Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.693.189ON26226212131e-170
TPHA0H006303.189ON1911293991e-47
KAFR0A012303.189ON2202623872e-45
TDEL0D043203.189ON2432733735e-43
ZYRO0A04928g3.189ON2512703657e-42
TBLA0F007503.189ON2341843516e-40
Suva_4.2383.189ON2332583517e-40
SAKL0C10494g3.189ON2302583463e-39
Kwal_56.231143.189ON2102673444e-39
YDL010W (GRX6)3.189ON2312573402e-38
Skud_4.2423.189ON2322573393e-38
KLTH0G16060g3.189ON2132563375e-38
Smik_4.2233.189ON2322593263e-36
Suva_2.1413.189ON2041283219e-36
NDAI0G018003.189ON2222723151e-34
YBR014C (GRX7)3.189ON2032553078e-34
Smik_2.1333.189ON2041253034e-33
Skud_2.1263.189ON2041173018e-33
KNAG0J012603.189ON1941102851e-30
AER017C3.189ON2161212852e-30
Ecym_53133.189ON2481242848e-30
NCAS0E016003.189ON2292502821e-29
KLLA0E17733g3.189ON2112522642e-27
CAGL0I04554g3.189ON226962628e-27
NCAS0C013408.679ON3571301872e-15
KAFR0A038708.679ON2671261772e-14
SAKL0H06468g8.679ON2581381753e-14
Skud_4.7881.38ON145871581e-12
KLLA0D05973g8.679ON2811351622e-12
Smik_4.7941.38ON143891544e-12
YDR513W (GRX2)1.38ON143871544e-12
KNAG0C004501.38ON157841555e-12
Suva_2.6931.38ON143871535e-12
Kwal_33.131661.38ON138821501e-11
KLLA0C01298g1.38ON107841453e-11
CAGL0K05813g1.38ON142901483e-11
CAGL0M02167g8.679ON2331381523e-11
Ecym_23948.679ON2811501509e-11
NDAI0E011508.679ON2361391471e-10
NCAS0B016408.679ON2401311472e-10
TBLA0A050801.38ON118881402e-10
YPL156C (PRM4)8.679ON2842751472e-10
KLTH0F01276g1.38ON138881394e-10
TPHA0G015908.679ON2971321455e-10
ZYRO0F17732g1.38ON139791395e-10
TDEL0C066401.38ON143881386e-10
Kpol_2000.991.38ON141871387e-10
Kpol_2002.361.38ON109871357e-10
ACR146W8.679ON2131401411e-09
AFR710W1.38ON111911341e-09
NCAS0B088701.38ON109821341e-09
Kpol_1072.148.679ON2501311402e-09
TPHA0B03560singletonON106831332e-09
Ecym_10441.38ON158851343e-09
TDEL0E05740singletonON108871313e-09
KNAG0G025808.679ON2781301384e-09
KNAG0F002501.38ON142841315e-09
NDAI0F044301.38ON136891316e-09
NDAI0A003801.38ON109821287e-09
SAKL0C01320g1.38ON165901327e-09
Suva_3.1781.38ON316821367e-09
Smik_6.3538.679ON2861321322e-08
Smik_3.421.38ON110731243e-08
Skud_16.1268.679ON2871321313e-08
KLTH0D11308g8.679ON2711301295e-08
TPHA0B048201.38ON138931246e-08
TPHA0E037301.38ON106831218e-08
NDAI0K013508.679ON2711311261e-07
Suva_16.1548.679ON2831321261e-07
YCL035C (GRX1)1.38ON110731192e-07
Kwal_26.88148.679ON2751291252e-07
KAFR0D003601.38ON109821173e-07
Skud_3.271.38ON110731164e-07
TBLA0B038208.679ON251991074e-05
NCAS0A003601.38ON13882972e-04
SAKL0H04136g4.211ON11087750.15
NDAI0E028908.519ON15594720.59
Ecym_11878.519ON13993701.1
NCAS0B022908.519ON13946691.2
NDAI0C053908.519ON14446691.2
KNAG0A020908.519ON14946672.4
Suva_8.542.513ON43656692.6
Kpol_513.118.519ON14746663.2
NCAS0C022408.519ON16194663.3
CAGL0M07271g8.519ON14946663.3
Smik_12.1055.124ON10387643.6
Skud_12.1095.124ON10387644.2
ADR053W8.519ON13896644.9
KLLA0B09636g8.519ON14246655.0
Suva_16.2558.519ON14946655.1
TBLA0H035008.519ON14994645.4
Smik_16.1788.519ON14946646.4
Skud_16.2248.519ON14946646.6
YPL059W (GRX5)8.519ON15046646.6
Suva_2.3478.381ON149148667.9
KLTH0E12034g8.519ON13646628.9
YLR043C (TRX1)5.124ON10385619.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.69
         (262 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {...   471   e-170
TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.18...   158   1e-47
KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.18...   153   2e-45
TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON...   148   5e-43
ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {O...   145   7e-42
TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.18...   139   6e-40
Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W (...   139   7e-40
SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar...   137   3e-39
Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {O...   137   4e-39
YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-gol...   135   2e-38
Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W (...   135   3e-38
KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} simil...   134   5e-38
Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W (...   130   3e-36
Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}...   128   9e-36
NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON...   125   1e-34
YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}  G...   122   8e-34
Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}...   121   4e-33
Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}...   120   8e-33
KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {O...   114   1e-30
AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON} Sy...   114   2e-30
Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON} ...   114   8e-30
NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON...   113   1e-29
KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa] ...   106   2e-27
CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some si...   105   8e-27
NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {O...    77   2e-15
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    73   2e-14
SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {O...    72   3e-14
Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W...    65   1e-12
KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some si...    67   2e-12
Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W...    64   4e-12
YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}  GRX2Cytop...    64   4e-12
KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON} ...    64   5e-12
Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W...    64   5e-12
Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {O...    62   1e-11
KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {O...    60   3e-11
CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly...    62   3e-11
CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {...    63   3e-11
Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON} ...    62   9e-11
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    61   1e-10
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      61   2e-10
TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {...    59   2e-10
YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}  ...    61   2e-10
KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {O...    58   4e-10
TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON...    60   5e-10
ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} simil...    58   5e-10
TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1....    58   6e-10
Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON} (21954...    58   7e-10
Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON...    57   7e-10
ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic hom...    59   1e-09
AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic h...    56   1e-09
NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1....    56   1e-09
Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON...    59   2e-09
TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON}      56   2e-09
Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON} si...    56   3e-09
TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {...    55   3e-09
KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.67...    58   4e-09
KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON} ...    55   5e-09
NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {...    55   6e-09
NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON} ...    54   7e-09
SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {O...    55   7e-09
Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}...    57   7e-09
Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C (...    55   2e-08
Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON} YC...    52   3e-08
Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {O...    55   3e-08
KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some si...    54   5e-08
TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1....    52   6e-08
TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38...    51   8e-08
NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {O...    53   1e-07
Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {O...    53   1e-07
YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}  GRX...    50   2e-07
Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C ...    53   2e-07
KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON} ...    50   3e-07
Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON} YC...    49   4e-07
TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON...    46   4e-05
NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON} ...    42   2e-04
SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {O...    33   0.15 
NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519      32   0.59 
Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to...    32   1.1  
NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519      31   1.2  
NDAI0C05390 Chr3 complement(1246280..1246714) [435 bp, 144 aa] {...    31   1.2  
KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.51...    30   2.4  
Suva_8.54 Chr8 (102513..103823) [1311 bp, 436 aa] {ON} YHR001W (...    31   2.6  
Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON} ...    30   3.2  
NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519      30   3.3  
CAGL0M07271g Chr13 (731627..732076) [450 bp, 149 aa] {ON} simila...    30   3.3  
Smik_12.105 Chr12 complement(212747..213058) [312 bp, 103 aa] {O...    29   3.6  
Skud_12.109 Chr12 complement(216544..216855) [312 bp, 103 aa] {O...    29   4.2  
ADR053W Chr4 (804734..805150) [417 bp, 138 aa] {ON} Syntenic hom...    29   4.9  
KLLA0B09636g Chr2 (836265..836693) [429 bp, 142 aa] {ON} similar...    30   5.0  
Suva_16.255 Chr16 (447649..448098) [450 bp, 149 aa] {ON} YPL059W...    30   5.1  
TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON...    29   5.4  
Smik_16.178 Chr16 (319960..320409) [450 bp, 149 aa] {ON} YPL059W...    29   6.4  
Skud_16.224 Chr16 (408961..409410) [450 bp, 149 aa] {ON} YPL059W...    29   6.6  
YPL059W Chr16 (444579..445031) [453 bp, 150 aa] {ON}  GRX5Hydrop...    29   6.6  
Suva_2.347 Chr2 (612620..617095) [4476 bp, 1491 aa] {ON} YDR180W...    30   7.9  
KLTH0E12034g Chr5 complement(1069449..1069859) [411 bp, 136 aa] ...    28   8.9  
YLR043C Chr12 complement(231702..232013) [312 bp, 103 aa] {ON}  ...    28   9.3  

>Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {ON}
           complement(161503..162291) [789 nt, 263 aa]
          Length = 262

 Score =  471 bits (1213), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 233/262 (88%), Positives = 233/262 (88%)

Query: 1   MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVR 60
           MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVR
Sbjct: 1   MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVR 60

