYDPWEWSHTGDMMFNGAKALKNHKDEPEYSPMHAGHYRMYDSKISQLTSY 630

Query: 559 DLEMENFKALEELLCLEKPF--EFKYLKDKLSDDK---EKWQGLCKYIKDRHIFME 609
           DLE+ N+ A ++ LC  K     F YL   L + +   +  + +C YI++R  +++
Sbjct: 631 DLELANWSAFKDYLCDIKDGYKNFGYLVQVLEETEFPHQSNENMCNYIRERVEYLQ 686

>SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 679

 Score =  242 bits (617), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 172/599 (28%), Positives = 295/599 (49%), Gaps = 93/599 (15%)

Query: 98  EEKRLRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDN 157
           ++  + + +K FY  +  L++   P G  D K  + C L  +IG    +  K++ LT+  
Sbjct: 82  QQGVISDELKKFYRNITQLVKQNSPTGELDAKKQKWCDL-GNIGL--TETTKFDKLTKLE 138

Query: 158 LSKCLQIDEESLAMLKNSHRKYIDGLKE--LGSSPDM----YSGDGIVLVAGGKFSLLST 211
           LSKC+ +  ++++ LK+ H K+   +K+  L ++  +    Y G+GIV++ GG+ +LL+ 
Sbjct: 139 LSKCINVPADTVSHLKDLHLKFQKLIKDEILPAASRLSKPAYEGEGIVILGGGQKTLLAL 198

Query: 212 LVIKTIRN-----LKINLPIEVFIPPMDEGDDELCNTLLPKYN----AKCIFLSDFLPED 262
             I  IR      ++   P+E+ IPP  + +   C  LLP+ +     +C+ LSD    +
Sbjct: 199 PAINAIRTSGGVTIRNTTPVELVIPPRYKNETAFCQHLLPQLDPTGLTRCVLLSDLYDGE 258

Query: 263 KINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYW 322
            +     ++  Q K +A+  SSF+  LLLD D+Y + ++D  F  E +  +GL+ WPD W
Sbjct: 259 ALEH---LEDQQLKPLALLVSSFQKALLLDCDSYVVNSLDGYFDGEIFRDKGLVLWPDAW 315

Query: 323 RRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTE 382
           RR   P+ Y++L+  + +N + RN++D +TP  V+   ++N   +P HD E T+PD ST+
Sbjct: 316 RRLHHPALYEVLNIKVDENNQPRNSIDIVTPREVF--QVENKLSVPYHDLEHTIPDGSTD 373

Query: 383 SGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNL---PF 439
           +GQL+I+K+KHL +L++++YYN  GP++YY +L Q  +  GDK T+ A A+  +     +
Sbjct: 374 TGQLLIDKDKHLDTLIMSVYYNFNGPSYYYLLLEQGCNVNGDKNTYTAAAHAMHPNDGSY 433

Query: 440 YQVKKHVGTDGY-------------TRPGGYRGVAMFQHDFIQDYTAY------------ 474
           Y V+  +G  G+              +    R VA  QHD+ +DY  Y            
Sbjct: 434 YHVRTPIGMQGHWVDEDGARLADPNQKSQTRRVVAGLQHDYNEDYKYYKWSREVIGNNFR 493

Query: 475 ENAKTFIEKKYPNTKQD------KIDKE-----------YSPFDFTDKFFEDEHADPVID 517
           E    F +K Y   K D      K  KE           +S F  + K  +         
Sbjct: 494 EKLAQFRKKWYQAHKSDFSEDEKKRQKELENNKELNAKFWSQFTGSYKLEDYLSFFDFTP 553

Query: 518 VMFVHAHLPKFEPVALWEENDLMQDGS------------------HVRSYT-KYDKLNHY 558
           V FVH+  P ++P  L +  DL  DG+                  H R Y  ++    ++
Sbjct: 554 VTFVHSRQPSYDPWQLSQIGDLKFDGARITDQHADDEEYKPSSSGHYRMYGPEFTDQTNF 613

Query: 559 DLEMENFKALEELLC---LEKPFEFKYLKDKLS---DDKEKWQGLCKYIKDRHIFMEKT 611
           DLE+ ++   + L C    E   +  YL++++S   D  +  Q +CKY+  R  ++  T
Sbjct: 614 DLELSSWLLFQRLFCSSDREAYTQLAYLQEQISNTPDPDKSVQEMCKYVGARAQYLRDT 672

>Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {ON}
           similar to Ashbya gossypii AEL082W
          Length = 670

 Score =  225 bits (574), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 161/552 (29%), Positives = 262/552 (47%), Gaps = 99/552 (17%)

Query: 153 LTQDNLSKCLQIDEESLAMLKNSH---RKYIDG-----LKELGSSPDMYSGDGIVLVAGG 204
           LT+  LSKCL + ++  + +  SH   ++Y+ G     L  L S P  Y GDG++++AGG
Sbjct: 118 LTEAELSKCLHVSDDIKSKMMASHLQFKEYVQGTLMKSLANLESYP--YKGDGVIIMAGG 175

Query: 205 KFSLLSTLVIKTIRN-----LKINLPIEVFIPPMDEGDDELCNTLLPKYN----AKCIFL 255
           + +L +   IK IR      ++ ++PI++ IP   + D+  C  +LP  +    + C+F 
Sbjct: 176 EHTLSAMASIKAIRQNGGIIMRRSVPIQIVIPSKKQDDEVFCTKVLPMLDPTGLSTCLFF 235

Query: 256 SDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGL 315
            D    D +N   KI+  Q K +A+  SSF+ VLLLD+D + + +ID  F+       G+
Sbjct: 236 EDIFDSDVLN---KIESSQYKSLALIVSSFRRVLLLDSDTFVVNSIDGYFHHSQLKENGM 292

Query: 316 IFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGT 375
           I WPDYWRR   P  Y I+  ++  + R+R ++DD +P  +Y E  K     P HD E  
Sbjct: 293 ILWPDYWRRLHHPDLYKIVGINVHADTRLRFSVDDSSPKVLY-ESPKGDSPFPFHDSENA 351

Query: 376 LPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGAN-- 433
           +PD ST SG L+I+K+ HL ++++++YY+  GP+ YYP+L      E +K+TF   A+  
Sbjct: 352 IPDGSTASGPLLIDKQIHLDTIIMSLYYSFNGPSLYYPLLGCDQGSECEKDTFALAAHAL 411

Query: 434 FFNLP-FYQVKKHVGTDGY--------------------TRPGGYRGVAMFQHDFIQDY- 471
           + + P +YQVK     +G+                         +R VAM  +D+I+D  
Sbjct: 412 YPDTPKYYQVKTPSAHEGHWENITTGVRILDEELASTNSDEGKTFRKVAMLLYDYIEDTE 471

Query: 472 -------TAYENAKTFIEK-KYPNTKQDKIDKEYSPFDFTDKFFEDE--------HADP- 514
                     ENA T +E  K          K + P D  D    DE        H D  
Sbjct: 472 FARLAREIIKENADTLLESFKNDGNAHHANRKTFKPRDINDLETNDELRADFWKKHNDVY 531

Query: 515 ----------VIDVMFVHAHLPKFEPVALWEENDLMQDGS------------------HV 546
                      I + F+ +  P + P  L    D+  D +                  H 
Sbjct: 532 HIQDFLLFFDFIPMKFIRSLSPSYNPWKLLTTGDMQFDAARALKGHENDPKYKPAHSGHY 591

Query: 547 RSYTK-YDKLNHYDLEMENFKALEELLCLEKPFEFK---YLKDKLSDDKE---KWQGLCK 599
           R Y+     + +YDLE+ N+   E  +C  K F ++   YLK ++ + K+   +++ +CK
Sbjct: 592 RMYSSGISTVTNYDLELANWSLFENFVCNSKAFTYRDYGYLKQQIENTKDPALEYKKMCK 651

Query: 600 YIKDRHIFMEKT 611
           YI++R  ++  T
Sbjct: 652 YIRNRVKYLRNT 663

>CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa]
           {ON} some similarities with uniprot|P46982 Saccharomyces
           cerevisiae YJL186w or uniprot|P38069 Saccharomyces
           cerevisiae YBR015c
          Length = 564

 Score =  209 bits (531), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 145/491 (29%), Positives = 237/491 (48%), Gaps = 41/491 (8%)

Query: 134 CPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYIDGLKELGSSPDMY 193
           C L + I   +        L+   L  C  +       LK +H  Y   ++ L  S D Y
Sbjct: 85  CTLVAPISVEETSDDTLKQLSYMTLDYCFHLSPTQTNNLKTAHNGYCRRVETLFGSLDEY 144

Query: 194 SGD-------GIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLP 246
             D       GIV + G + +L     I  +R +   LPIEV  PP    +D+ C+  LP
Sbjct: 145 LRDSLMPRYKGIVTLGGNERTLSLLASIPRLRKMGSTLPIEVIFPPYVSNEDKFCDDFLP 204

Query: 247 KYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFY 306
           +YN KCI++S  LPE  +    K D    ++     S+FK++L ++++++   N+D  F 
Sbjct: 205 RYNGKCIYMSKALPEYVLKAH-KFDEKMIRMFTPLVSTFKSILYMESNDFANTNVDKAFD 263

Query: 307 SEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYT-EDLKNHK 365
           S+ ++  GL+ WP   RRSTSP++Y I++R I  N R RN  DD++ P+ YT + L+N +
Sbjct: 264 SKSFTDTGLVLWPGRSRRSTSPAFYQIVNRKIDLNNRTRNLADDVSRPTRYTSQALENIQ 323

Query: 366 -----DIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
                  PMHD +G +PD  T  G  MI+K+KH K+L+LAMYY ++G  W+  +   +  
Sbjct: 324 FNLLAHTPMHDLDGAIPDAVTHVGHYMIDKQKHFKTLMLAMYYAVHGEMWFDMMFAPEKG 383

Query: 421 GEGDKETFIAGANFFNLPFYQV----KKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYEN 476
             G +E  +A A+   L +YQV    +   G    T   G      F  DF  DY  ++ 
Sbjct: 384 SSGYRENIVAAAHALELSYYQVHLIPRSMRGGSKDTLQSG-ETFMHFDPDF--DYRKHQA 440

Query: 477 AKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVIDVMFVHAHLPKFEPVALWEE 536
               ++ K  +      D++Y+     +K     + D  +  +F+    P+F+P+AL+ +
Sbjct: 441 LADKVKSKLIDVHS--FDRKYTAIRTFEKDLLAGNQD--VKSIFIEMPSPQFDPLALFFK 496

Query: 537 NDLMQDGSHVRSYTKYDKLNHYD----LEMENFKALEELLCLEK-PFEFKYLKDKLSDDK 591
                     +S  K D+ +  D    LE +N+  L E+LC +  P   + + +  S  K
Sbjct: 497 ---------AKSLQKLDRKDKVDDLMALERQNYSNLMEVLCRDTDPLVLQMMVNHPS--K 545

Query: 592 EKWQGLCKYIK 602
            K + +C Y+K
Sbjct: 546 YKMKDMCVYLK 556

>AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR015C (MNN2)
          Length = 681

 Score =  186 bits (472), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 162/595 (27%), Positives = 265/595 (44%), Gaps = 109/595 (18%)

Query: 113 VYDLLRS--AGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLA 170
           V ++LR+  A P G +  +   DC L+     R  D  K+  LT   L  C+ +  ++ A
Sbjct: 92  VEEILRTVQAYPPGAA-LQVQADCLLER---VRATDERKFGSLTASKLQGCVDLSGDAFA 147

Query: 171 MLKNSH--------RKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIR---- 218
             K  H        +   + L +L   P  Y  DGIV++ GG  ++ +   I++IR    
Sbjct: 148 HAKEQHALMMKVIQKSLPEHLSDLDHYP--YISDGIVILGGGHKTIAAIPAIRSIRENSG 205