Query: 61  VGGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXX 120
           VGGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPF                       
Sbjct: 61  VGGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFNDNNNNNIANKKLTTDNNKNNVV 120

Query: 121 XXXXXXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEES 180
                 QNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEES
Sbjct: 121 NEKSTVQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEES 180

Query: 181 YSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLI 240
           YSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLI
Sbjct: 181 YSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLI 240

Query: 241 ETIQEMSDYSVVVKAIEKPSNS 262
           ETIQEMSDYSVVVKAIEKPSNS
Sbjct: 241 ETIQEMSDYSVVVKAIEKPSNS 262

>TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.189
           YDL010W
          Length = 191

 Score =  158 bits (399), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%)

Query: 127 QNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPE 186
           +NN A R + GGS   KFDPAQEY  I E++P++L++KTFCPYCKRL KLL ++Y F P+
Sbjct: 53  RNNEAPRPIVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPD 112

Query: 187 FHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEM 246
              ++LDKH +GDEL  ++ +QT H TVPN ++NGKSLGG+D I KL +   + +TIQ+ 
Sbjct: 113 IKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKD 172

Query: 247 SDYSVVVKA 255
           SD+SV+V +
Sbjct: 173 SDFSVIVSS 181

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (89%)

Query: 6  NKRNIRILSITGVLLFVIFLISQNNNGML 34
          NKRN+RILSITG+LLFV+FL  QN+N +L
Sbjct: 5  NKRNVRILSITGLLLFVVFLFVQNDNWLL 33

>KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.189
           YDL010W
          Length = 220

 Score =  153 bits (387), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/262 (33%), Positives = 137/262 (52%), Gaps = 42/262 (16%)

Query: 1   MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVR 60
           MA+  NKRNIRI+S+T +LL ++F + ++ N +    S   S+    T + G   S+   
Sbjct: 1   MAVILNKRNIRIVSVTSILLLLVFFVIRDANSITLSQSISNSETVAKTDLDGASASN--- 57

Query: 61  VGGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXX 120
                        K    + +   EID+IK+E+G+                         
Sbjct: 58  -------------KKKTDNSEATEEIDRIKQEIGI------------------------T 80

Query: 121 XXXXXXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEES 180
                   NA ++  +  +  V F+ A+EYA I ELSP+++++K+FCP+  +L +L    
Sbjct: 81  DDSPVPATNANEQNEENTA--VTFNAAKEYASILELSPMVVFSKSFCPFSAKLKELFANE 138

Query: 181 YSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLI 240
           Y F P F+ V+LDKH HGD LQ ++ ++TG  TVPN VING S GG DD+  LH  GKL+
Sbjct: 139 YQFTPNFYIVELDKHQHGDLLQAYIKEKTGRGTVPNVVINGVSRGGSDDLRALHADGKLL 198

Query: 241 ETIQEMSDYSVVVKAIEKPSNS 262
           ++++     +  VK IEKPSN+
Sbjct: 199 DSLKTWGSGNFQVKQIEKPSNN 220

>TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON}
           Anc_3.189 YDL010W
          Length = 243

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 97/273 (35%), Positives = 150/273 (54%), Gaps = 43/273 (15%)

Query: 1   MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVR 60
           M++   KRN+R+LS+T +LL ++F + QN N +      L +  F +    G+  +    
Sbjct: 1   MSVSLKKRNLRVLSVTALLLLLVFFVVQNANSISFGEEELKAATFVNPVASGLTSA---- 56

Query: 61  VGGKVRYSSDDLV--KGTAKDDK------VNAEIDKIKEEVGLPFXXXXXXXXXXXXXXX 112
             G   +++D++V  K + K  K      V+AEIDKIK+EV                   
Sbjct: 57  --GTAVHNNDEIVVDKESGKKGKDQESALVDAEIDKIKQEV------------------- 95

Query: 113 XXXXXXXXXXXXXXQNNAAQRAVQGGSEPV----KFDPAQEYAIISELSPIILYTKTFCP 168
                          N+ +Q+A  G  +      +FDPA+EY++I  +SP+I+++K+FCP
Sbjct: 96  ------NSGSGASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIVFSKSFCP 149

Query: 169 YCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYD 228
           Y  RL +LL + Y+  P +  ++LDKH HG  LQ+F+ K+TG  TVPN +INGKS GG+D
Sbjct: 150 YSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMINGKSRGGFD 209

Query: 229 DILKLHEAGKLIETIQEMSDYSVVVKAIEKPSN 261
           DI  LH  G+L+E++ +  D    VK +EKPSN
Sbjct: 210 DIKALHSKGELLESLNKWGDGDFTVKQLEKPSN 242

>ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {ON}
           weakly similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 251

 Score =  145 bits (365), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 146/270 (54%), Gaps = 29/270 (10%)

Query: 1   MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVR 60
           M +  NKRN+R+LSIT +LL ++F + QN N +    S  +++A  +       D     
Sbjct: 1   MGVTLNKRNLRVLSITSLLLLLVFFVVQNANSVSIGESSSLANANSNE------DQTLTS 54

Query: 61  VGGKVRYSSDDLV---KGTAK------DDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXX 111
            G  +   S + V   K  AK      D  V+AEI KIK+EVG+                
Sbjct: 55  AGTSINKESKEEVVTEKQKAKEKQPEGDSVVDAEIGKIKQEVGI---------GKTDDLE 105

Query: 112 XXXXXXXXXXXXXXXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCK 171
                            +A++ A Q      +FDP +EYA+I + SPII+++K+ CPY K
Sbjct: 106 TGSSGSISGGGVVGKGGSASEHAQQ-----TEFDPVKEYAMILDFSPIIVFSKSTCPYSK 160

Query: 172 RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDIL 231
           +L +LL++ YSF P +  ++LD+H +G ELQ++V ++TG +TVPN +INGKS GG D+  
Sbjct: 161 KLKELLDKEYSFTPSYFVIELDRHHNGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFR 220

Query: 232 KLHEAGKLIETIQEMSDYSVVVKAIEKPSN 261
            LH  GKL+ + ++ S  +  V  +++PSN
Sbjct: 221 SLHNEGKLLSSFKDWSQGTFTVLQLDRPSN 250

>TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.189
           YDL010W
          Length = 234

 Score =  139 bits (351), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 106/184 (57%), Gaps = 18/184 (9%)

Query: 79  DDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNNAAQRAVQGG 138
           D  V+A+ DKIK+EVGL                                  A    +   
Sbjct: 69  DAGVDAQFDKIKQEVGLDTGKTTQGGLPSSIGT------------------ATDNKISNN 110

Query: 139 SEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHG 198
            E   FD A+EYA+I +LSP+I+++K++CP+   L +LL + +SF P ++ ++LD+H+HG
Sbjct: 111 DENGTFDAAKEYAMILDLSPVIIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHG 170

Query: 199 DELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVKAIEK 258
            ELQ ++ K+T  +TVPN ++NG S GG D+I+ L++ GKL+E + + SD +  VK  EK
Sbjct: 171 AELQAYIAKKTDRSTVPNMIVNGISRGGRDEIVALNDEGKLLEALNDWSDNTFTVKQAEK 230

Query: 259 PSNS 262
           PSN+
Sbjct: 231 PSNN 234

>Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W
           (REAL)
          Length = 233

 Score =  139 bits (351), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 138/258 (53%), Gaps = 32/258 (12%)

Query: 6   NKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVRVGGKV 65
           NKRN RILSIT +LL ++F I+QN N +  +         E      ++D D   + G+ 
Sbjct: 5   NKRNARILSITMLLLLLVFFIAQNANFLAIETK-------EEEKPPQLLDIDKNSISGRS 57

Query: 66  --RYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXXXXX 123
             R +S         + +V+ EI++IK++VGL                            
Sbjct: 58  SRRIASVPTSTTNKGNSEVDEEINEIKQKVGL-----------------------QQPIA 94

Query: 124 XXXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSF 183
               + +A ++ +G      F+  QEY+++ +L+P+I+++K+ C Y K L +LLE  Y F
Sbjct: 95  SADDSLSAIKSDKGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQF 154

Query: 184 QPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETI 243
            P ++ ++LDKH HG+EL++++   TG  TVPN +ING S GG ++I +LH  GKL+ ++
Sbjct: 155 VPNYYIIELDKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSL 214

Query: 244 QEMSDYSVVVKAIEKPSN 261
           QE S     V+  EKPSN
Sbjct: 215 QEWSGGKFTVEQREKPSN 232

>SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar to
           Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 230

 Score =  137 bits (346), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 133/258 (51%), Gaps = 33/258 (12%)

Query: 7   KRNIRILSITGVLLFVIFLISQNNN--GMLTDPSGLISDAFESTSVKGMIDSDNVRVGGK 64
           KRN+R+L+ITG L+F+IF I QN N   +    SG  +    S+    +I SD       
Sbjct: 4   KRNLRVLTITGFLVFLIFFIVQNANTVAVANKNSGRANGVPPSSK---LIHSDGDEQEVA 60

Query: 65  VRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXXXXXX 124
           V+   +       +D  VNAEI +I++E+                               
Sbjct: 61  VQKQQEK------EDSAVNAEIAQIQQEIA----------------------GNQGGGGS 92

Query: 125 XXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQ 184
                  + +    S  V+F+ A+EYA I E SP+++++K++CP+  +L  LL + Y F 
Sbjct: 93  NSGRTGNKVSAAKDSSSVEFNAAKEYASILEESPMVVFSKSYCPFSTKLKDLLAQEYQFT 152

Query: 185 PEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQ 244
           P +  ++LDKH HG ELQ+++   TG +TVPN VIN  S GG DD+  LH+ GKL+++++
Sbjct: 153 PSYVVLELDKHEHGAELQKYIGDVTGRSTVPNVVINRVSRGGSDDLRALHKDGKLLDSLK 212

Query: 245 EMSDYSVVVKAIEKPSNS 262
           E     + V   +KPSN+
Sbjct: 213 EWGGKQLTVSKNQKPSNN 230

>Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {ON}
           YBR014C - Hypothetical ORF [contig 183] FULL
          Length = 210

 Score =  137 bits (344), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 89/267 (33%), Positives = 129/267 (48%), Gaps = 69/267 (25%)

Query: 6   NKRNIRILSITGVLLFVIFLISQN-------NNGMLTDPSGLISDAFESTSVKGMIDSDN 58
           +KRN+R+ S T VL+F+I+ I QN          +   P  LI D               
Sbjct: 3   SKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGDG-------------- 48

Query: 59  VRVGGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXX 118
             V  K + +       T  D+ V+  I  I+EEVG+                       
Sbjct: 49  --VVAKAKET-------TKIDEDVDQAIRNIQEEVGI----------------------- 76

Query: 119 XXXXXXXXQNNAAQRAVQGGSEPVK--FDPAQEYAIISELSPIILYTKTFCPYCKRLAKL 176
                        +    G SEP +  FDPA EY  I   SP+I+++K+ CPY  ++ +L
Sbjct: 77  -------------KEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSKSMCPYSAKMKEL 123

Query: 177 LEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEA 236
           L++ Y F P++  V+LD+H HG ELQ ++ K T   TVPN VI+G S GGYDD   L + 
Sbjct: 124 LKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSRGGYDDFKALLDK 183

Query: 237 GKLIETIQEMSD-YSVVVKAIEKPSNS 262
           GKL+E++Q+ SD  ++ V   EKPSN+
Sbjct: 184 GKLLESLQDWSDGKTLSVSKKEKPSNN 210

>YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-golgi
           localized monothiol glutaredoxin that binds an
           iron-sulfur cluster; more similar in activity to dithiol
           than other monothiol glutaredoxins; involved in the
           oxidative stress response; functional overlap with GRX7
          Length = 231

 Score =  135 bits (340), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 89/257 (34%), Positives = 138/257 (53%), Gaps = 30/257 (11%)

Query: 6   NKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVRVGGKV 65
           NKRN RILSIT +LL ++F ++QN N +  +     S AF +       + DN+  G   
Sbjct: 5   NKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFST-------NMDNMAGGSSR 57

Query: 66  RYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 125
            Y++           +V+ EI++IK++VGL                              
Sbjct: 58  EYAAMPTSTTNKGSSEVDEEINEIKQKVGL-----------------QQPIASVDDSLSA 100

Query: 126 XQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQP 185
            +N+   R  +       F+  +EY++I +LSPII+++K+ C Y K + +LLE  Y F P
Sbjct: 101 IKNDKGSRITKA------FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIP 154

Query: 186 EFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
            ++ ++LDKH HG+ELQ+++   TG  TVPN ++NG S GG ++I KLH  GKL+E++Q 
Sbjct: 155 NYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQV 214

Query: 246 MSDYSVVVKAIEKPSNS 262
            SD    V+  EKPSN+
Sbjct: 215 WSDGKFSVEQREKPSNN 231

>Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  135 bits (339), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 138/257 (53%), Gaps = 29/257 (11%)

Query: 6   NKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVRVGGKV 65
           NKRN RILSIT +LL ++F I QN N +  +        F+  S     + D++ VG   
Sbjct: 5   NKRNARILSITMLLLLLVFFIVQNANFLTIETKE--EKPFQVFST----NMDSLSVGSSK 58

Query: 66  RYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 125
           + +++          +V+ EI++IK++VGL                              
Sbjct: 59  KLATEPTSAIKKGSSEVDEEINEIKQKVGL-----------------------QQPIASA 95

Query: 126 XQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQP 185
             + +A ++ +G      F+  +EY+++ +LSP+I+++K+ CPY + + +LLE  Y F P
Sbjct: 96  DDSLSALKSDKGSGTGKGFNVQKEYSLMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLP 155

Query: 186 EFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
            ++ ++LDKH HG+ELQ+++   TG   VPN +ING S GG ++I  LH  GKL+ ++Q 
Sbjct: 156 NYYIIELDKHGHGEELQEYIRLMTGRGAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQA 215

Query: 246 MSDYSVVVKAIEKPSNS 262
            S+    V+  EKPSN+
Sbjct: 216 WSNGKFSVEQREKPSNN 232

>KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} similar
           to Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 213

 Score =  134 bits (337), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 127/256 (49%), Gaps = 46/256 (17%)

Query: 6   NKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVRVGGKV 65
           +KRN+R+   TGVLL +I+ I QN +  +T  +  +S    S +V  +    N +  G+V
Sbjct: 3   SKRNLRVFVFTGVLLVLIYFIIQNAHTTVTSGNSSLSGQTASGAV--IHSKGNHKSSGEV 60

Query: 66  RYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 125
                        D  V+ EI +IK EVG+                              
Sbjct: 61  -------------DPSVDKEIQEIKNEVGI------------------------------ 77

Query: 126 XQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQP 185
             ++ A        E  +FDPA+EY  I    P+I+++K+ CP+ K+L  LL + + F P
Sbjct: 78  KGDDGASSGTDFTQEK-EFDPAKEYQYILANRPMIVFSKSRCPFSKKLKDLLAKEFEFSP 136

Query: 186 EFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
            +  V+LDKH HG ELQ+ +   TG +TVPN +ING S GG DD  KL E G+L+ +++ 
Sbjct: 137 SYMVVELDKHEHGAELQKHIGSLTGRSTVPNVIINGVSRGGCDDFEKLQEKGELLSSLKT 196

Query: 246 MSDYSVVVKAIEKPSN 261
             D ++ V   EKPSN
Sbjct: 197 WCDKALTVSKKEKPSN 212

>Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  130 bits (326), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 141/259 (54%), Gaps = 35/259 (13%)

Query: 6   NKRNIRILSITGVLLFVIFLISQNNNGM-LTDPSGLISDAFESTSVKGMIDSDNVRVGGK 64
           NKRN RILSIT +LL ++F ++QN N + L       S+ F+S       + +N+     
Sbjct: 5   NKRNARILSITMLLLLLVFFVAQNANFLTLETKERESSELFDS-------EMNNLAAEST 57

Query: 65  VRYSSDDLVKGTAKDDKVNAEIDKIKEEVGL--PFXXXXXXXXXXXXXXXXXXXXXXXXX 122
            +Y +           +V+ EI++IK++VGL  P                          
Sbjct: 58  RKYVAVPTSATNKGSSEVDEEINEIKQKVGLQRPILSDDDSL------------------ 99

Query: 123 XXXXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYS 182
                 +A +   Q G+  + F+  +EY+++ +LSP+I+++K+ C Y K + +LLE  Y 
Sbjct: 100 ------SAIKSDKQSGTGKL-FNVQKEYSLMLDLSPVIIFSKSSCSYSKGMKELLENEYQ 152

Query: 183 FQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIET 242
           F P ++ ++LDKH HG+ELQ+++  +TG  TVPN ++NG S GG ++I KLH  GKL+E+
Sbjct: 153 FVPNYYIIELDKHGHGEELQEYIKLKTGRGTVPNLLVNGISRGGNEEIRKLHSQGKLLES 212

Query: 243 IQEMSDYSVVVKAIEKPSN 261
           +Q  SD    V+  EKPSN
Sbjct: 213 LQSWSDGKFSVEQHEKPSN 231

>Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  128 bits (321), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 88/128 (68%), Gaps = 1/128 (0%)

Query: 135 VQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDK 194
           V   S+ VKFD A EY  I + S +++++K++CP+ K+L  LL ESY F P +H V+LD+
Sbjct: 77  VNENSKEVKFDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQ 136

Query: 195 HTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVK 254
           H H DELQ ++ K TG  TVPN +ING S GG DD++ LH+  KL+E+++E S+ +  V+
Sbjct: 137 HGHTDELQDYIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196

Query: 255 AIEKPSNS 262
           A+  PS S
Sbjct: 197 AV-PPSES 203

>NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON}
           Anc_3.189
          Length = 222

 Score =  125 bits (315), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 128/272 (47%), Gaps = 67/272 (24%)

Query: 1   MALGWNKRNIRILSITGVLLFVIFLISQNNNG-----------MLTDPSGLISDAFESTS 49
           MA+  NKRNIR+L  T VL+ +   + QN N             +TD + ++    E  +
Sbjct: 1   MAVVLNKRNIRVLITTCVLIVIGVFVFQNANASTYTSSKALKSTITDTNSIVQAHGEDEN 60

Query: 50  VKGMIDSDNVRVGGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXX 109
           +  + + DN  V  ++          + +D K+NA+                        
Sbjct: 61  IPALKNVDNSPVSTEIT---------SEEDSKINAD------------------------ 87