Query: 219 -NLKINLPIEVFIP-PMDEGDDELCNTLLPKYN----AKCIFLSDFLPEDKINEDIKIDG 272
             ++ ++PIEV IP P DE +   C+ +LP  +     +C+ L D +    ++   K+  
Sbjct: 206 ITVRNSMPIEVVIPGPADE-EKVFCSKILPVLDPSGLTRCVHLGDTISSSLLS---KVKP 261

Query: 273 YQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYD 332
              + +A+ ASSF  VL LD+    I  ID  F+ E ++ RGL+ WPDYWRR   P  Y+
Sbjct: 262 SDHRTLALLASSFSRVLYLDSSVQVINAIDGYFHHELFNERGLVLWPDYWRRLHHPKLYE 321

Query: 333 ILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEK 392
           +    +    R R ++D  +P  +Y        + PMHD + ++PD S+ SG L+I+K+K
Sbjct: 322 LAGSKVDTGRRERYSIDKGSPIELYG---GKDGEWPMHDCKDSIPDASSSSGVLLIDKKK 378

Query: 393 HLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNL---PFY-QVKKHVGT 448
           H K+L LA+YYN++G  ++YP+L  KA  E +K+T +  A+  +    P Y QV     +
Sbjct: 379 HFKTLALALYYNVHGEPFFYPLLDPKAPREAEKDTIVFAAHVLSRGGGPLYHQVTTPKRS 438

Query: 449 DGY------TRP-------------GGYRGVAMFQHDFIQDYTAYENAKTFIEKKYPN-- 487
           +G+      ++P               YR  A   HDF  D+     A   I   + +  
Sbjct: 439 EGHRKDKASSKPILEDTVDTSTIITSTYRHGAASYHDFFADHNFELLAGEIINSNFDSRR 498

Query: 488 ---------------TKQDKIDKEYS-PFDFTDKFFEDEHADPVID----------VMFV 521
                          T +DK D++ S        F+   H +  +           V FV
Sbjct: 499 LAYVKWWRQNHSDDTTYKDKSDEDLSNDASVKADFYTSFHGNYTLAEYLNFFEFTPVSFV 558

Query: 522 HAHLPKFEPVALWEENDLMQDGS--------------------HVRSYT-KYDKLNHYDL 560
              +    P  + +  DL  DG+                    H R ++  + KL  YDL
Sbjct: 559 ETDVLTCNPWIVAQSRDLTFDGASAVGAQPANQQTQYKAGPPTHHRLFSDHFQKLTTYDL 618

Query: 561 EMENFKALEELLCLEKPF-EFKYLKDKLS---DDKEKWQGLCKYIKDRHIFMEKT 611
           E+  + A  E LC +  + ++ YLK+ L         ++ +CKYI  R   ++ T
Sbjct: 619 ELATWSAYAEFLCSKFSYKDYPYLKEHLGLTDSPTTAYKMMCKYISARVSHLQST 673

>CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 632

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 17/170 (10%)

Query: 269 KIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSP 328
           +I  +  K  A   ++F+ VLLLDAD  P  ++D+ F  + Y   GL FW D  R S + 
Sbjct: 322 QITSFHNKFFAAMFNTFEEVLLLDADVVPYVSLDEFFNLKGYKDTGLQFWRDRNRGSDTH 381

Query: 329 SYYDILDRDISQNERVRNNLD---DITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQ 385
            +   L   +  +    N L         S+  + +++ ++   H F   L   + +SG 
Sbjct: 382 KFCSNLGVYLEPSLEEHNLLGTELKFRINSLAKKKVRSSEERAFHRFFNELKVHNIDSGI 441

Query: 386 LMINKEKHLKSLLLA-MYYN--MYGPNWYYPILTQKASGEGDKETFIAGA 432
           +++NK++ L SL++  ++Y    +G   Y           GDKE F+ GA
Sbjct: 442 IVLNKKQKLHSLIMGEIFYTNGRFGRCAY-----------GDKEMFMMGA 480

>Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C
           (REAL)
          Length = 553

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 114/259 (44%), Gaps = 31/259 (11%)

Query: 194 SGDGIVLVAGGKFSLLSTL-VIKTIRNLKINLPIEVFIPPMDEGDDELCNTL-------L 245
           +G   ++++     L  TL ++K +R++K N PIE+ +   D   D + + +        
Sbjct: 167 TGSRGIVISASDAQLDETLRLLKVLRSIKNNFPIEI-VHKGDLSKDSIGSLVKYARNQDA 225

Query: 246 PKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIF 305
            +Y A+ I+  +           K + Y  K +A+  SSF+  +LLD+D  P  +ID ++
Sbjct: 226 LEYPAQEIWFLNVHSVLSPGYSEKFEAYSNKWLALIFSSFEIPILLDSDTVPFVSIDKLY 285

Query: 306 YSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHK 365
             E +   G++F+ D   R  S   +     ++SQ + ++  +      ++  E   NH 
Sbjct: 286 KLEEFQRTGVLFFKD---RIISDDLF-----ELSQVDVLKEVIYGCVGLNLTDESNINHI 337

Query: 366 DIPM--HDFEGTLPDV---STESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
             PM     E  L        ESG ++++K++HL S+L ++         Y+        
Sbjct: 338 KDPMVAQALENMLVKKYKHHLESGLVILDKKRHLFSVLTSLALQFSPIAEYF-------- 389

Query: 421 GEGDKETFIAGANFFNLPF 439
             GDKE F  GA     PF
Sbjct: 390 -HGDKEWFWLGALLSGNPF 407

>NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123
          Length = 656

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 122/289 (42%), Gaps = 36/289 (12%)

Query: 192 MYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMD---EGDDELCNTLLPKY 248
           M  G GIV+      S +    +K + +L   LPI++     +   E  ++L N +  + 
Sbjct: 267 MSMGKGIVVTMSEGDSYMFKKQLKVLDHLNNELPIQIITKGNEFSTEFINDLSNFVQKET 326

Query: 249 NAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSE 308
             K   L+     D    D  I  +  K +A+  ++F+ +++LDAD  P   I+D F  +
Sbjct: 327 KQKVAILNISSMLDPAFADKYIVNFYNKWLAVIFNTFQEIIILDADVVPFVPINDFFEEK 386

Query: 309 PYSSRGLIFWPDYW-------------RRSTSPSYYDILDRDISQNERVRNNLDDITPPS 355
            + + G++ + D                +   PS  ++  + ++    V +N +   PPS
Sbjct: 387 KFKNSGMLLYKDRLMVNEHTFSYCIDSMKFLEPSSLEL--KYLNTKLLVDSNTEIAIPPS 444

Query: 356 VYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPIL 415
             +E+L  +     ++F   L     +SG ++INK++ L  LLL+   ++ G        
Sbjct: 445 --SEELSVY-----YNFFKNLRLHHIDSGLVVINKQEKLNGLLLSFALHLDG-------- 489

Query: 416 TQKASGEGDKETFIAGANFF--NLPFYQVKKHV-GTDGYTRPGGYRGVA 461
             +    GDKE F  G  F   +   Y +   V G  G T P G   VA
Sbjct: 490 KLRRCVYGDKEFFWLGQLFIGQDYSIYSMDGGVSGPLGETNPDGKNSVA 538

>SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]
           {ON} similar to uniprot|P53059 Saccharomyces cerevisiae
           YGL257C MNT2 Mannosyltransferase involved in adding the
           4th and 5th mannose residues of O-linked glycans
          Length = 577

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 99/245 (40%), Gaps = 58/245 (23%)

Query: 192 MYSGDGIVLVAGGKFSLLSTL-VIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNA 250
           M SG   ++++ G+F    T+ +I+ +R LK NLPIEV    + +GD      L P + +
Sbjct: 180 MQSGSRGIVLSIGQFQTADTIRLIRILRFLKNNLPIEV----VHKGD------LSPHHQS 229

Query: 251 KCIF-----LSDFLPEDKI-----------NEDIKIDGYQTKVVAIAASSFKNVLLLDAD 294
             I      LSD  P  ++               K   Y  K +A+   SF+  +LLDAD
Sbjct: 230 VLIGAAREDLSDEYPGQELWFLDVTNMLNPQYSAKFTRYSNKWLALLFCSFEQPILLDAD 289

Query: 295 NYPIKNIDDIFYSEPYSSRGLIFWPD--------------YWRRSTSPSYYDILDRD--- 337
             P    +  + SE + + G  F+ D               + R  +        RD   
Sbjct: 290 TVPFTTFERYYQSEQFKNSGTFFFKDRKLKSNLLKKKHLLAFNRIVTTLLGLHFPRDHSL 349

Query: 338 -ISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKS 396
            I   +      D+I+  +V    LK H+                ESG ++INK +HL S
Sbjct: 350 HIFHTQLSLQLNDEISVETVENLLLKGHRH-------------HMESGLVVINKRRHLFS 396

Query: 397 LLLAM 401
           LL ++
Sbjct: 397 LLASI 401

>CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {ON}
           some similarities with uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 642

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 104/247 (42%), Gaps = 18/247 (7%)

Query: 194 SGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMD-EGDDELCNTLLPKYNAKC 252
           SG GIVL A      +    +   + L    PI+V     +   D+E+      +   + 
Sbjct: 242 SGRGIVLSAKPDDIDMLRQQLSVWKELGNKYPIQVVHKGGELTRDNEISLKQFAEETDQN 301

Query: 253 IFLSDFLPE-DKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYS 311
           I++ D  P  DK   D  I  +  K V +  ++F+  +++DAD  P  + +D F SE + 
Sbjct: 302 IYIVDAGPVLDKNFADEHITKFHNKWVGVLFNTFEEYIMVDADTVPFISAEDFFESENFK 361

Query: 312 SRGLIFWPDYWR-----RSTSPSYYDILDRDISQNERVRNNLD-DITPPSVYTEDLKNHK 365
             G+  W D        R   P     L+  + ++  +   L   +  P +  E  K  +
Sbjct: 362 KSGMRMWRDRTLTNRHIREHCPDLALKLEPSLEEHRILGTTLRFKLLDPDLKQE--KTSE 419

Query: 366 DIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDK 425
           +   +     L     +SG ++INK++ L SLLL+ ++  +        L ++ S  GDK
Sbjct: 420 ERAFNQMRTNLALHHVDSGLVVINKKEKLHSLLLSEFFQNHA-------LFRRCS-YGDK 471

Query: 426 ETFIAGA 432
           E F   A
Sbjct: 472 ELFWYAA 478

>CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 637

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 118/285 (41%), Gaps = 49/285 (17%)

Query: 195 GDGIVL-VAGGKFSLLSTLVIKTIRNLKINLPIEV------FIPPMDEGDDELCNTLLPK 247
           G GI L VA     LL +L  K +  L    P+EV        P M++    L      +
Sbjct: 247 GRGITLTVAPDDIKLLRSL-FKVLEKLGNEYPVEVVHKGGEMTPKMED----LIRQYAEE 301

Query: 248 YNAKC--IFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIF 305
            N +   I LS  L  D  +++IK   ++ K  A   ++F+  +LLD D     + +  F
Sbjct: 302 TNQEVYVINLSPILDPDFASQNIK--SFKNKWFAAMFNTFEEAILLDVDVVLYASPEYFF 359

Query: 306 YSEPYSSRGLIFWPD--YWRRSTSPSYYDILDRDISQ------NERVRNNLDDITPPSVY 357
             + Y   GL+ W D  Y    TS       DR  S       +E     L  I    + 
Sbjct: 360 ELDGYKKTGLMLWKDREYTEVETS-------DRCASMAPYFEPSEEEHELLGTIQKYRLT 412

Query: 358 TEDLKNHKD---IPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPI 414
             DL+ H +     ++DF         +SG ++INK++ L +LLLA YY+M   + Y+  
Sbjct: 413 GPDLETHNESEATTLNDFFNNKLATIIDSGVVLINKKQKLNALLLAAYYHM---SKYFGG 469