Query: 110 XXXXXXXXXXXXXXXXXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPY 169
                                    VQ  +E V FD A+EY  I +  P+++++KTFCPY
Sbjct: 88  ----------------------SSIVQAEAE-VPFDVAKEYTSILQRGPMVIFSKTFCPY 124

Query: 170 CKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDD 229
            K L +LL  ++   P+   ++LDKH HG+ELQ ++ +QTG  TVPN +ING S GG DD
Sbjct: 125 SKALKELLSTNFQINPQPIVIELDKHEHGEELQAYIKEQTGRGTVPNLIINGNSKGGSDD 184

Query: 230 ILKLHEAGKLIETIQEMSDYSVVVKAIEKPSN 261
           + KL +   L++++ E S+ +  V+A E  SN
Sbjct: 185 MKKLFDENVLLDSLNEWSNGAYEVQATETASN 216

>YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}
           GRX7Cis-golgi localized monothiol glutaredoxin; more
           similar in activity to dithiol than other monothiol
           glutaredoxins; involved in the oxidative stress
           response; does not bind metal ions; functional overlap
           with GRX6
          Length = 203

 Score =  122 bits (307), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 118/255 (46%), Gaps = 59/255 (23%)

Query: 1   MALGWNKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVR 60
           MA+  NKRN+R+L IT +LL V+F +       L + +  ++++  +     ++  DN  
Sbjct: 1   MAIVINKRNVRVLVITNLLLIVVFFV-------LRNSNASVNESITTHHPDSLVTFDNSG 53

Query: 61  VGGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXX 120
                  S  D V      DK   E+DK                                
Sbjct: 54  NAPGTHQSVHDTVN---TQDKEAEEVDK-------------------------------- 78

Query: 121 XXXXXXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEES 180
                             S   +FD A EY  I E SP+I+++KT CPY K+L  LL  S
Sbjct: 79  -----------------NSGDAEFDAAAEYNKIMEQSPMIVFSKTGCPYSKKLKALLTNS 121

Query: 181 YSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLI 240
           Y+F P ++ V+LD+H H  ELQ  + K TG  TVPN +I G S GGY +I +LH+  +L+
Sbjct: 122 YTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTSRGGYTEIAELHKNDELL 181

Query: 241 ETIQEMSDYSVVVKA 255
           ++ ++ SD +  VKA
Sbjct: 182 DSFKKWSDGAFTVKA 196

>Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  121 bits (303), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 81/125 (64%), Gaps = 1/125 (0%)

Query: 138 GSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTH 197
            SE  +FD A EY  I + SP+I+++K+FCP+ K+L  LL ESY+F P ++ V+LDK  H
Sbjct: 80  NSEEAQFDAAAEYDKILKKSPMIVFSKSFCPFSKKLKTLLAESYTFSPSYYVVELDKREH 139

Query: 198 GDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVKAIE 257
             ELQ+ + K TG  TVPN VI+G S GG D+I  LHE  KL+ + +E S     V+AI 
Sbjct: 140 TSELQEHIEKSTGRRTVPNVVIDGISRGGCDEITALHENDKLLNSFKEWSSGKFTVEAI- 198

Query: 258 KPSNS 262
            PS S
Sbjct: 199 SPSQS 203

>Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  120 bits (301), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (65%)

Query: 139 SEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHG 198
           S+ V FD A EY  I E SP ++++KT CPY K+L  LL ESY+  P ++ V+LD+H HG
Sbjct: 81  SKGVTFDAAAEYGKILEYSPFVVFSKTGCPYSKKLKSLLAESYAITPSYYVVELDEHEHG 140

Query: 199 DELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVKA 255
            EL+ ++  +TG +TVPN VING S GGY ++  LHE   L+++ +E S     VKA
Sbjct: 141 KELKDYIGDKTGRSTVPNVVINGISRGGYTEMAALHENDTLVDSFKEWSSDKFTVKA 197

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 25/32 (78%)

Query: 1  MALGWNKRNIRILSITGVLLFVIFLISQNNNG 32
          MA+  NKRN+R+L IT +LL ++FL+ +++N 
Sbjct: 1  MAIVINKRNVRVLVITNILLILVFLVVRSSNA 32

>KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {ON}
           Anc_3.189 YDL010W
          Length = 194

 Score =  114 bits (285), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 74/110 (67%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           F PA EY  I   SP+++++K++CPY  +L KLL   + F P +  V+LD+H HG ELQ+
Sbjct: 82  FSPAVEYDSILSRSPVVIFSKSYCPYSAKLKKLLAAGFKFTPAYTVVELDEHEHGPELQK 141

Query: 204 FVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVV 253
           ++ ++TG +TVPN ++NG S GG DDI+ L E GKL++ + E    +V V
Sbjct: 142 YIAEKTGRSTVPNLIVNGVSHGGCDDIVALSENGKLLDRLNEWGGSAVNV 191

>AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL010W and
           YBR014C
          Length = 216

 Score =  114 bits (285), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 82/121 (67%)

Query: 142 VKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDEL 201
           V FD A+ Y  I  LS +++++K+ CP    L +LL  +Y F P++  V+LDKH +G EL
Sbjct: 96  VLFDAAKTYNEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAEL 155

Query: 202 QQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVKAIEKPSN 261
           Q++V K T  +TVPN VING S GG+D I++LH+ G+L+E++++ ++    V   ++PSN
Sbjct: 156 QKYVTKTTARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKHAVTQKQRPSN 215

Query: 262 S 262
           S
Sbjct: 216 S 216

>Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AER017C
          Length = 248

 Score =  114 bits (284), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 83/124 (66%)

Query: 135 VQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDK 194
            +  S+ + ++PA  Y  I +++P+I+++KT CPY  +L  LL ++Y F P++  ++LD 
Sbjct: 123 AEDSSDNIGYNPADRYQKILDMAPVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDL 182

Query: 195 HTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVK 254
                ELQ ++++QTG  TVPN ++NGKS+GG+D+I  LH  G+L+++I++ SD  V V 
Sbjct: 183 EKRTKELQFYISQQTGRKTVPNLLVNGKSMGGHDEISALHSKGELLKSIEDWSDKKVTVT 242

Query: 255 AIEK 258
             +K
Sbjct: 243 PKQK 246

>NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON}
           Anc_3.189
          Length = 229

 Score =  113 bits (282), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 118/250 (47%), Gaps = 46/250 (18%)

Query: 1   MALGWNKRNIRILSITGVLLFVIFLI--SQNNNGMLTDPSGLISDAFESTSVKGMIDSDN 58
           MA+  NKRNIR++ IT  LL ++F I  S NN+   T+     S+     S+ G    D+
Sbjct: 1   MAIVLNKRNIRVVGITAALLCLVFFIIQSANNSAFTTESPSKQSNKPALNSLVGA-HGDD 59

Query: 59  VRVGGKVRYSSDDLVKG----TAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXX 114
           + +        D++       T  +   N E+D+                          
Sbjct: 60  LNIPATHNVLQDNVESAPTVETESESNNNMELDE-------------------------- 93

Query: 115 XXXXXXXXXXXXQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLA 174
                         ++AQ      + P  FD A+EYA I    P+++++K+ CPY  +L 
Sbjct: 94  ------------SADSAQEKDASTTAP-DFDVAKEYAAILAKGPMVIFSKSTCPYSSKLK 140

Query: 175 KLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLH 234
           KLL  ++ F PE   V+LDKH HGD LQ ++ ++TG  TVPN ++ G S GG DDI KL 
Sbjct: 141 KLLRTNFQFSPEPVIVELDKHEHGDVLQGYIKEETGRGTVPNLIVGGLSRGGSDDIQKLF 200

Query: 235 EAGKLIETIQ 244
           + G L++ ++
Sbjct: 201 DEGTLLKELK 210

>KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa]
           {ON} similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 211

 Score =  106 bits (264), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 119/252 (47%), Gaps = 52/252 (20%)

Query: 6   NKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVRVGGKV 65
           +KR++R++S+TG+++FV+F I  N   +     G               +S N+      
Sbjct: 3   SKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGK--------------ESSNL------ 42

Query: 66  RYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 125
                      A D KV ++I+ I+E +                                
Sbjct: 43  -----------ANDAKVESDINNIQEGIA-----------------ETKSNAVVADTSNA 74

Query: 126 XQNNAAQRAVQG---GSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYS 182
            +N A    V+     +E   ++   EY  I   SPI++++K++CP+  RL  LL+E Y 
Sbjct: 75  VKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YE 133

Query: 183 FQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIET 242
           F P +  V+LDKH +G ELQ+++  +TG +TVPN +ING S GG D+   LHE   L+++
Sbjct: 134 FDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQS 193

Query: 243 IQEMSDYSVVVK 254
           ++  +  ++ VK
Sbjct: 194 LKTWAGSTLSVK 205

>CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some
           similarities with uniprot|P38068 Saccharomyces
           cerevisiae YBR014c
          Length = 226

 Score =  105 bits (262), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 70/96 (72%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           + PA+E+  + + +PI++++K++CP+ K L KLL+++Y   P + AV++D+H +GD+L  
Sbjct: 114 YSPAKEFQKLVKSAPIVIFSKSYCPFSKNLKKLLDKNYRLDPAYVAVEVDQHPNGDKLYS 173

Query: 204 FVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKL 239
           ++ K TG NTVPN + NG S GG+DD+L LH + +L
Sbjct: 174 YIKKLTGRNTVPNLIANGDSKGGFDDMLALHNSNEL 209

>NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {ON}
           Anc_8.679
          Length = 357

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 69/130 (53%), Gaps = 11/130 (8%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           FDP + +  I   SP +L+ K+       L KLL+E Y   PE   V LDKH++G EL+Q
Sbjct: 228 FDPERSFNQIIHTSPAVLFIKSSSTDSLNLRKLLKEEYEISPELAVVDLDKHSNGVELEQ 287

Query: 204 FVNKQ---TGHNT-----VPNFVINGKSL---GGYDDILKLHEAGKLIETIQEMSDYSVV 252
           ++ +    T   T     VP   +NG S+   G   DI KLH+ G L+E ++ +SD  ++
Sbjct: 288 YIKQNKLLTEERTNSPINVPYLFLNGNSVINNGLSKDISKLHKNGHLLEKLRSLSDGHIM 347

Query: 253 VKAIEKPSNS 262
               + PSNS
Sbjct: 348 FVKKDHPSNS 357

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 3/126 (2%)

Query: 140 EPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGD 199
           E   FD    +  I   SP++L+ KT          LL   Y   PE   V LDKH++G 
Sbjct: 142 ESASFDVETNFNEILNTSPVVLFIKTSDKQSNYFKNLLLREYEISPEVAVVDLDKHSNGA 201

Query: 200 ELQQFVNKQ---TGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMSDYSVVVKAI 256
           +LQ+++ K    T    +P   IN  ++   D++ K H+ G L+E  +++ +  ++ K I
Sbjct: 202 KLQEYIRKNKLMTKDQKLPYLFINSVAITNNDNLKKFHKDGTLLENFKKLGNGKIMFKKI 261

Query: 257 EKPSNS 262
           E PSNS
Sbjct: 262 EAPSNS 267

>SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {ON}
           weakly similar to uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 258

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 71/138 (51%), Gaps = 15/138 (10%)

Query: 140 EPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGD 199
           E + FDP+  +  I   SP++++TK+     + L  LL + Y   P+   V+LDKH  G 
Sbjct: 121 ESLAFDPSINFKEILSTSPVVIFTKSSDLGSQYLKNLLTKEYQISPQVAVVELDKHAKGK 180

Query: 200 ELQQFV--NKQTGHNT----------VPNFVINGKSL---GGYDDILKLHEAGKLIETIQ 244
           ELQ ++  NK T + +          VP   ING S+   G  DDI KLH+ G L++ ++
Sbjct: 181 ELQDYIKLNKLTAYKSNLSPSDDIPEVPYLFINGVSIINKGLKDDIKKLHKDGSLLDKLR 240

Query: 245 EMSDYSVVVKAIEKPSNS 262
             +   V+ +    PSNS
Sbjct: 241 SFAGEKVMFEKANLPSNS 258

>Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W
           (REAL)
          Length = 145

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 159 IILYTKTFCPYCK-RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           + +  KT+CPYCK  L+ L +E    + +   ++LD+ ++G E+Q  + + +G  TVPN 
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQRTVPNV 112

Query: 218 VINGKSLGGYDDILKLHEAGKLIETIQ 244
            INGK +GG  D+  L ++GKL E ++
Sbjct: 113 YINGKHIGGNSDLESLKKSGKLAEILK 139

>KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 281

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 66/135 (48%), Gaps = 15/135 (11%)

Query: 143 KFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQ 202
           +F P+  +  I   SP+IL+ K+       L  +L   Y+F PE   V LDKH  GD +Q
Sbjct: 147 RFSPSLGFQQILNTSPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFGDSMQ 206

Query: 203 QFV--NKQTGHNT----------VPNFVINGKSL---GGYDDILKLHEAGKLIETIQEMS 247
           +++  N+   + +          VP   ING SL      DDIL  H  G L+  ++ ++
Sbjct: 207 EYIQLNRLATYKSNYGESSKSPDVPYLFINGVSLINKSLKDDILNKHADGSLLSKLRHVA 266

Query: 248 DYSVVVKAIEKPSNS 262
           D  V +  ++ PSNS
Sbjct: 267 DSKVSISKVDIPSNS 281

>Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 159 IILYTKTFCPYCK-RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           + +  KT+CPYCK  L+ L +E    + +   ++LD+ ++G E+Q  + + +G  TVPN 
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNV 112

Query: 218 VINGKSLGGYDDILKLHEAGKLIETIQEM 246
            INGK +GG  D+  L + GKL E ++ +
Sbjct: 113 YINGKHIGGNSDLETLKKNGKLAEILKPL 141

>YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}
           GRX2Cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase involved
           in maintaining redox state of target proteins, also
           exhibits glutathione peroxidase activity, expression
           induced in response to stress
          Length = 143

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 159 IILYTKTFCPYCK-RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           + +  KT+CPYCK  L+ L +E    + +   ++LD+ ++G E+Q  + + +G  TVPN 
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNV 112

Query: 218 VINGKSLGGYDDILKLHEAGKLIETIQ 244
            INGK +GG  D+  L + GKL E ++
Sbjct: 113 YINGKHIGGNSDLETLKKNGKLAEILK 139

>KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON}
           Anc_1.38 YCL035C
          Length = 157

 Score = 64.3 bits (155), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 158 PIILYTKTFCPYCKRLAKLLEESYSFQPEFHAV--KLDKHTHGDELQQFVNKQTGHNTVP 215
           PI + +KT+CPYC+   K L +     PE  AV  +LD+   G E+Q+ +    G  TVP
Sbjct: 66  PIFVASKTYCPYCRATLKTLFKELEI-PESEAVVLQLDEMPDGPEIQEALFDINGQKTVP 124

Query: 216 NFVINGKSLGGYDDILKLHEAGKL 239
           N  I G+ +GG DD+  L +AGKL
Sbjct: 125 NIYIKGQHIGGNDDLQTLKKAGKL 148

>Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 63.5 bits (153), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 159 IILYTKTFCPYCK-RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           + +  KT+CPYCK  L+ L +E    + +   ++LD+ ++G E+Q  + + +G  TVPN 
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELNVPKSKAVVLELDEMSNGSEIQDALEEISGQKTVPNV 112

Query: 218 VINGKSLGGYDDILKLHEAGKLIETIQ 244
            INGK +GG  D+  L + GKL E ++
Sbjct: 113 YINGKHIGGNSDLEALKKNGKLAELLK 139

>Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {ON}
           YCL035C (GRX1) - Glutaredoxin [contig 121] FULL
          Length = 138

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 159 IILYTKTFCPYCKRLAKLLEESYSF-QPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I + +KT+CPYC+   KLL E     + + + V+LD    G E+Q+ + + +G  TVPN 
Sbjct: 48  IFVASKTYCPYCQATLKLLFEDKKLTKDQVYVVQLDTIKEGSEIQEALAEISGQKTVPNV 107

Query: 218 VINGKSLGGYDDILKLHEAGKL 239
            I+G+ +GG  D+  L  +GKL
Sbjct: 108 YISGEHIGGNSDLQALESSGKL 129

>KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {ON}
           weakly similar to uniprot|P25567 Saccharomyces
           cerevisiae YCL037C SRO9 Associates with translating
           ribosomes and weakly similar to uniprot|Q12034
           Saccharomyces cerevisiae YDR515W SLF1 RNA binding
           protein that associates with polysomes
          Length = 107

 Score = 60.5 bits (145), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 157 SPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAV-KLDKHTHGDELQQFVNKQTGHNTVP 215
           S I + +KT+CPYC+   K L E      +   V +L++   G ++Q  + + TG  TVP
Sbjct: 17  SKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQDALAEITGQKTVP 76

Query: 216 NFVINGKSLGGYDDILKLHEAGKL 239
           N  INGK +GG  D+ +L+ +G L
Sbjct: 77  NIFINGKHIGGNSDLQELNNSGDL 100

>CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly
           similar to uniprot|P17695 Saccharomyces cerevisiae
           YDR513w TTR1
          Length = 142

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 54/90 (60%), Gaps = 3/90 (3%)

Query: 159 IILYTKTFCPYCKRLAK--LLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPN 216
           I + +K++CPYC R AK  L EE      +   ++LD+   G ++QQ + +  G NTVPN
Sbjct: 52  IFVASKSYCPYC-RAAKQTLFEELKVPMDKAVVLELDEIEEGSDIQQALAEINGQNTVPN 110

Query: 217 FVINGKSLGGYDDILKLHEAGKLIETIQEM 246
             I+G+ +GG  D+ KL + GKL   +Q++
Sbjct: 111 IYIDGQHIGGNSDLQKLKQTGKLQPLLQKV 140

>CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {ON}
           some similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156c PRM4
          Length = 233

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 63/138 (45%), Gaps = 17/138 (12%)

Query: 142 VKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDEL 201
           +++DP + +  I   SP +L+ ++       L KLL   Y   PE   V LDKH H   L
Sbjct: 96  IEYDPEKNFKQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLL 155

Query: 202 QQFVNKQTGHNT--------------VPNFVINGKSL---GGYDDILKLHEAGKLIETIQ 244
           ++ +      +T               P   ING SL   G  DDILK HE G+L+  ++
Sbjct: 156 ERHILSHKIKSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLK 215

Query: 245 EMSDYSVVVKAIEKPSNS 262
             +  ++V    + PSNS
Sbjct: 216 AFAGENIVFNKRDLPSNS 233

>Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON}
           similar to Ashbya gossypii ACR146W
          Length = 281