Query: 415 LTQKASGEGDKETF-----IAGANFFNLPFYQVKKHVGTDGYTRP 454
            T      GDKE F      AG +++  P       +G  GY  P
Sbjct: 470 CTY-----GDKELFEIAALAAGEDYYVDP--NKAGAIGPIGYHPP 507

>Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}
           YGL257C (MNT2) - Mannosyltransferase [contig 247] FULL
          Length = 568

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 103/243 (42%), Gaps = 27/243 (11%)

Query: 197 GIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPP-MDEGDDELCN-TLLPKYNAKCIF 254
           GIVL        L   ++K + + K  LPI+V     + E    L +  L P  N   + 
Sbjct: 182 GIVLSFPDSHVSLVIRLLKVLHHQKNELPIQVIHKGDLSEASKNLISEALSPSQNLWFVD 241

Query: 255 LSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRG 314
           +S  L +  + +     GY+ K +A+  ++F   + +DAD   + + +D F    Y+  G
Sbjct: 242 VSSMLNKRFVRD---FSGYKNKWLAMILNTFSEAVFIDADAVSMMSFEDYFEMGLYNQTG 298

Query: 315 LIFWPDYWRRSTSPSYYDILDRDISQNE---------RVRNNLDDITPPSVYTEDLKNHK 365
            +F+ D  R       YD     I   +         + R  L D+   +  T+D    +
Sbjct: 299 ALFFKD--RAFDHKFDYDFCVPMIKSLQPGKHETRYFQHRKRLIDLQLRN--TQDPSTEQ 354

Query: 366 DIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDK 425
            I    FEG       +SG ++I K KHL  LL A++ N+       P L++     GDK
Sbjct: 355 TIIKDFFEG-YQRHQMDSGLVLIEKGKHLTPLLAAVFLNL------APKLSK--CTHGDK 405

Query: 426 ETF 428
           ETF
Sbjct: 406 ETF 408

>CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 636

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 72/150 (48%), Gaps = 18/150 (12%)

Query: 191 DMYSGDGI-VLVAGGKFSLLSTLVIKTIRNLKIN-LPIEVFIPPMDEG------DDELCN 242
           +M  G GI V V+  +  +L +L    + N + N LPI++    +D+G      D EL  
Sbjct: 245 NMAKGKGIAVSVSPKEIRMLHSLF--AVLNQQGNKLPIQI----IDKGETLTLADKELIK 298

Query: 243 TLLPKYN--AKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKN 300
           +   K N     + LS  +  +  +E+I   G   K  A   ++F+ VLLLD D  P   
Sbjct: 299 SYAVKTNQDVSVVDLSPIIDAEYADENII--GMHNKWFAAMFNTFEEVLLLDVDVIPFVG 356

Query: 301 IDDIFYSEPYSSRGLIFWPDYWRRSTSPSY 330
            +  F  EPY+SR ++FW +   +  +P Y
Sbjct: 357 TEKFFQLEPYTSRHILFWRNRDIKKKNPKY 386

>KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 112/266 (42%), Gaps = 51/266 (19%)

Query: 194 SGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKC- 252
           SG G+V+  G     +   +++ + NL+ ++PI+V +    E   +    L  +Y  +  
Sbjct: 233 SGRGVVITMGDNDVDMFGRLVRVLENLENDIPIQV-VTTGKEMKPQFIQQLR-EYTVQTG 290

Query: 253 --IFLSDFLPE-DKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEP 309
             I L D  P  D++    KI  +  K VA   ++F+  +L+D D+ P   +   F  E 
Sbjct: 291 QRIQLVDSSPMLDRLYVAFKITRFLNKWVATIFNTFEEAILIDVDSIPFVPLSTFFEIES 350

Query: 310 YSSRGLIFWPDYWR---------------RSTSPSYYDI------LDRDISQN---ERVR 345
           Y + G+  + D  R               R+  PS  +       L  D+SQ+   +R +
Sbjct: 351 YKTTGIYMYRD--RDIKHEHAPEKCIADFRNLEPSVQETDLIGTSLRFDLSQSNDLQRQQ 408

Query: 346 NNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNM 405
            N + IT   V  ++  ++ ++   D           SG ++INK K L SLLLA   ++
Sbjct: 409 QNGESITIEEVIYKNFFHNYNLHQVD-----------SGLVVINKHKQLHSLLLAFQLHL 457

Query: 406 YGPNWYYPILTQKASGEGDKETFIAG 431
            G          +    GDKE F  G
Sbjct: 458 SG--------VFEKCVHGDKEFFWLG 475

>Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {ON}
           YIL014W (MNT3) - Product of gene unknown [contig 135]
           FULL
          Length = 619

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 116/303 (38%), Gaps = 46/303 (15%)

Query: 195 GDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCN-TLLPKYNAKCI 253
           G G+V   G +       ++K +     +LPI++   P +  D  L N T   + + + +
Sbjct: 222 GKGLVFSLGERHLDPFLRLLKILDQQNNSLPIQIVQQPHELSDAFLGNLTEFLQSSHQEV 281

Query: 254 FLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSR 313
           +  D            +  +  K +A   ++F  V+L+DAD  P   ++  F  E Y + 
Sbjct: 282 YYIDCEALLDTTYKAYMTYFVNKWLASIFNTFSEVVLMDADVVPFVPVESFFQEEQYKAT 341

Query: 314 GLIFWPDYWRRSTSPSYYDIL-----------DRDISQNERVRNNLDDITPPSVYTEDLK 362
           G++ + D  R     + +D                +  N R++ N   + P +       
Sbjct: 342 GVLLYKD--RDMPQETTFDYCITTFKLLEPSSQEVVLMNHRMKTNSSVVDPGA---HIFA 396

Query: 363 NHKDIPMHDF--EGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
           N KD   H F    TL +V  +SG ++++K + L  LL++   N          L QKAS
Sbjct: 397 NEKDKVYHRFFYNETLHNV--DSGLVVLHKTERLSGLLISFIMN----------LDQKAS 444

Query: 421 G--EGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--GGYRGVAMFQHDFIQDYTAYEN 476
               GDKE F  G  F            G D    P  G   G     HD +  +  YE 
Sbjct: 445 NCIYGDKELFWLGQLF-----------SGNDYAIDPLDGAAVGRVNLTHDKVSGHQKYEI 493

Query: 477 AKT 479
             T
Sbjct: 494 CAT 496

>Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W
           (REAL)
          Length = 630

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 74/165 (44%), Gaps = 11/165 (6%)

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPS 329
           I  +Q K VA   ++FK  +LLDAD  P    D  F S  Y   G++ + D   +S    
Sbjct: 311 ISFFQNKWVATLFNTFKEYILLDADVVPFVESDYFFDSPSYRQSGILLFKDRVMKSEQTF 370

Query: 330 YYDI-LDRDISQNERVRNNLDD--ITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQL 386
            Y I + R++  + + R ++    I   S+    + + +    ++F   L     +SG +
Sbjct: 371 SYCIEMLREVEPSGQERKSIGSKLIFDSSLPFSSINSEEASVYYNFFKKLQLHHVDSGLV 430

Query: 387 MINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAG 431
           ++NK + L  LL++  +N+ G          +    GDKE F  G
Sbjct: 431 VVNKLEKLNGLLMSFMFNLNG--------KLQRCVYGDKEIFWLG 467

>TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 142/366 (38%), Gaps = 51/366 (13%)

Query: 172 LKNSHRKYIDGLKELGSSPDMYS---GDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEV 228
           L  +  KY   L   G+  D+ S     GIV+  G      +T +IK +R     LPIE+
Sbjct: 150 LGAAKSKYNKNLSFWGNWLDLLSKSSSKGIVISVGAGQISDATKLIKVLRYQMNALPIEI 209

Query: 229 FIPPMDEGDDELCNTLL---------PKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVA 279
            I   D  +D+    LL           Y A+ ++  +           +   Y  K +A
Sbjct: 210 -IHRGDLSEDQ--QQLLIQAARSAHSASYPAQELWFVNVSNVLNPRHAEQFATYSNKWLA 266

Query: 280 IAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDIS 339
           I  SSF++ +L+DAD  P  +++  +  + Y   GL+F+ D  R  TS    D+L     
Sbjct: 267 IIFSSFESPILVDADTIPFISLEKYYDFQQYKEMGLLFFKD--RAITS----DLL----- 315

Query: 340 QNERVRNNLDDITPPSV----YTEDLKNHKDIPMHDFEGTLPDVS---------TESGQL 386
            N+   N L  I   ++       DL N  ++ + D       +S          ESG +
Sbjct: 316 -NKEQLNTLKQIALSTIKLGSAAADLNNAIELGIKDNIAAETVMSMLVEGQKHHMESGLV 374

Query: 387 MINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPF-YQVKKH 445
           +++K  HL +LL ++       + Y+          GDKE F       N PF +  K+ 
Sbjct: 375 LLDKSLHLVNLLTSVSLQFSSISSYF---------HGDKEWFWIAYLLRNRPFTFHPKQA 425

Query: 446 VGTDGYTRPGGYRGVAMFQHDFIQ-DYTAYENAKTFIEKKYPNTKQDKIDKEYSPFDFTD 504
                  R     G   +Q   +Q  +T  + +  +I       K++    +Y+      
Sbjct: 426 SNVGKLGRVQSEDGKEFYQICSVQVSHTELDGSLLWINGGLKTCKKNSWTSDYASNKRIS 485

Query: 505 KFFEDE 510
             F +E
Sbjct: 486 SMFNNE 491

>TPHA0H00240 Chr8 (40339..42828) [2490 bp, 829 aa] {ON} 
          Length = 829

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 109/281 (38%), Gaps = 47/281 (16%)

Query: 199 VLVAGGKFSLLSTL-VIKTIRNLKINLPIEVFIPPMDEGDDELCNTL------------- 244
           ++++     L++ L  +   R+ K+ LPI  F+   D+   E  + L             
Sbjct: 347 IIISMSDHQLVTALKWLAAARHAKVTLPI-FFMFKNDDVSKETMHKLHRVARSYDVDIPN 405

Query: 245 ---LPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNI 301
               PK +   I L   +   K+NE  K   Y+ K +A+  +  K VL LD D     + 
Sbjct: 406 SKNYPKLDIWFIDLKPSIETSKVNEFTK---YKNKWLALLLNPLKEVLFLDTDTVNYMDP 462

Query: 302 DDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNER----------VRNN--LD 349
           +  F +E + + G +F+ D +           +   +S N +            NN  L 
Sbjct: 463 NFYFETEQFKNTGTLFFRDRFLNIGKSEVCSQISETLSPNFQESFYFGKLPLFDNNYILK 522

Query: 350 DITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPN 409
           ++T   + TE+L     +    F+  +     ESG + ++KE H+  LL++   N+Y P 
Sbjct: 523 NLTETDLTTEEL-----VFKSYFDNNIQH-ELESGLMALDKENHIIPLLISRNLNLYKP- 575

Query: 410 WYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDG 450
                        GDKE F  G      PF       GT G
Sbjct: 576 -------FAGCSHGDKEFFWLGFVASGAPFSIYPVRAGTVG 609

>Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL257C
           (REAL)
          Length = 562

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 84/196 (42%), Gaps = 32/196 (16%)

Query: 269 KIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSP 328
           K   Y  K +A+  SSF+  +LLD+D  P  +ID  +  E +   G++F+ D   R  S 
Sbjct: 253 KFATYSNKWLALIFSSFEIPILLDSDTVPFVSIDKFYKLEEFQKTGVLFFKD---RVISD 309

Query: 329 SYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDV--------- 379
             +     D  Q E +++ +   T  ++  E  K   +I  H  E T+  V         
Sbjct: 310 DLF-----DPPQLEVLKDIIHGCTGINLLDES-KIRDNIAEHIREPTVARVLENMLIKKY 363

Query: 380 --STESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFN- 436
               ESG ++++K KHL S+L ++       + Y+          GDK+ F  G    N 
Sbjct: 364 KHHLESGLVVLHKGKHLFSMLTSISLQFSPISEYF---------HGDKDFFWLGELLSNN 414

Query: 437 -LPFYQV-KKHVGTDG 450
              FY V   ++G  G
Sbjct: 415 HFTFYPVDASNIGQLG 430

>KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {ON}
           Anc_7.123 YIL014W
          Length = 694

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 97/229 (42%), Gaps = 24/229 (10%)

Query: 195 GDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTL--LPKYNAKC 252
           G GIVL      S +    + T + L   LPI+V +    E  ++   TL  L K   + 
Sbjct: 286 GKGIVLTMRESDSGMFYKQLNTFKELGNKLPIQV-VTTGKEATNKFVETLGKLAKKTEQK 344

Query: 253 IFLSD---FLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEP 309
           I+L D    L  D + +  KI  +  K +A   ++F+  + +D D      + D F +E 
Sbjct: 345 IYLVDVSKLLKPDFVQD--KIINFLNKWIATIFNTFEEEVFIDVDAISYVPMQDYFQTEN 402

Query: 310 YSSRGLIFWPD--YWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDI 367
           Y   G++ + D    + +T     D+L       E VR         S++   LK + D+
Sbjct: 403 YKDTGILMFRDRTLLQENTFKRCTDLLIEAEPTKEEVRLIGSRQMFDSLW---LKKNDDV 459

Query: 368 PMHDFEGTLPDV-----------STESGQLMINKEKHLKSLLLAMYYNM 405
           P  +   T  +V             +SG + I+K+  L  +L++ ++N+
Sbjct: 460 PDKELMSTEAEVYRNFYERLKLHHVDSGLIAIHKKYKLTGVLMSFFFNL 508

>CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2
          Length = 627

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 97/253 (38%), Gaps = 16/253 (6%)

Query: 195 GDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGD---DELCNTLLPKYNAK 251
           G GIV+    + + +   +I  + +LK  LPI++ I     G    + L    + K    
Sbjct: 222 GRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTIEMLKEKAIEKKQQI 281

Query: 252 CIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYS 311
            I  +  L  +K  E + I GY  K +A   ++F+  +LLD D  P  N    F  + Y 
Sbjct: 282 YIVDATKLLMEKYAE-VHIQGYTNKWIASIFNTFEEFILLDVDTVPFINPKKFFEKKGYR 340

Query: 312 SRGLIFWPD--YWRRSTSPSYYDILD-RDISQNE-RVRNNLDDITPPSVYTEDLKNHKDI 367
           + G   + D             DI+    +S  E RV N     +P     +D       
Sbjct: 341 TTGFYMYQDRNLVNEKLGRKCVDIISGAQLSGYEARVLNTGFLYSPYFAREDDYTTASAR 400

Query: 368 PMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKET 427
             +           ES  ++INK++ L  LL++   N          +  K    GDKE 
Sbjct: 401 AYYKLFNNWTLHQAESVLVVINKKQKLGGLLMSFMLNTQ--------IALKQCFLGDKEF 452

Query: 428 FIAGANFFNLPFY 440
           F  G    N P+Y
Sbjct: 453 FWIGQLMNNSPYY 465

>NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123
          Length = 639

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 75/172 (43%), Gaps = 30/172 (17%)

Query: 276 KVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDI-- 333
           K +AI  ++F+ ++L+DAD  P   +   F SE Y + GL+ + D   +      Y +  
Sbjct: 324 KWIAILLNTFEELVLIDADVVPFVPLKSFFKSEGYKTTGLLLFKDRNMKGEHTFTYCMES 383

Query: 334 ---LDRDISQNERVRNNL------DDITPPSVYTEDLKNH--KDIPMHDFEGTLPDVSTE 382
              ++    + E ++ NL      +  +P S     + NH  KD+ +H           +
Sbjct: 384 LKYMEPSRQETEYIQTNLLIDSTKELPSPTSSEEAAVYNHFFKDLRLHH---------VD 434

Query: 383 SGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANF 434
           SG + +NK + +  LL++   ++ G         Q+    GDKE F  G  F
Sbjct: 435 SGLVTVNKNEKMNGLLMSFMLHLNGK-------IQRCV-YGDKEFFWLGQLF 478

>CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 623

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 108/260 (41%), Gaps = 46/260 (17%)

Query: 195 GDGIVL-VAGGKFSLLSTLVIKTIRNLKINLPIEV------FIPPMDEGDDELCNTLLPK 247
           G GI L VA     LL +L  K +  L    P+EV        P M++    L      +
Sbjct: 234 GRGITLTVAPDDIKLLRSL-FKVLEKLGNEYPVEVVHKGGEMTPKMED----LIRQYAEE 288

Query: 248 YNAKC--IFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIF 305
            N +   I LS  L  D   E+IK   +  K +A   ++F+ V+LLDAD     + D  F
Sbjct: 289 TNQEVYVINLSPILDPDFAEENIK--RFSNKWLAAMFNTFEEVMLLDADVVLYNHPDHFF 346

Query: 306 YSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDD-----------ITPP 354
             + Y   GL+ W D  R  T     D+ D+  +       +L++           +T P
Sbjct: 347 ELKGYQDTGLMLWKD--REITDT---DVYDKCTAMAPFFEPSLEEHKLLGTTQKYRLTGP 401

Query: 355 SVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPI 414
           S+  E     +   + D+         +SG ++ NK++ L +L+L+ YY+          
Sbjct: 402 SL--EAHNESEATTLIDYFRKKRLNVIDSGVVIFNKKQKLHALVLSNYYH---------- 449

Query: 415 LTQKASG--EGDKETFIAGA 432
           + +K  G   GDKE F  G 
Sbjct: 450 INRKFLGCVHGDKEFFEFGV 469

>TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {ON}
           
          Length = 730

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 87/198 (43%), Gaps = 28/198 (14%)

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSE--------PYSSRGLIFWPDY 321
           ++ +  K V+I  S+FK  + LD D+ P  N+D+ ++ E         Y   G++ + D 
Sbjct: 388 LNFFYNKWVSIIFSTFKETIFLDVDSIPFVNLDEFYFQENNINNDYKNYKDTGMLMYKDR 447

Query: 322 WRRSTSPSYY-----DILDRDISQNERVRNNL--DDITPPSVYTEDLKNHKDIPMH---- 370
              +     Y       ++  + +++ + +N+  +  +P       ++N  D  ++    
Sbjct: 448 MLINEFTFGYCMDALKFVEPSLQESQLINSNILFNSTSPKIDDITSIENTNDREIYNIYN 507

Query: 371 DFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIA 430
           +F   +  + + SG ++INK+K L SL+ ++  N+ G          +    GDKE F  
Sbjct: 508 NFLTKIFAIISISGLVVINKDKKLFSLIFSLMMNLNGK--------LQRCVYGDKEFFWL 559

Query: 431 GANFFNLPFYQVKKHVGT 448
           G  F    F  V  H G+
Sbjct: 560 GQLFAGERF-TVNTHDGS 576

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 108/262 (41%), Gaps = 52/262 (19%)

Query: 194 SGDGIVLVAGGKFSLLSTL-VIKTIRNLKINLPIEVFIPPMDEGDDELCNTLL------- 245
           SG   ++++     L  T+ ++K +R  K + PI++ +   D   D +   LL       
Sbjct: 179 SGSRGIVISASDTQLDETVRLLKVLRYFKNDYPIQI-VHNADLSQDSI--RLLVKYGRSE 235

Query: 246 --PKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDD 303
             P+Y A+ I+ S+           K   Y  K +A+  S F+  +LLD+D  P   ID+
Sbjct: 236 DTPEYPAQEIWFSNVRNLLSPKYSNKFATYSNKWLALIFSFFEVPILLDSDTVPFVPIDE 295

Query: 304 IFYSEPYSSRGLIFWPDYWRRSTS-----PSYYDILDR--------DISQNERVRNNLDD 350
            +  E +   G +F+ D   R  S      S  D+L          +++    +   ++D
Sbjct: 296 FYKLEEFQRTGALFFKD---RIISNDLFESSQLDVLKEIIHGCIGLNLTDESDIHEKIED 352

Query: 351 ITPPSVYTEDL-KNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPN 409
            T   V    L K HK                ESG ++++K+KHL S+L+++       +
Sbjct: 353 PTVVQVLENMLIKKHKH-------------HLESGLVVLHKDKHLFSVLISVALQFSPIS 399

Query: 410 WYYPILTQKASGEGDKETFIAG 431
            Y+          GDK+ F  G
Sbjct: 400 EYF---------HGDKDWFWMG 412

>CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 628

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 109/259 (42%), Gaps = 44/259 (16%)

Query: 195 GDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDD--ELCNTLLPKYNAKC 252
           G GI L A  K   L   + K    L    PI++    + +G +      +L+  Y  + 
Sbjct: 238 GRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQI----VQKGGEMSPTMESLIKDYAIET 293

Query: 253 ---IFLSDFLPEDKINEDIKID---GYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFY 306
              +F+ D  P   ++ D   D    +Q K  A   ++F+ V+L+DAD       +  F 
Sbjct: 294 NQNVFIVDLSP--VLDPDFATDHIRKFQNKWFASIFNTFEEVMLIDADVVIYTEPESFFN 351

Query: 307 SEPYSSRGLIFWPDY-------WRRST--SPSYYDILD--RDISQNERVRNNLDDITPPS 355
            + Y + GL+ W D          R T  +P +   L+  R +   ++ R     +T PS
Sbjct: 352 LDGYKNTGLLLWRDREIVDAKTHERCTDMAPYFEPALEEHRLLGTVQKYR-----LTGPS 406

Query: 356 VYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPIL 415
           + T D    +   + DF         +SG ++ NK++ L  L+LA Y++           
Sbjct: 407 LETHDEPEAE--TLFDFFHRRIVTIIDSGVVIYNKKQKLHGLILAEYFHN---------- 454

Query: 416 TQKASG--EGDKETFIAGA 432
           +++ +G   GDKE F  GA
Sbjct: 455 SKQFAGCVYGDKEYFEFGA 473

>AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YIL014W (MNT3)
          Length = 645

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 72/154 (46%), Gaps = 8/154 (5%)

Query: 172 LKNSHRKYIDGLKELGSSPDMYS-GDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVF- 229
           LK+  R  ID       +  ++S G GI + AG +   +   ++  + ++   LPIE+  
Sbjct: 220 LKDGQRLTIDDNLSFWKNWQLFSKGRGITITAGAEHVEMLPRLLNVLDHIGNTLPIELIN 279

Query: 230 ---IPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFK 286
              +PP     D++   +  K N + + L D     + +    I G++ K +A   ++F+
Sbjct: 280 AADLPPTT--IDKIAKYVQMKSN-QTVRLVDCGKTLEHSYRSLITGFRHKWLAYIFNTFE 336

Query: 287 NVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPD 320
             + +D D  P  +++ +F  E Y S G++ + D
Sbjct: 337 EAVFIDLDAVPFVDLEKLFEVEGYKSEGILMFRD 370

>Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON}
           (12426..14321) [1896 nt, 632 aa]
          Length = 631

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 102/254 (40%), Gaps = 29/254 (11%)

Query: 194 SGDGIVLVAGGKFSLLSTLVIKTIRNLKIN---LPIEVFIPP-------MDEGDDELCNT 243
           SG GIV+  G +      ++ K +R L+      PI++           ++E  DEL   
Sbjct: 238 SGKGIVITMGER---DKPMLFKLLRVLEFQDNKYPIQIVTSGNELSREFINEIHDELQRI 294

Query: 244 LLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDD 303
               Y   C  L D       ++D+ I+ +  K +A+  ++F+ V+ LD D  P  ++D 
Sbjct: 295 KQDVYLVDCGSLLD----PHYSKDLIIN-FLNKWLAVIFNTFEEVIFLDVDVIPFVDMDY 349