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 66/150 (44%), Gaps = 15/150 (10%)

Query: 128 NNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEF 187
           NN      + G    +F PA  +  I   SP++++ K      + L  LL   Y   PE 
Sbjct: 132 NNMVLTGPRSGGMKNEFMPAIAFQEILNTSPVVVFAKGMNRDSEYLKNLLHAEYEVTPEI 191

Query: 188 HAVKLDKHTHGDELQQFV--NKQTGHNT----------VPNFVINGKSLGGYD---DILK 232
             V L KH  GDELQ+++  NK   +NT          VP   ING S+       DI  
Sbjct: 192 AIVDLMKHDQGDELQKYIMLNKLNTYNTHYDASDDIPDVPYLFINGVSVINVSLEKDIKL 251

Query: 233 LHEAGKLIETIQEMSDYSVVVKAIEKPSNS 262
            H +G LIE ++  +   V  K +  PSNS
Sbjct: 252 QHTSGLLIEKLRSFAGEKVKFKRLSPPSNS 281

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 70/139 (50%), Gaps = 11/139 (7%)

Query: 135 VQGGSEPVK-FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLD 193
           +   S P++ F+P   +  I E SP++L+ K+     K +  +L + Y   PE   V LD
Sbjct: 98  IPTSSSPIQSFNPEVNFFQILETSPMVLFIKSSERDSKIIRDILTKEYEISPELAVVDLD 157

Query: 194 KHTHGDELQQFV-----NKQ----TGHNTVPNFVINGKSLGGYDDILK-LHEAGKLIETI 243
           KH HGDEL++F+     N+Q    +   ++P   +N  S+      +K LH    LI+  
Sbjct: 158 KHKHGDELEEFIRLNKLNEQAIFSSSLASLPYLFVNEVSMEIDTATIKDLHSKNFLIKKF 217

Query: 244 QEMSDYSVVVKAIEKPSNS 262
           + MS+  V+ +    PSNS
Sbjct: 218 ELMSNGKVLFERKNPPSNS 236

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 64/131 (48%), Gaps = 7/131 (5%)

Query: 139 SEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHG 198
           S    F+  Q +  I   SP++L+ K+     + +  LL++ Y   PE   V LDKHTHG
Sbjct: 110 SHAAAFNVQQHFTQIIHTSPVVLFMKSSQDDSRLMRDLLQKEYEISPEIAVVDLDKHTHG 169

Query: 199 DELQQFV------NKQTGHNTVPNFVINGKSLG-GYDDILKLHEAGKLIETIQEMSDYSV 251
             LQ ++      N+ T +  +P   IN + +     ++  LH+ G L++T ++ +  +V
Sbjct: 170 AALQDYIRLNKLDNRGTAYVKLPYLFINEQFVHVDVKNVKSLHKDGALLKTFKDAAGENV 229

Query: 252 VVKAIEKPSNS 262
                  PSNS
Sbjct: 230 FWHKTGVPSNS 240

>TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {ON}
           Anc_1.38 YCL035C
          Length = 118

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 1/88 (1%)

Query: 158 PIILYTKTFCPYCKR-LAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPN 216
           PI +  K+ CPY K+ L  L ++ +  + +   + +D+  +G E++Q +   TG  TVPN
Sbjct: 28  PIFVARKSDCPYSKKTLETLFDDLHVPKDKVLLITVDEIENGAEVKQAIIDYTGQKTVPN 87

Query: 217 FVINGKSLGGYDDILKLHEAGKLIETIQ 244
             ING+ +GG DD+ KL + G+L E ++
Sbjct: 88  TYINGRHIGGNDDLQKLKQTGELQELLR 115

>YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}
           PRM4Pheromone-regulated protein proposed to be involved
           in mating; predicted to have 1 transmembrane segment;
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 284

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 117/275 (42%), Gaps = 24/275 (8%)

Query: 7   KRNIRILSITGVLL--FVIFLISQNNNGML---TDPSGLISDAFESTSVKGMIDSDNVRV 61
           KR+ RI+S+T VLL  F   L++ N++       DPS    ++ E +  K +    N+  
Sbjct: 15  KRSTRIISLTLVLLGVFSFLLLTWNDSLEFYNSADPSENKKNSEEESEKKFVYKLPNLLK 74

Query: 62  GGKVRYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFXXXXXXXXXXXXXXXXXXXXXXXX 121
                 S+++ +       KV  EI  I+ EV +                          
Sbjct: 75  TADSFLSNENELNF----QKVKEEISNIQSEVEVDIPEPSSKATSKFSSRSFQTDNVVTA 130

Query: 122 XXXXXQN-NAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEES 180
                 N  ++  A+Q   +  KFDP  ++  I   SP +L+ K+       L  LL+  
Sbjct: 131 TTTTTLNPRSSSLALQKNCDHKKFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQRE 190

Query: 181 YSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNT----------VPNFVINGKSL---GGY 227
           +   PE   V L+KH+HG EL++++ KQ   N            P   +NG S+   G  
Sbjct: 191 FEISPELATVDLEKHSHGYELEKYI-KQNKLNIDTSAALESIQSPYLFLNGISVINRGMV 249

Query: 228 DDILKLHEAGKLIETIQEMSDYSVVVKAIEKPSNS 262
            DI++ H  G L+  ++  +  +++V+  + PSNS
Sbjct: 250 RDIIEPHSKGLLLPLLKSEARGNLLVEKKDIPSNS 284

>KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
           cerevisiae YDR513w TTR1
          Length = 138

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 159 IILYTKTFCPYCKRLAKLLEESYSFQP-EFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I +  KT+CPYC    KLL +    +  +   ++LD    G E+Q+ + + +G  TVPN 
Sbjct: 48  IFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQLDTMKEGSEIQEALTEISGQRTVPNI 107

Query: 218 VINGKSLGGYDDILKLHEAGKLIETIQE 245
            I G+ +GG  D+  L  +GKL E +++
Sbjct: 108 YILGEHIGGNSDLQALEASGKLDELLEK 135

>TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON}
           Anc_8.679 YPL156C
          Length = 297

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 62/132 (46%), Gaps = 13/132 (9%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           FD A  Y  I   S ++L+ K+       + KLL  SY   PE   V LD+H  G  L  
Sbjct: 166 FDAAANYKEIINTSRVVLFMKSSDSQSNEIKKLLLNSYEILPEIAIVDLDRHVQGALLHD 225

Query: 204 FVNK------QTGHNT-----VPNFVINGKSL--GGYDDILKLHEAGKLIETIQEMSDYS 250
           ++ K      Q G++      VP  VING S       +  KLH  G L++ ++ ++  S
Sbjct: 226 YIAKKKILTNQLGYHKDDQLEVPFLVINGVSFVTSSNKNFHKLHNEGLLLQKLKNLAGDS 285

Query: 251 VVVKAIEKPSNS 262
           V++   + PSNS
Sbjct: 286 VMISKKDSPSNS 297

>ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} similar
           to uniprot|P17695 Saccharomyces cerevisiae YDR513W TTR1
           Glutaredoxin (thioltransferase) (glutathione
           reductase)and similar to uniprot|P25373 Saccharomyces
           cerevisiae YCL035c
          Length = 139

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 163 TKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHT--HGDELQQFVNKQTGHNTVPNFVIN 220
           +KT+CPYC+   K L     F PE  A+ L  +T   G ++Q  + +  G  TVPN  I+
Sbjct: 57  SKTYCPYCQATLKTLFTDLQF-PEAQAIVLQLNTIDDGQDIQDALYEINGQRTVPNIYID 115

Query: 221 GKSLGGYDDILKLHEAGKL 239
           GK +GG  D+ +L+ +GKL
Sbjct: 116 GKHIGGNSDLQELNASGKL 134

>TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1.38
           YCL035C
          Length = 143

 Score = 57.8 bits (138), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 159 IILYTKTFCPYCKRLAKLLEESYSF-QPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I + +KT+CPYC+   K L +  +  + +   ++L+    G E+Q+ + +  G  +VPN 
Sbjct: 53  IFVASKTYCPYCQATLKTLFDDLNVPKSKSLVLQLNTMDDGAEIQEALFEINGQKSVPNI 112

Query: 218 VINGKSLGGYDDILKLHEAGKLIETIQE 245
            I+GK +GG  D+ +L  AGKL E ++E
Sbjct: 113 YIDGKHIGGNSDLQELKNAGKLDEVLKE 140

>Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON}
           (219541..219966) [426 nt, 142 aa]
          Length = 141

 Score = 57.8 bits (138), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 159 IILYTKTFCPYCK-RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           + +  K++CPYC+  L  L  + +  + +   ++L++   GD++Q  + + TG  TVPN 
Sbjct: 51  VFVAAKSYCPYCQASLQTLFTDYHVPKDKSLVLQLNQMEDGDDIQAALAEITGQRTVPNI 110

Query: 218 VINGKSLGGYDDILKLHEAGKLIETIQ 244
            I+GK +GG  D+ +L  +GKL E ++
Sbjct: 111 YIDGKHIGGNSDLQQLKSSGKLDELLK 137

>Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON}
           complement(73659..73988) [330 nt, 110 aa]
          Length = 109