Query: 304 IFYSEPYSSRGLIFWPD--YWRRSTSPSYYDIL-DRDISQNERVRNNLDDITPPSVYTED 360
            F +E Y S  L+ + D      ST P   D+  + + S+ E        +        D
Sbjct: 350 FFDNEEYKSSNLLLYKDRVMLHESTYPHCIDMFHEVEPSREESAVLGTKILFDSRTKEFD 409

Query: 361 LKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
             +   +   +F   L     +SG +++NK + L  LL +   ++            +  
Sbjct: 410 HNSQVAMTFRNFFRKLQLHHVDSGLIVVNKMEKLNGLLFSFMLHLDAK--------VRRC 461

Query: 421 GEGDKETFIAGANF 434
             GDKE F  G  F
Sbjct: 462 VYGDKELFWIGQLF 475

>Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 107/255 (41%), Gaps = 29/255 (11%)

Query: 269 KIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSP 328
           K   +  K +AI   SF+  +LLD+D  P   +D  + ++ +   G +F+ D   RS   
Sbjct: 277 KFKRFSNKWLAITFCSFQKPILLDSDAVPFVPLDTFYEADEFKKTGTLFFKD---RSFPT 333

Query: 329 SYYDILDRDISQNERVRNNLDDITPPSVY-TEDLKN--HKDIPMHDFEGTLPDVS---TE 382
           S   +  R I+  ++V  +   I   S    E LKN  + D+ M   E           E
Sbjct: 334 SKLSL--RKINVLKKVIGDCLGIPLDSKKGLELLKNRLNDDMAMDAVESLFIKHQKHYME 391

Query: 383 SGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFN--LPFY 440
           SG L+++K+KH   LL+++         + PI   +    GDKE F  G    N    F+
Sbjct: 392 SGLLVLDKQKHFFGLLVSIMLQ------FSPI---REYFYGDKEWFWLGLLISNDTFTFH 442

Query: 441 QVK-KHVG-TDGYTRPGGYRGVAM-FQHDFIQDYTAYENAKTFIEK----KYPNTKQDKI 493
            V+  +VG  +  + P   R  ++   H  I D   + N    + K    KY  T++  I
Sbjct: 443 PVEASNVGKLEDSSTPDSARMCSIQLCHTDIHDNVLWLNGGLSVCKKACWKYDYTRRKDI 502

Query: 494 DKEYSPFDFTDKFFE 508
              +   D   K ++
Sbjct: 503 ASRFESVDELQKHYQ 517

>Kwal_23.5454 s23 (1171360..1173111) [1752 bp, 583 aa] {ON} YGL257C
           (MNT2) - Mannosyltransferase [contig 9] FULL
          Length = 583

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 113/274 (41%), Gaps = 42/274 (15%)

Query: 191 DMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEV------------FIPPMDEG-- 236
           + YSG GIV+  G         +++ +R LK  LPI++             I     G  
Sbjct: 184 ERYSGKGIVISIGEGGVDEVIRLLRVLRALKNTLPIQLVHKGDVSASSMNMIIQAGRGKI 243

Query: 237 -DDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADN 295
            D +   + + ++  +  F++      K N D+    +  K +A   +SF+ ++L+D+D 
Sbjct: 244 EDKQGIYSDISEHPQEIWFVNAARSIKKGNLDL-FQRFSNKWIASLFNSFEEMILMDSDV 302

Query: 296 YPIKNIDDIFYSEPYSSRGLIFWPDY----WRRSTSPSYYDILDRDISQNERVRNNLDDI 351
            P  N  ++F +  Y   G  F+ D     + RS+  S+Y  L    S+ E     +  +
Sbjct: 303 VPFLNPKELFDATEYRETGAYFFKDRPIDEFLRSSDLSFYRKLLP--SEWEYTAFEMQPL 360

Query: 352 TPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWY 411
           T  +     LK       H ++  +     ESG +++N+  H+  LL++    ++     
Sbjct: 361 TDHTYGNGFLK-------HGYKHFM-----ESGVVVLNRRNHMPGLLISATMQLWKET-S 407

Query: 412 YPILTQKASGEGDKETFIAGANFFNLPFYQVKKH 445
            PI        GDKE F  G +      Y+  K+
Sbjct: 408 QPIY-------GDKELFWLGQSIAGNENYRFNKN 434

>Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 104/248 (41%), Gaps = 34/248 (13%)

Query: 197 GIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGD-DELCNTLLPKYNAKCIFL 255
           G+V+         +  +I+T+R L  +LPIE+    + + D DE    LL     +   L
Sbjct: 199 GLVMSVSDYLVSDTIRLIRTLRLLNNSLPIEI----VHKSDLDERYQQLLIISARESASL 254

Query: 256 SDFLPEDKINEDI----------KIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIF 305
            D+ P++    D+          K   +  K +AI  SSF+  + LD+D  P   +D ++
Sbjct: 255 -DYPPQELWFLDVQSMLSDDYLGKFKRFSNKWLAITFSSFQVPIFLDSDTVPFAPVDTLY 313

Query: 306 YSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHK 365
            ++ +   G +F+ D   RS   S   +L   + + + + N+L          E LKN  
Sbjct: 314 QTDEFIRTGTLFFRD---RSFPNSKLSLLQIKVLK-QIINNSLGISLDSGQDFELLKNSL 369

Query: 366 D--IPMHDFEGTL---PDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
           +  I  +  E  +        +SG L+ +K+KH   L +A+         Y+        
Sbjct: 370 NDKIATNAIESLIFKQQKHHMDSGLLIFDKQKHFFCLPIAIMLQFSPIQEYF-------- 421

Query: 421 GEGDKETF 428
             GDKE F
Sbjct: 422 -HGDKEWF 428

>AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homolog
           of Saccharomyces cerevisiae YIL014W (MNT3) and YER001W
           (MNN1)
          Length = 381

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 72/175 (41%), Gaps = 38/175 (21%)

Query: 273 YQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPS--- 329
           ++ K +A   +S + V+ +D D  P  +ID  F  E Y S G++ + D    S   S   
Sbjct: 62  FRYKWLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGILMFQDRVFNSIKNSKCR 121

Query: 330 --YYDILDRDISQN--------------ERVRNNLDDITPPSVYTEDLKNHKDIPMHDFE 373
              + IL     Q                R++N  DD    SVY   L+  +   MH   
Sbjct: 122 TAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVYDRYLEGDR---MH--- 175

Query: 374 GTLPDVSTESGQLMINKEKHLKSLLLAMYYNM------YGPNWYYPILTQKASGE 422
                   ESG ++++K K + SL++++  +M      YG   Y   L Q  SGE
Sbjct: 176 ------MVESGLVVVDKRKKISSLIISLMLHMNIAECSYGDKEYL-WLGQLVSGE 223

>CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P53745 Saccharomyces cerevisiae
           YNR059w MNT4
          Length = 629

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 110/254 (43%), Gaps = 34/254 (13%)

Query: 195 GDGIVL-VAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKC- 252
           G GI L +A G   LL +L  K ++      P+++ I    E   ++  +L+ KY  +  
Sbjct: 238 GKGITLTIAPGDIKLLRSL-FKVLQRQGNEYPVQI-IQKGGEMTPKM-ESLIKKYALETE 294

Query: 253 --IFLSDFLP-EDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEP 309
             +++ D  P  D      +I  +Q K  A   ++F+  LLLDAD       +  F  + 
Sbjct: 295 QDVYIIDLAPILDPAFAIQRITKFQNKWFASMFNTFEEALLLDADVVLYTEPEHFFKMKG 354

Query: 310 YSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPM 369
           Y   GL+ W D  R  T+    +  DR  +    +  ++++ +      +       + +
Sbjct: 355 YQDTGLLLWRD--RELTA---LETPDRCAALAPHLEPSVEEYSLLGTRQKYRLTESSLKI 409

Query: 370 HD-------FEGTLPDVST--ESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
           H+       +E     + T  +SG ++ NK + L +L+ A Y++          +++K +
Sbjct: 410 HNEPEARTLYEYFHKKIVTIIDSGVVVYNKRQKLHALMTAEYFH----------ISRKFA 459

Query: 421 G--EGDKETFIAGA 432
           G   GDKE F  GA
Sbjct: 460 GCVYGDKEYFEFGA 473

>CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 620

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 119/300 (39%), Gaps = 63/300 (21%)

Query: 186 LGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLL 245
           +G+   +  G GIVL        L     +  + L   LPI+V +    E + EL    +
Sbjct: 223 IGNWRKLSRGKGIVLTVSQSDVPLLRQQFRVWKELGNKLPIQV-VHKGTEINAEL-EQKI 280

Query: 246 PKYNAKC---IFLSDFLPEDKINEDI---KIDGYQTKVVAIAASSFKNVLLLDADNYPIK 299
            +Y  +    +++ D  P   I+ D     I  +  K  A   ++F+ ++L+DAD  P  
Sbjct: 281 KEYAIEMEQDVYVVDLSP--VIDPDFAENSIQNFHNKWYAAIFNTFEELILIDADAIPYV 338

Query: 300 NIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITP---PSV 356
             +D   S+ Y   GL  W                DRDI+ +ER  +   ++ P   P++
Sbjct: 339 PAEDFLKSKSYKKTGLRLWR---------------DRDIT-HERTLHFCVEMAPYFEPTL 382

Query: 357 YTEDL-----------------KNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLL 399
              +L                 K+ +   +++F   +     +SG ++I+K+  + SL++
Sbjct: 383 EEHNLIGTTLSYRLTDSGLKDAKDSEGRALYEFFQKMYLHHVDSGLVVIDKKDKIHSLIM 442

Query: 400 AMY---YNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPF---YQVKKHVGTDGYTR 453
           +     +  +G   Y           GDKE F+ GA      +    Q    +GT GY +
Sbjct: 443 SEILHSHTRFGRCTY-----------GDKELFMLGAYMVGESYTLEAQSAAIIGTVGYEK 491

>KAFR0K01260 Chr11 complement(261190..263076) [1887 bp, 628 aa] {ON}
           
          Length = 628

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 70/175 (40%), Gaps = 13/175 (7%)

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFW-----PDYWRR 324
           +  +  K VAI  +  + V+ +DAD  P+ +++D F  E Y   GL  +     P     
Sbjct: 316 LKSFLNKWVAILFNPLEEVIFMDADAVPLISVEDYFKYEDYKESGLYVFKDRVMPHKLAT 375

Query: 325 STSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESG 384
               +    ++    +N  +  N    T  SV T            +F         +SG
Sbjct: 376 ERCIAMLHFVEPSAEENSLLGENSMVSTCKSVKTIKKTLMAKGVYDNFFEKAHLHQVDSG 435

Query: 385 QLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPF 439
            +++N++K L ++L++   ++        +   +    GDKE F  G  F + PF
Sbjct: 436 LVILNRKKKLNAMLMSFLLHL--------LPETQVCFHGDKELFWIGPLFMDEPF 482

>Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 102/248 (41%), Gaps = 34/248 (13%)

Query: 197 GIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLS 256
           G+V+ A       +  +++ +R L  +LPIE+    + + D    +  L   +A+    S
Sbjct: 199 GLVMSASDALVSDTIRLMRILRLLNNSLPIEI----VHKSDLSKSSQQLLIASARESASS 254

Query: 257 DFLPEDKINEDIK----------IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFY 306
           ++ P++    D+K             +  K +AI  SSF+  + LD+D  P   +D  + 
Sbjct: 255 NYPPQELWFLDVKSLIKDEYLNRFKRFSNKWLAITFSSFQMPIFLDSDTVPFVPLDGFYR 314

Query: 307 SEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYT-EDLKNHK 365
           +  +   G +F+ D   RS   S   +  +      ++ NN   I+  S    E LKN  
Sbjct: 315 TGEFERTGTLFFKD---RSFPLS--KLSSQQTKALRQIINNSLGISSNSEQGFESLKNSS 369

Query: 366 --DIPMHDFEGTLPDVS---TESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
             D  +   +  +        +SG L+I+K+KH   L +A+         Y+        
Sbjct: 370 KDDTAIGAIDSVIFKQQKHYMDSGLLVIDKQKHFFCLPIAIMLQFSPIQEYF-------- 421

Query: 421 GEGDKETF 428
             GDKE F
Sbjct: 422 -HGDKEWF 428

>ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 641

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 117/297 (39%), Gaps = 33/297 (11%)

Query: 150 WNVLTQDNLSKCLQIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLL 209
           W V+T  N         E  A+ +    +  DG     +      G GI +  G     +
Sbjct: 203 WPVITDINTGMTF----EGGAVWEGRQSEIDDGASFWKNWRSFSHGKGITMSVGDGHLEM 258

Query: 210 STLVIKTIRNLKINLPIEVFIPPMDEGD-------DELCNTLLPKYNAKCIFLSDFLPED 262
              ++  +  L   LPIE+    +++G        D+L   +  K   K   +S     D
Sbjct: 259 LLRMLTVLDYLGNELPIEI----VEKGGELSQQFRDKLTEFVRNKSKQKVRIISCARTLD 314

Query: 263 KINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYW 322
           + +  + I G+  K VA+  ++F+  + LD D  P    +  F  E Y S G++ + D  
Sbjct: 315 ETHARL-IFGFSCKWVALMFNTFEEAIFLDVDAVPYILPEQFFDMEGYKSTGIMLFRDRL 373

Query: 323 -RRSTSPSYYDILDRDISQNER--VRNNLDDITPPSVYTEDLKNHKD---IPMHD--FEG 374
             +  S    D + + I   E   + N+    + P+   E   N KD     ++D  F  
Sbjct: 374 IDQHVSKECPDAVRQMIPTQEETSIWNHKAKFSGPAANKEAYDNTKDEGAAAVYDRFFRD 433

Query: 375 TLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAG 431
               V  ESG ++ NK+  L+S++ +   N+   N+YY          GDKE    G
Sbjct: 434 HYYHV-VESGVVVFNKKNKLQSIVNSFMLNL---NFYY-----VGCFYGDKELMWVG 481

>KLTH0G07986g Chr7 complement(646652..648361) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P39106 Saccharomyces
           cerevisiae YER001W MNN1 Alpha-1 3-mannosyltransferase
           integral membrane glycoprotein of the Golgi complex
           required for addition of alpha1 3-mannose linkages to N-
           linked and O-linked oligosaccharides one of five S.
           cerevisiae proteins of the MNN1 family
          Length = 569

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 72/166 (43%), Gaps = 25/166 (15%)

Query: 273 YQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSY-- 330
           Y+ K +A+  ++F   + +DAD   ++ ++D   SE Y   G IF+ D   R+ +  +  
Sbjct: 260 YRNKWLAMIFNTFSTPIFIDADAVSVQPVEDYLQSEAYVESGTIFFRD---RAFAHKFDY 316

Query: 331 -YDILDRDISQNERV-------RNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTE 382
            Y +      Q  R+       R  +D+     +   D  + +   +  F         +
Sbjct: 317 EYCVPLLKALQPSRLETLYFGQRRLIDE----QLMMSDSTSLEQRIVQSFFVGGQRHQMD 372

Query: 383 SGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETF 428
           SG L ++K KHL  L+  ++ N+       P L++     GDKETF
Sbjct: 373 SGLLAVDKSKHLMPLMAGVFLNL------APKLSK--CTHGDKETF 410

>NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON} 
          Length = 657

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 101/252 (40%), Gaps = 25/252 (9%)

Query: 191 DMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDD--ELCNTLLPKY 248
           ++  G GIV+        L   +I T++ +K  LPI++     D   +  E  N  L   
Sbjct: 245 EVSKGKGIVINMKETEKDLFMSLIATLQEVKNTLPIQIITTGQDFEKETFESMNRFLQTT 304

Query: 249 NAKCIFL--SDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFY 306
           + +   +  S  L  D + E I    +  K      ++F+ V++LDAD+ P    +  F 
Sbjct: 305 DQQVSLIDCSSILDADFVKEHIA--SHLHKWFGTLFNTFEEVVILDADSVPFVAPETFFK 362

Query: 307 SEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDI-------TPPSVYTE 359
           ++ Y   G  F+ D    +     Y I   +  +  +  + L +         PP    E
Sbjct: 363 NKEYKDAGSFFFRDKTLGNERTYQYCIEMIEAMEPSKAESGLINTKLKFTSNNPP----E 418

Query: 360 DLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKA 419
           D  +      + F G     + +SG +++ K++ L SLL+    N+         + Q  
Sbjct: 419 DNSSPAASVYNTFFGKYKHKNLDSGVVVLKKKEKLTSLLMGFMMNLDAK------MKQCV 472

Query: 420 SGEGDKETFIAG 431
           SGE  KE F  G
Sbjct: 473 SGE--KELFWLG 482

>YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}
           MNT2Mannosyltransferase involved in adding the 4th and
           5th mannose residues of O-linked glycans
          Length = 558

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 46/233 (19%), Positives = 96/233 (41%), Gaps = 45/233 (19%)

Query: 194 SGDGIVLVAGGKFSLLSTL-VIKTIRNLKINLPIEVFIPPMDEGDDELCNTL-------L 245
           SG   ++++     L  T+ ++K +R +K + PI++ +   D   D + + +        
Sbjct: 172 SGSKGIVISASDVQLNETIRLLKVLRFIKNDYPIQI-VHNADLSQDSMKSIIKYARSLDT 230

Query: 246 PKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIF 305
            +Y A+ ++  +           K   Y  K +A+  SSF+  +L+D+D  P  +I+  +
Sbjct: 231 AEYPAQELWFLNVHSLLNPKYSKKFTTYSNKWLALTFSSFEIPILMDSDTVPFVSIEKFY 290

Query: 306 YSEPYSSRGLIFWPDYWRRSTSPSY-------------YDILDRDISQNERVRNNLDDIT 352
             E +   G++F+ D   R  S                Y  +  D+    ++   ++D  
Sbjct: 291 ELEEFQKTGVLFFKD---RVISDDLFESSELKILREIVYGCIGLDLEDESKIHEQVEDPV 347

Query: 353 PPSV----YTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAM 401
              V    + +  K+H                 ESG ++++K KHL S+L ++
Sbjct: 348 VAQVLENMFIKKYKHH----------------LESGLVILHKGKHLFSMLTSI 384

>AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 648

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 269 KIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSP 328
           KI  +  K +A   +SF+ ++LLD D  P+  ID  F    Y+  G +F+ D     T P
Sbjct: 333 KIKRFMNKWLATIFNSFEEIILLDVDVVPLVPIDSYFKLPGYTKTGALFFKD----RTLP 388

Query: 329 SYYDI 333
            Y  +
Sbjct: 389 EYLPV 393

>TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {ON}
           Anc_7.123 YIL014W
          Length = 641

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 86/207 (41%), Gaps = 8/207 (3%)

Query: 192 MYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGD---DEL-CNTLLPK 247
           M SG GIV+        L    +K   +    LPI++     D  D   +EL       K
Sbjct: 248 MASGSGIVITLNEGSKNLLYKQLKVFDHSDNTLPIQIITTGNDFSDGFIEELKAKVAASK 307

Query: 248 YNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYS 307
            N   +  S  L  +   E   I     K +A+  ++F+  +LLD D  P   +DD    
Sbjct: 308 QNVYLVDCSPILDSEFAKE--HIGDIINKWIAVIFTTFEESILLDVDAVPFVPMDDFLTE 365

Query: 308 EPYSSRGLIFWPDYWRRSTSPSYYDI-LDRDISQNERVRNNLDDITPPSVYTEDLKNHKD 366
           + Y + G++ + D    +     Y I + R++  + + R+ ++        T+D +  ++
Sbjct: 366 KSYKASGILMYKDRSMPNEHTFQYCIDMLREVEPSYQERHLINSRIKYHSGTKDFEQSEE 425

Query: 367 IPMHD-FEGTLPDVSTESGQLMINKEK 392
             ++  F   L     ESG ++INK K
Sbjct: 426 ADVYKRFSHDLLLHHVESGLVVINKPK 452

>KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 60/132 (45%), Gaps = 8/132 (6%)

Query: 194 SGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTL--LPKYNAK 251
           SG G++        +L    ++ ++     LP++V I    E  DE    L  + + + +
Sbjct: 207 SGRGLITTMKSDDIVLYEKQMRILKEFDNKLPLQV-ITTGSEMRDEFVKQLQIIAEIHNQ 265

Query: 252 CIFL---SDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSE 308
            I+L   SD +    +N+  KID ++ K +++  ++F+  + +D D  P     + F  +
Sbjct: 266 EIYLVDLSDIIDRRFVND--KIDRFKHKFLSVLFNTFEEAIFMDVDAVPFVETTEFFEIQ 323

Query: 309 PYSSRGLIFWPD 320
            Y   G+  + D
Sbjct: 324 AYKDTGMYLYRD 335

>KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON} 
          Length = 533

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 61/138 (44%), Gaps = 8/138 (5%)

Query: 188 SSPDMYSGDGIVLV-AGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLP 246
           S  +M  G GIV   +  KFS      +K ++     LPI++ +   +  DD +      
Sbjct: 152 SWSNMAQGRGIVTTFSAKKFSDFFFRQLKVLQYHNNELPIQIIVQDNEFSDDFIAEIAAA 211

Query: 247 KYNAK----CIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNID 302
               K     + +S  L  D  N+   + G+  K++A   ++F+  +LLDAD  P     
Sbjct: 212 GERTKQSLYLVKISKLL--DPANQKY-LSGWINKLLANLFNTFEEFILLDADVVPYAAPH 268

Query: 303 DIFYSEPYSSRGLIFWPD 320
             F ++ Y+S GL  + D
Sbjct: 269 TYFSTKEYTSTGLYMFQD 286

>YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}
           MNT3Alpha-1,3-mannosyltransferase, adds the fourth and
           fifth alpha-1,3-linked mannose residues to O-linked
           glycans during protein O-glycosylation
          Length = 630

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 69/169 (40%), Gaps = 19/169 (11%)

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPS 329
           I  +Q K VA   ++F+  +LLDAD  P    D  F S  Y   G++ + D    +    
Sbjct: 311 ISFFQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDSPSYRESGILLFKDRVMENEQTF 370

Query: 330 YYDIL---DRDISQNER----VRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTE 382
            Y I    + + S  ER     R   D   P S  T +    +    ++F   L     +
Sbjct: 371 QYCIEMLNEVEPSAQERRFIGSRLVFDSSLPFSSETSE----EASVYYNFFKKLRLHHVD 426

Query: 383 SGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAG 431
           SG +++NK + L  LL++   N+ G          +    GDKE F  G
Sbjct: 427 SGLVVVNKLEKLNGLLMSFMLNLDGK--------LQRCVYGDKEIFWLG 467

>Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W
           (REAL)
          Length = 629

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 68/167 (40%), Gaps = 15/167 (8%)

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPS 329
           I  +Q K VA   ++F+  +LLDAD  P    D  F S  Y   G++ + D   R+    
Sbjct: 310 IFSFQNKWVASLFNTFEEYILLDADVVPFVKSDYFFDSPSYKGSGILLFKDRVMRNELTF 369

Query: 330 YYDILDRDISQNERVRNNLDDITPPSVY-----TEDLKNHKDIPMHDFEGTLPDVSTESG 384
            Y I    + +  R  + L  I    V+          + +    ++F   L     +SG
Sbjct: 370 KYCIELLGLVEPSREEHRL--IGSKLVFDSSSLLSSSSSEEASVYYNFFKNLRLHHVDSG 427

Query: 385 QLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAG 431
            +++NK + L  LL++   N+ G          +    GDKE F  G
Sbjct: 428 LVVVNKLEKLNGLLMSFMLNLDG--------KMQRCVYGDKEIFWIG 466