 Score = 56.6 bits (135), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 158 PIILYTKTFCPYCKRLAKLLEESYSFQPEFHAV-KLDKHTHGDELQQFVNKQTGHNTVPN 216
           P+ +  K++CP+C+   + L E Y+   E   V +LD  T G E+Q+ + + T  +TVPN
Sbjct: 18  PVFVAAKSYCPHCRATRETLFEEYNLPREKALVLELDLMTDGAEIQEALAEITHQDTVPN 77

Query: 217 FVINGKSLGGYDDILKLHEAGKLIETI 243
             I G+ +GG  D+  L + G+L E +
Sbjct: 78  IFIYGQHVGGNSDLQALKKDGQLKEML 104

>ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL156C (PRM4)
          Length = 213

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 63/140 (45%), Gaps = 16/140 (11%)

Query: 136 QGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKH 195
           +GG +   F PAQ +  I   SP +L+ K      + L  LL   Y   PE   V L KH
Sbjct: 77  RGGGD---FRPAQNFQEIISTSPFVLFVKGTDESSRYLRHLLTNEYEVTPEIAVVDLSKH 133

Query: 196 THGDELQQFVNKQTGH--------NT--VPNFVINGKSL---GGYDDILKLHEAGKLIET 242
            +  +LQ+++ +   H        NT  VP   + G+S+       DI + HE G+L   
Sbjct: 134 RYSGDLQRYIREHKLHGPLFQLTENTPDVPYLFVKGESVINTSVEKDIREPHERGQLQAE 193

Query: 243 IQEMSDYSVVVKAIEKPSNS 262
           +Q  +    V+K    PSNS
Sbjct: 194 LQRHAGLDAVIKKRSPPSNS 213

>AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL035C (GRX1) and
           YDR513W (TTR1)
          Length = 111

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 6/91 (6%)

Query: 159 IILYTKTFCPYCKRLAK-LLEESYSFQPEFHAVKLDKHTHGDE---LQQFVNKQTGHNTV 214
           + + +KT+CPYC+   + LLEE          ++LD  T G+E   +Q  + + +G  TV
Sbjct: 19  VFIASKTYCPYCQAAKRTLLEEKRVPASAVKLLELD--TMGEEGAVIQAALQELSGQRTV 76

Query: 215 PNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           PN  ING+ +GG  D+  L  +G+L + ++E
Sbjct: 77  PNIYINGRHVGGNSDLEALKASGELDQLLEE 107

>NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1.38
           YCL035C
          Length = 109

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 159 IILYTKTFCPYCKRLAK-LLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I + +KT+CPYC    K L +E    + +   ++L++   G E+QQ + +  G  TVPN 
Sbjct: 19  IFVASKTYCPYCHATIKTLFKELNVPKSKALVLQLNEMDDGAEIQQALFEINGQKTVPNI 78

Query: 218 VINGKSLGGYDDILKLHEAGKL 239
            INGK +GG D +  L E+G+L
Sbjct: 79  YINGKHVGGNDKLQDLKESGEL 100

>Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON}
           complement(30780..31532) [753 nt, 251 aa]
          Length = 250

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 63/131 (48%), Gaps = 10/131 (7%)

Query: 142 VKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDEL 201
           + FD  + +  I   SP++++ K+  P    L  LL   Y   PE   V LD+H  G  L
Sbjct: 120 LNFDAERNFKEIINTSPVVIFIKSSDPASHYLKNLLLREYEVSPEMAVVDLDRHVQGQLL 179

Query: 202 QQFVNK---QTGHN----TVPNFVINGKSL---GGYDDILKLHEAGKLIETIQEMSDYSV 251
           Q+++      +G N     VP   ING S+   G   DI +    G L++ ++  +  +V
Sbjct: 180 QKYIKAYQLTSGENGNPPEVPYLFINGVSVINNGIEKDIKQAQTKGILLDKLKSFASDNV 239

Query: 252 VVKAIEKPSNS 262
           +++  + PSNS
Sbjct: 240 MIQKKDMPSNS 250

>TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 158 PIILYTKTFCPYCK-RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPN 216
           PI +  K++CPYC+   + L +E      +   + LD+   G  +Q  + + T  NTVPN
Sbjct: 17  PIFVAAKSYCPYCQASKSTLFKELNVPADKATVLDLDQMQDGQAIQAILAELTQQNTVPN 76

Query: 217 FVINGKSLGGYDDILKLHEAGKL 239
             INGK +GG  D+  L   G+L
Sbjct: 77  IFINGKHIGGNSDLQALKNNGEL 99

>Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON}
           similar to Ashbya gossypii AFR710W
          Length = 158

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 157 SPIILYTKTFCPYCKRLAK-LLEESYSFQPEFHAVKLD-KHTHGDELQQFVNKQTGHNTV 214
           S I + +KT+CPYC+R  K L E+     PE   ++LD     G ++Q  + + +G  TV
Sbjct: 65  SKIFVASKTYCPYCRRAKKTLFEDKKIPLPEAKVLELDIMGQEGVDIQAALLELSGQRTV 124

Query: 215 PNFVINGKSLGGYDDILKLHEAGKL 239
           PN  I GK +GG  ++  L  +G+L
Sbjct: 125 PNIYIGGKHIGGNSELQALESSGEL 149

>TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {ON}
           Anc_1.38 YCL035C
          Length = 108

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 159 IILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFV 218
           +++++KTFCPYCK   K  +E+         ++LDK   G E+Q  + +  G  TVP+  
Sbjct: 19  VVIFSKTFCPYCKATLKTFDEARLPVGLVRVLQLDKLDDGSEIQDALYELNGQKTVPSIY 78

Query: 219 INGKSLGGYDDILKLHEAGKLIETIQE 245
           I  + +GG  ++ KL   G ++E I E
Sbjct: 79  ILKRHIGGNSELQKLKHEG-VLEFIME 104

>KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.679
           YPL156C
          Length = 278

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 62/130 (47%), Gaps = 12/130 (9%)

Query: 144 FDPAQEYAIISELSPIILYTKT--FCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDEL 201
           +DP   +  +  +SP++L+ K+         + K+L   Y   P    V LDKH +G+EL
Sbjct: 148 WDPLSTFTEVMNMSPVVLFIKSSERNSLADHVRKVLSTEYEISPGAAVVDLDKHRYGEEL 207

Query: 202 QQFVNKQT----GHNTVPNFVINGKSLGGYDDI------LKLHEAGKLIETIQEMSDYSV 251
           Q ++  Q         +P   +N   + G  +I       +LH  G L++  +++++  V
Sbjct: 208 QNYIETQKLPGGSSQQLPYLFVNRVPVIGAGEIDSVAEFKRLHSTGALLDRFKQLAERKV 267

Query: 252 VVKAIEKPSN 261
           + + IE PSN
Sbjct: 268 LFEKIELPSN 277

>KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON}
           Anc_1.38 YCL035C
          Length = 142

 Score = 55.1 bits (131), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 157 SPIILYTKTFCPYCK-RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVP 215
           + + +  KT+CPYCK  +  LL++      +   +KL++  HG E+Q+ + +  G  TVP
Sbjct: 46  NAVFVAVKTWCPYCKATIVTLLDQMKVPASKIKVLKLNELKHGREIQEALFQMNGQKTVP 105

Query: 216 NFVINGKSLGGYDDILKLHEAGKL 239
           +  IN   +GG  D+ +L  +GKL
Sbjct: 106 HIYINQIFIGGNSDLEELRVSGKL 129

>NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {ON}
           Anc_1.38 YCL035C
          Length = 136

 Score = 55.1 bits (131), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 159 IILYTKTFCPYCKRLA-KLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           +I++ K++CPYCK     + EE    + +   + LD   +G E+QQ +    G  TVP+ 
Sbjct: 48  VIIFAKSYCPYCKAAKHTIFEEINVPKSKALVLDLDLMDNGQEIQQALLAINGQKTVPHV 107

Query: 218 VINGKSLGGYDDILKLHEAGKLIETIQEM 246
            ING+ +GG  ++ K++++G+L + ++ +
Sbjct: 108 YINGEFIGGNSEVQKIYKSGELQKMVEAL 136

>NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 53.9 bits (128), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 159 IILYTKTFCPYC-KRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I + +KT+CPYC   +  L EE    + +   ++L++   G ++Q+ + +  G  TVPN 
Sbjct: 19  IFIASKTYCPYCFSTIKTLFEELKVPKSKALVLQLNEMDDGADIQEALFEINGQKTVPNI 78

Query: 218 VINGKSLGGYDDILKLHEAGKL 239
            INGK +GG   +  L E+G+L
Sbjct: 79  YINGKHIGGNSQLQDLKESGEL 100

>SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 Hydroperoxide and superoxide-radical
           responsive heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair protects
           cells from oxidative damage and similar to
           uniprot|P17695 Saccharomyces cerevisiae YDR513w
           cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase
          Length = 165

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 157 SPIILYTKTFCPYCK-RLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVP 215
           S I + +KT+CPYC+  L  L ++      +   ++L++   G E+Q  + + +G  TVP
Sbjct: 73  SKIFVASKTYCPYCQATLRTLFDDKKVPNDKIKVLQLNQLDDGAEIQDALQEISGQRTVP 132

Query: 216 NFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           N  I GK +GG  D+ +L  AG+L   ++E
Sbjct: 133 NIYILGKHIGGNSDLQELAAAGELDRLLEE 162

>Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}
           YCL035C (REAL)
          Length = 316