>YER001W Chr5 (153520..155808) [2289 bp, 762 aa] {ON}
           MNN1Alpha-1,3-mannosyltransferase, integral membrane
           glycoprotein of the Golgi complex, required for addition
           of alpha1,3-mannose linkages to N-linked and O-linked
           oligosaccharides, one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 762

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 59/278 (21%), Positives = 103/278 (37%), Gaps = 67/278 (24%)

Query: 194 SGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCI 253
           +G GIVL  G     L+   I ++R     LPI+V +   DE   EL + L+  Y A+  
Sbjct: 316 AGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQV-VYRGDELSQELVDKLI--YAARS- 371

Query: 254 FLSDFLP--------------------EDKINEDIKID--GYQTKVVAIAASSFKNVLLL 291
              DF P                     + I+   + D   Y++K + +  +  +  + L
Sbjct: 372 --PDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFL 429

Query: 292 DADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDI 351
           D D    + ID+ F +  Y   G +F+ +   R              + NER     + +
Sbjct: 430 DIDAISYEKIDNYFKTTEYQKTGTVFYRERALRE-------------NVNERCIARYETL 476

Query: 352 TPPSVYTEDLKNH----KDIPMHDFEGTLP--------------DVSTESGQLMINKEKH 393
            P ++ +++ +N      D  +++ + TL                   E+G   ++K KH
Sbjct: 477 LPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKH 536

Query: 394 LKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAG 431
              L+LA   ++                 GDKE F  G
Sbjct: 537 TIPLVLAAMIHLAK--------NTAHCTHGDKENFWLG 566

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 24/123 (19%)

Query: 459 GVAMFQHDFIQDYTAYENA--KTFIEKKYP--NTKQDKIDKEYSPFDFTDKFFEDEHADP 514
           GVAM  ++       +  A  +  IE+K P  +T ++ I K+Y      D  F+D     
Sbjct: 177 GVAMMMYNTTDSIEGFAKASFELAIERKLPLYSTTKNTILKKY------DGKFKD----- 225

Query: 515 VIDVMFVHAHLPKFEPVALWEENDLMQD---------GSHVRSYTKYDKLNHYDLEMENF 565
           V + M+  ++  KFE + +W E+ L+ D         G ++ +   YD     D+  + F
Sbjct: 226 VFEAMYARSYKEKFESLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGF 285

Query: 566 KAL 568
            +L
Sbjct: 286 GSL 288

>CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 625

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 72/175 (41%), Gaps = 28/175 (16%)

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPD--------- 320
           I+ +  K  A   ++F+  +L+DAD     + D+ F S  +   GL  W D         
Sbjct: 312 IENFHNKWYAAMFNTFEEAILVDADVVSYVHPDEYFESADFKKTGLKLWRDRDIPDIHVH 371

Query: 321 YWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVS 380
            +  + +P +    +   +    ++  L++ +     T +        +H F        
Sbjct: 372 IYCLNMAPYFLPSKEEHRTLGTTLKYRLEEESLKDAGTSEADG-----LHKFFFEKSGSI 426

Query: 381 TESGQLMINKEKHLKSLLLAMYYNM---YGPNWYYPILTQKASGEGDKETFIAGA 432
            +SG ++ NK+K L SL+++ +++    + P  Y           GDKE F+ GA
Sbjct: 427 VDSGLVVFNKKKKLHSLIISEFFHTDAKFKPCTY-----------GDKEIFMLGA 470

>TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON} 
          Length = 736

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 74/176 (42%), Gaps = 27/176 (15%)

Query: 269 KIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIF-----WPDYWR 323
           K   ++ K +A   + F+  L +D D     + +D F  + Y   G +F     WP  W 
Sbjct: 395 KFSRFKNKWLASNFNMFEEFLFIDTDAITYIDPNDYFELQEYKESGTVFFRDRTWPKQWG 454

Query: 324 -RSTSPSYYDILDRDISQNERVRN----NLDDI--TPPSVYTEDLKNHKDIPMHDFE-GT 375
             +   S   +L   I +++   N    ++D I  TP +  + + K +K      FE G 
Sbjct: 455 DEAKCSSLMSLLPPRILESKYFNNYPLFDVDYIKETPSTRLSIEEKIYKRY----FENGR 510

Query: 376 LPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAG 431
           +  +  ESG   INK KH+ S+L     N+            ++ G GDKE F  G
Sbjct: 511 IHQM--ESGVFAINKNKHIISILTGTILNIDH--------VTESCGYGDKEFFWFG 556

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 24/129 (18%)

Query: 459 GVAMFQHDFIQDYTAYENA--KTFIEKKYP--NTKQDKIDKEYSPFDFTDKFFEDEHADP 514
           GVAM  ++       +  A  +  +E+K P  +T ++ I K+Y      D  F+D     
Sbjct: 177 GVAMMMYNTTDSIKGFAKASFELALERKLPLYSTTKNTILKKY------DGKFKD----- 225

Query: 515 VIDVMFVHAHLPKFEPVALWEENDLMQD---------GSHVRSYTKYDKLNHYDLEMENF 565
           V + M+   +  KFE + +W E+ L+ D         G ++ +   YD     D+  + F
Sbjct: 226 VFEAMYAEVYKEKFEALGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGF 285

Query: 566 KALEELLCL 574
            +L  +  L
Sbjct: 286 GSLGLMTSL 294

>TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa]
           {ON} 
          Length = 554

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 71/174 (40%), Gaps = 24/174 (13%)

Query: 273 YQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYD 332
           +  K +A+   SF+  +LLDAD  P   +++ + ++ +   G +F+ D  R  T+     
Sbjct: 260 FSNKWLALLFCSFEKPILLDADTVPFTKLEEYYDTDQFKKYGTVFFKD--RTLTA----H 313

Query: 333 ILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDV-------STESGQ 385
           +L+R   Q   ++   D +   S       ++  I     +  L  +         ESG 
Sbjct: 314 MLNR--GQRRTLKRIFDGLLTSSDRQSSADSYYGIQDPIVQKALERILKKRQKHIMESGL 371

Query: 386 LMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPF 439
           +  +K+KHL  LL ++       N Y+          G+KE F        +PF
Sbjct: 372 VAYDKKKHLFGLLTSLALQFSPLNEYF---------HGEKEWFWISQLIRGVPF 416

>SAKL0H13288g Chr8 complement(1140503..1143157) [2655 bp, 884 aa]
           {ON} weakly similar to uniprot|Q03466 Saccharomyces
           cerevisiae YDR206W
          Length = 884

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 28/48 (58%)

Query: 509 DEHADPVIDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLN 556
           DE+   ++D ++   H P F+   +W ++  +QD +  R+Y ++ K+N
Sbjct: 90  DENFSNLLDFIWREIHYPIFKWFQMWRQHLSLQDKTQQRNYVEFRKMN 137

>NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa]
           {ON} 
          Length = 664

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 80/200 (40%), Gaps = 22/200 (11%)

Query: 256 SDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGL 315
           S  L +D + ++IK   Y  K + +  ++F+ ++  DAD+ P    +    +  Y   G 
Sbjct: 327 SPMLDQDFVEKNIK--SYVNKWIGVLFNTFEELVFFDADSVPFIAPEKFLENSEYKKTGA 384

Query: 316 IFWPDYWRRSTSPSYYDILDRDI---SQNER----VRNNLDDITPPSVYTEDLKNHKDIP 368
            F+ D    +     Y I    +   S+ E+     +   + + PP    E   + +   
Sbjct: 385 YFFRDRSLGNDRTFQYCIDMIQVMEPSKEEKKLIKSKTKFETLNPP----ETKSSSEAAI 440

Query: 369 MHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETF 428
            + F       + +SG +M+NK++ +  LL+  + ++            K    GDKE F
Sbjct: 441 FNSFFQNFQHNNVDSGVVMLNKKQKMGGLLMGFFLHLDAK--------MKKCVSGDKEMF 492

Query: 429 IAGANFFNLPFYQVKKHVGT 448
             G N      Y + K  G+
Sbjct: 493 WLG-NLLAGQDYSIAKSYGS 511

>Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W
           (REAL)
          Length = 625

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 115/298 (38%), Gaps = 29/298 (9%)

Query: 143 RKNDVHKWNVLTQDNLSKCL---QIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIV 199
           +K+DV  W ++T     + +   QID ES     N    +    KE           G V
Sbjct: 188 KKSDVIMWPIVTDLTTGESVPTPQIDMESSKFNGNFWSSWRKLSKE----------RGFV 237

Query: 200 LVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCN-TLLPKYNAKCIFLSDF 258
           L  G K   L    +K +  L+  LP ++     +   + +   + + K   + ++L D 
Sbjct: 238 LTMGEKDVPLFLKQLKVMELLENVLPFQIITTGNELSPESIAKISKVAKEGGQKVYLMDC 297

Query: 259 LPE-DKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIF 317
               D       I  +Q K VA   ++F+  +LLDAD  P    D  F S  Y   G++ 
Sbjct: 298 STVLDAEFSKTFISFFQNKWVATLFNTFEEFILLDADVVPFVKSDYFFDSPSYKRSGILL 357

Query: 318 WPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVY----TEDLKNHKDIPMHDFE 373
           + D  R   +   ++     +S  E        I+   ++    +    + +    ++F 
Sbjct: 358 FKD--RVMQNEHTFEYCVEMLSGVEPSGQEHRLISSKLLFDSSLSFPSSSEEAAVYYNFF 415

Query: 374 GTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAG 431
             L     +SG +++NK + +  LL++   N+ G          +    GDKE F  G
Sbjct: 416 EKLQLHHVDSGLVVVNKREKINGLLMSFMLNLDG--------KMQRCVYGDKEIFWLG 465

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 24/123 (19%)

Query: 459 GVAMFQHDFIQDYTAYENA--KTFIEKKYP--NTKQDKIDKEYSPFDFTDKFFEDEHADP 514
           GVAM  ++  +  T +  A  +  +E+K P  +T ++ I K Y      D  F+D     
Sbjct: 177 GVAMAMYNTTESITGFAKASFELALERKLPLYSTTKNTILKRY------DGKFKD----- 225

Query: 515 VIDVMFVHAHLPKFEPVALWEENDLMQD---------GSHVRSYTKYDKLNHYDLEMENF 565
           + + M+   +  KFE + +W E+ L+ D         G ++ +   YD     D+  + F
Sbjct: 226 IFESMYASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGF 285

Query: 566 KAL 568
            +L
Sbjct: 286 GSL 288

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 24/123 (19%)

Query: 459 GVAMFQHDFIQDYTAYENA--KTFIEKKYP--NTKQDKIDKEYSPFDFTDKFFEDEHADP 514
           GVAM  ++       +  A  +  IE+K P  +T ++ I K+Y      D  F+D     
Sbjct: 177 GVAMMMYNTTNSIEGFAKASFELAIERKLPLYSTTKNTILKKY------DGKFKD----- 225

Query: 515 VIDVMFVHAHLPKFEPVALWEENDLMQD---------GSHVRSYTKYDKLNHYDLEMENF 565
           V + M+   +  KFE + +W E+ L+ D         G ++ +   YD     D+  + F
Sbjct: 226 VFEAMYAENYKEKFESLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGF 285

Query: 566 KAL 568
            +L
Sbjct: 286 GSL 288

>KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} similar
           to uniprot|P39106 Saccharomyces cerevisiae YER001W MNN1
           Alpha-1 3-mannosyltransferase integral membrane
           glycoprotein of the Golgi complex required for addition
           of alpha1 3-mannose linkages to N-linked and O- linked
           oligosaccharides one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 746

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 99/251 (39%), Gaps = 29/251 (11%)

Query: 197 GIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVF-IPPMDEGDDELCN-----TLLPKYNA 250
           GI+L AG         +I T+R     LPI++     ++E   +L +     T      A
Sbjct: 336 GIILAAGDGQVDQCIRLIATLRAQGNALPIQIIHNNQLNEKSVKLLSEAAKSTEFSSGRA 395

Query: 251 KCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPY 310
           + ++L +  P  + +       ++ K +++  ++F+  + +D D     N+ D F  + Y
Sbjct: 396 QSLWLVNVGPTLESSMKSNFGRFKNKWLSVIFNTFEEFIFIDTDAISYINMADYFNFKEY 455

Query: 311 SSRGLIFWPDY-----WRRSTSPSYYDILDRDISQ---NERVRNNLDDITPP--SVYTED 360
            S G +F+ D        +   P +  +  R +     N     N D +      + T +
Sbjct: 456 KSTGTLFFKDRSLAIGTEQKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQCMGMLTPE 515

Query: 361 LKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKAS 420
            K +K       +  L     ESG L INK +H+  L+ A   N+  P            
Sbjct: 516 EKVYKRFFEVGHQHNL-----ESGLLAINKNEHIMGLVTATVLNI-APK-------VGGC 562

Query: 421 GEGDKETFIAG 431
           G GDKE F  G
Sbjct: 563 GWGDKEFFWLG 573

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 24/123 (19%)

Query: 459 GVAMFQHDFIQDYTAYENA--KTFIEKKYP--NTKQDKIDKEYSPFDFTDKFFEDEHADP 514
           GVAM  ++       +  A  +  IE+K P  +T ++ I K+Y      D  F+D     
Sbjct: 177 GVAMMMYNTTDSIEGFAKASFELAIERKLPLYSTTKNTILKKY------DGKFKD----- 225

Query: 515 VIDVMFVHAHLPKFEPVALWEENDLMQD---------GSHVRSYTKYDKLNHYDLEMENF 565
           V + M+  ++  KFE + +W E+ L+ D         G ++ +   YD     D+  + F
Sbjct: 226 VFEGMYAESYKEKFESLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGF 285

Query: 566 KAL 568
            +L
Sbjct: 286 GSL 288

>ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014W MNT3 Alpha-1 3-mannosyltransferase adds the
           fourth and fifth alpha-1 3-linked mannose residues to
           O-linked glycans during protein O-glycosylation
          Length = 641

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPD 320
           ++ +  K +A   ++F+ VLLLD D  P  ++++ F    Y + G+  + D
Sbjct: 316 VEKFVNKWLAALFNTFEEVLLLDVDTVPFVDVEEFFKEPQYRATGMALFKD 366

>Skud_5.100 Chr5 (150236..152524) [2289 bp, 762 aa] {ON} YER001W
           (REAL)
          Length = 762

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 98/263 (37%), Gaps = 43/263 (16%)

Query: 197 GIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLS 256
           GIVL  G     L+   I  +R     LPI++ +   +E   EL + L+  + A+     
Sbjct: 321 GIVLSLGSNQFPLAVKFIAALRFQGNTLPIQI-VYRGNELSQELVDKLI--FAARS---P 374

Query: 257 DFLP-EDKINEDIKI---------------------DGYQTKVVAIAASSFKNVLLLDAD 294
           DF P E+K +    +                     D Y++K + +  + FK  + LD D
Sbjct: 375 DFKPVENKYDNSTNVPQEIWFLDVSNTIHPKWQNDFDSYKSKWLVVLFNLFKEFVFLDID 434

Query: 295 NYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTS-----PSYYDILDRDI-SQNERVRNNL 348
               + ID  F +  Y   G +F+ +   +          Y  +L R + S+N +    +
Sbjct: 435 AISYQEIDKYFETAEYQKTGTVFYRERALKENVHERCIARYETLLPRKLESKNFKSSLLI 494

Query: 349 DDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGP 408
           D     S    DLK  + I    F         E+G   I+K +H   L+LA   ++   
Sbjct: 495 DADRVLSGCDNDLKPEEHI-FKAFFHHRRQHQLEAGLFAIDKSEHTIPLILASMIHLAKH 553

Query: 409 NWYYPILTQKASGEGDKETFIAG 431
                         GDKE F  G
Sbjct: 554 T--------SHCTHGDKENFWLG 568

>TPHA0F00700 Chr6 (158182..160752) [2571 bp, 856 aa] {ON} 
          Length = 856

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 72/185 (38%), Gaps = 16/185 (8%)

Query: 273 YQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYW----RRSTSP 328
           ++ K +A   +  K +L LD D    K+ +  F ++ Y + G +F+ D +    ++    
Sbjct: 438 FKNKWLASTLNPCKEILFLDTDTINYKDPNFYFETKGYKNSGTLFFRDRYLKVDKKEICS 497

Query: 329 SYYDILDRDISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLP-DVS--TESGQ 385
           S++D L     Q     + L       +     KN      H F+     D+    ESG 
Sbjct: 498 SFHDTLSPSF-QESFYFDKLPLFDKQYIVDNVAKNELTTEEHIFKSYFHLDIQHEMESGL 556

Query: 386 LMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKH 445
           + I+K  H+  + ++  +N++ P              GDKE F  G      PF      
Sbjct: 557 MAIDKATHIIPMQMSANFNLFKP--------FSKCSHGDKEFFWLGFMASGTPFSIDPIK 608

Query: 446 VGTDG 450
            GT G
Sbjct: 609 PGTVG 613

>TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {ON} 
          Length = 751

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 56/274 (20%), Positives = 98/274 (35%), Gaps = 64/274 (23%)

Query: 197 GIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKC---- 252
           G++L  G K    +  +I  +R  +  LPI++ I   D   + +   L    + +     
Sbjct: 323 GVILSFGDKHLKWALKLIMALRYRQNTLPIQIIITKNDLSKNSMEKILFAAQSDEVQIKD 382

Query: 253 ----IFLSDFLPEDKINEDI----------KIDGYQTKVVAIAASSFKNVLLLDADNYPI 298
               +    F  ++ I  D+             G+++K +A   + F+  + LDAD    
Sbjct: 383 KKGNVMKDVFTKQEIIFVDVTNIIDPEFFDNFTGWKSKWLASIFNLFEEYIFLDADAISY 442

Query: 299 KNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYT 358
            +++  F ++ Y+  G IF+ D       P   + L             L+ + P    +
Sbjct: 443 VDLNHYFNTKEYNETGTIFFRDRMLEHYLPRTCNAL-------------LESVHPMLPES 489

Query: 359 EDLKNHKDIPMHDFEGTLPDV---------------------STESGQLMINKEKHLKSL 397
           +   NHK I   D E  L +                        ESG   I+K  H+  L
Sbjct: 490 KYFDNHKYI---DEEHVLNECEQYLDPNEKIYKQFFADNLLHQMESGLYAIDKTSHIIPL 546

Query: 398 LLAMYYNMYGPNWYYPILTQKASGEGDKETFIAG 431
           ++ M  +M         L  +    GDKE F  G
Sbjct: 547 IMGMTLHM---------LPIEKCSYGDKEFFWLG 571

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 24/123 (19%)

Query: 459 GVAMFQHDFIQDYTAYENA--KTFIEKKYP--NTKQDKIDKEYSPFDFTDKFFEDEHADP 514
           GVAM  ++  +  T +  +  +  +E+K P  +T ++ I K+Y      D  F+D     
Sbjct: 179 GVAMSMYNTAESITGFAKSSFELALERKMPLYSTTKNTILKKY------DGQFKD----- 227

Query: 515 VIDVMFVHAHLPKFEPVALWEENDLMQD---------GSHVRSYTKYDKLNHYDLEMENF 565
           + + M+   +  KFE V +W E+ L+ D         G  + +   YD     D+  + F
Sbjct: 228 IFEGMYEREYKQKFEAVGIWYEHRLIDDMVAQMLKSKGGFIIAMKNYDGDVQSDIVAQGF 287

Query: 566 KAL 568
            +L
Sbjct: 288 GSL 290

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 58/131 (44%), Gaps = 27/131 (20%)

Query: 451 YTRPGGYRGVAMFQHDFIQDYTAYENA--KTFIEKKYP--NTKQDKIDKEYSPFDFTDKF 506
           Y R GG   VAM  ++  +    +  A  +  +E+K P  +T ++ I K+Y      D  
Sbjct: 175 YPRDGG---VAMVMYNTKESIEGFAKASFQLAVERKMPLYSTTKNTILKKY------DGM 225

Query: 507 FEDEHADPVIDVMFVHAHLPKFEPVALWEENDLMQD---------GSHVRSYTKYDKLNH 557
           F+D     + + M+   +  KFE + +W E+ L+ D         G ++ +   YD    
Sbjct: 226 FKD-----IFEGMYEREYKEKFEELGIWYEHRLIDDMVAQMLKSSGGYIIAMKNYDGDVQ 280

Query: 558 YDLEMENFKAL 568
            D+  + F +L
Sbjct: 281 SDIVAQGFGSL 291

>Suva_5.87 Chr5 (129322..131622) [2301 bp, 766 aa] {ON} YER001W
           (REAL)
          Length = 766

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 108/286 (37%), Gaps = 51/286 (17%)

Query: 197 GIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLS 256
           GIVL  G     L+   I ++R     LPI++ I   DE   E+   L+  Y A+     
Sbjct: 324 GIVLSLGSNQFSLAVKFIASLRFQGNTLPIQI-IYRGDELPQEMVEKLM--YAARS---P 377

Query: 257 DFLP--------------------EDKINEDIKID--GYQTKVVAIAASSFKNVLLLDAD 294
           +F P                     + ++ D K D   Y++K + +  + F+  + LD D
Sbjct: 378 EFKPIENSYDNSTNVPQELWFLDVSNTVHPDWKGDFGSYKSKWLVVLFNLFQEFVFLDID 437

Query: 295 NYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPS--------YYDILDRDISQNERVRN 346
               + ID  F S  Y   G +F   Y  RS + +        Y  +L R + ++E  +N
Sbjct: 438 AISYQEIDKYFESPEYQKTGTVF---YRERSLNENVHERCIARYETLLPRKL-ESENFQN 493

Query: 347 NLDDITPPSVYTE--DLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYN 404
           +L    P +V  E   L   ++     F         E+G   ++  +H   L+LA   +
Sbjct: 494 SL-MFNPENVLNECDKLLTTEEYIFKAFFRHRRQHQLEAGLFAVDTAQHTIPLVLASMIH 552

Query: 405 MYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDG 450
           +     +           GDKE F  G      P+   K + G  G
Sbjct: 553 LAKHTSH--------CTHGDKENFWLGFLASGHPYALQKVYSGAIG 590

>TBLA0A01160 Chr1 complement(267341..269332) [1992 bp, 663 aa] {ON} 
          Length = 663

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%)

Query: 270 IDGYQTKVVAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPS 329
           I  +  K VA+  ++FK  + LD D  P   +D  F +E +   G++ + D   R+    
Sbjct: 347 IVNFLNKWVAMLFNTFKEAIFLDVDAIPFIGMDYFFENEGFEETGILMYKDRVMRTEHTF 406

Query: 330 YYDI 333
            Y I
Sbjct: 407 QYCI 410

>KLLA0F21758g Chr6 complement(2023805..2028523) [4719 bp, 1572 aa]
            {ON} similar to uniprot|Q05471 Saccharomyces cerevisiae
            YDR334W SWR1 Swi2/Snf2-related ATPase
          Length = 1572

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 8/87 (9%)

Query: 500  FDFT--DKFFEDEHADPVIDVMFVHAHLPKFEPVALWEENDL------MQDGSHVRSYTK 551
            F FT  DK     H++ + ++  V   L +   +    END        QD +   SY K
Sbjct: 1114 FQFTSNDKTLSTNHSEKISELQCVQPILKEISRLKQLNENDSPVTQPDFQDLNQYYSYAK 1173

Query: 552  YDKLNHYDLEMENFKALEELLCLEKPF 578
            ++K+N    ++E+   +  L C  +P 
Sbjct: 1174 HNKINEIIGQLEHLNYMNNLRCNRRPM 1200

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,048,391
Number of extensions: 3559266
Number of successful extensions: 10541
Number of sequences better than 10.0: 147
Number of HSP's gapped: 10493
Number of HSP's successfully gapped: 154
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)