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 159 IILYTKTFCPYCKR-LAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I + +KT+CPYC   L  L ++    + +   ++L++   G ++Q  + +  G  TVPN 
Sbjct: 225 IFVASKTYCPYCHAALNTLFQKMNVPKSKVLVLQLNEMKDGVDIQAALYQLNGQRTVPNI 284

Query: 218 VINGKSLGGYDDILKLHEAGKL 239
            INGK +GG DD+ +L E G+L
Sbjct: 285 YINGKHIGGNDDLQELRETGEL 306

>Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C
           (REAL)
          Length = 286

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 66/132 (50%), Gaps = 14/132 (10%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           FDP   +  I + SP +L+ K+       L  LL++ +   PE   V L+KH+ G EL++
Sbjct: 156 FDPKANFLDIIKTSPAVLFIKSSQSDSIFLRNLLQKEFEISPELATVDLEKHSRGYELEK 215

Query: 204 FVNKQTGHNTVPN----------FVINGKSL---GGYDDILKLHEAGKLIETIQEMSDYS 250
           ++ KQ   N  P+            +NG SL   G   DI++ H  G L+  ++  +  +
Sbjct: 216 YI-KQNKLNIDPDIALESIHPPYLFLNGVSLINNGIEKDIIEPHSKGSLLSVLKSEARGN 274

Query: 251 VVVKAIEKPSNS 262
           ++V+  + PSNS
Sbjct: 275 LLVEKKDIPSNS 286

>Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 159 IILYTKTFCPYCKR-LAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I + +KT+CPYC   L  L E+    + +   ++L++   G E+Q  + +  G  TVPN 
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNEMKDGAEIQAALCEINGQRTVPNI 78

Query: 218 VINGKSLGGYDDI 230
            INGK +GG DD+
Sbjct: 79  YINGKHIGGNDDL 91

>Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {ON}
           YPL156C (REAL)
          Length = 287

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 12/132 (9%)

Query: 143 KFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQ 202
           +FDP   +  I   SP +L+ K+       L  LL+  +   PE   V L+KH+HG +L+
Sbjct: 156 EFDPKVSFLDIISTSPAVLFIKSSQMDSIFLKNLLQREFEISPELATVDLEKHSHGYQLE 215

Query: 203 QF-------VNKQTGHNTV--PNFVINGKSL---GGYDDILKLHEAGKLIETIQEMSDYS 250
           ++       +N  T   ++  P   +NG S+   G   DI++ H  G L+  ++  +  +
Sbjct: 216 KYIKQNKLSINPSTALESIHSPYLFLNGVSVINNGMAKDIIEPHSEGLLLSILKSEARGN 275

Query: 251 VVVKAIEKPSNS 262
           ++V+  + PSNS
Sbjct: 276 LLVEKKDIPSNS 287

>KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 271

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 12/130 (9%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           FDPA  +  I   SP++L+  +     +RL  LL+  Y   P    V L+KH+ G +L+ 
Sbjct: 143 FDPAANFQEILSASPVVLFVDS-AQDSERLRALLQRDYEVSPAPAVVDLEKHSRGAQLET 201

Query: 204 FV----NKQTGHNTVPN----FVINGKSLGGYD---DILKLHEAGKLIETIQEMSDYSVV 252
           ++     K      VP       +NG S+   D   DI  LH   +L+  ++ +++ +V+
Sbjct: 202 YIRYYRTKPASATAVPRQPPYLFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVAEGNVM 261

Query: 253 VKAIEKPSNS 262
                 PSNS
Sbjct: 262 FARNNAPSNS 271

>TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1.38
           YCL035C
          Length = 138

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 147 AQEYAIISELSPIILYTKTFCPYCKR-LAKLLEESYSFQPEFHAVKLDKHTHGDELQQFV 205
           A+  A+I + S + +  K++CPYCK  L  L +E    + +   ++LD  + G ELQ  +
Sbjct: 37  ARVNALIKQKS-VFVAAKSYCPYCKNTLITLFDELKVPKEKALVLQLDGMSDGLELQDTL 95

Query: 206 NKQTGHNTVPNFVINGKSLGGYDDILKLHEAGK 238
            +  G  TVP   I+GK +GG  ++ KL ++G+
Sbjct: 96  QQINGQRTVPQIYIDGKHVGGNSELQKLKKSGE 128

>TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38
           YCL035C
          Length = 106

 Score = 51.2 bits (121), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 158 PIILYTKTFCPYCKRLAKLLEESYS-FQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPN 216
           P+ + TK++C         L + YS    E   ++LDK + G+ +   ++K +  +T+PN
Sbjct: 17  PVFIATKSYCNESNAAKGTLFDEYSILDDEATVLELDKMSDGEAVLFALSKISQQSTLPN 76

Query: 217 FVINGKSLGGYDDILKLHEAGKL 239
             I GK +GGY D+ +++E+G+L
Sbjct: 77  IFIKGKHIGGYQDLKEMNESGEL 99

>NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {ON}
           Anc_8.679
          Length = 271

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 60/131 (45%), Gaps = 12/131 (9%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           F+    +  I   SP +L+ K+     + L  LL   Y   P+   V L+KH++G++L  
Sbjct: 141 FNAEDNFKQILNTSPAVLFIKSSEWDSQYLKNLLSIEYEISPQLAIVDLEKHSNGNQLLN 200

Query: 204 FV---------NKQTGHNTVPNFVINGKSL---GGYDDILKLHEAGKLIETIQEMSDYSV 251
           ++         NK +    +P   ING S+   G   DI +LH  G L+  ++  SD  +
Sbjct: 201 YIKKNKLLPPSNKASSTPNLPYLFINGVSIINNGLSKDIKQLHSNGHLLNKLKSYSDGHI 260

Query: 252 VVKAIEKPSNS 262
             +    PSNS
Sbjct: 261 FFEKKNFPSNS 271

>Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {ON}
           YPL156C (REAL)
          Length = 283

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 12/132 (9%)

Query: 143 KFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQ 202
           KFDP   +  I   SP +L+ K+       L +LL+  +   PE   V L+KH++G EL+
Sbjct: 152 KFDPKVNFLDIINTSPAVLFIKSSQMDSVFLKRLLQREFETSPELAIVDLEKHSYGYELE 211

Query: 203 QF-------VNKQTGHNTV--PNFVINGKSL---GGYDDILKLHEAGKLIETIQEMSDYS 250
           ++       V+  T    +  P   +NG S+   G   DI++ H  G L+  ++  +  +
Sbjct: 212 KYIKENKLDVDPSTALEAIHSPYLFLNGVSVINNGIARDIIEPHSKGLLLPVLKSKAGGN 271

Query: 251 VVVKAIEKPSNS 262
           ++V+  + PSNS
Sbjct: 272 LLVEKRDIPSNS 283

>YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}
           GRX1Hydroperoxide and superoxide-radical responsive
           heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair; protects
           cells from oxidative damage
          Length = 110

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 159 IILYTKTFCPYCKR-LAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I + +KT+CPYC   L  L E+    + +   ++L+    G ++Q  + +  G  TVPN 
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNI 78

Query: 218 VINGKSLGGYDDI 230
            INGK +GG DD+
Sbjct: 79  YINGKHIGGNDDL 91

>Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C
           (PRM4) -  [contig 68] FULL
          Length = 275

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 11/129 (8%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           FD A  ++ I   SP++++  +     + L  LL   Y   P    V L+KH+ G +L+ 
Sbjct: 148 FDAAASFSEILNTSPVVIFVDS-AQDSELLRSLLHRHYEVSPAPAVVDLEKHSRGAQLES 206

Query: 204 FV----NKQTGHNTV---PNFVINGKSLGGYD---DILKLHEAGKLIETIQEMSDYSVVV 253
           F+      QT + +    P   +NG+S+   D   DI  LH   KL+E ++ +++  V+ 
Sbjct: 207 FIRLYKTDQTSNPSPREPPYLFVNGQSVINTDFKSDIQDLHAQNKLLEKLRSVAEGQVMF 266

Query: 254 KAIEKPSNS 262
                PSNS
Sbjct: 267 TRNNAPSNS 275

>KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 159 IILYTKTFCPYCKR-LAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           + + +K++CPY K  L  L  E      +   +++++   G ++Q  + + TG  TVPN 
Sbjct: 19  VFVASKSYCPYSKAALNTLFTELNVPTSKALVLQVNQLPEGSDIQDALLELTGQRTVPNI 78

Query: 218 VINGKSLGGYDDILKLHEAGKL 239
            I GK +GG DD+  L ++GKL
Sbjct: 79  YIKGKHIGGNDDLQILKQSGKL 100

>Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 159 IILYTKTFCPYCKR-LAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           I + +KT+CPYC   L  L ++    + +   ++L++   G ++Q  + +  G  TVPN 
Sbjct: 19  IFVASKTYCPYCHAALNTLFQQLKVPKSKVLVLQLNEMEDGADIQAALYEINGQRTVPNV 78

Query: 218 VINGKSLGGYDDI 230
            INGK +GG DD+
Sbjct: 79  YINGKHIGGNDDL 91

>TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON}
           Anc_8.679 YPL156C
          Length = 251

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 8/99 (8%)

Query: 144 FDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQ 203
           ++P   +  I   SP++L+ ++     K + KL    Y   PEF  V LD H +G+ LQ 
Sbjct: 125 YNPELNFKQILNTSPMVLFIRSSQKSSKFIKKLFLNEYEISPEFAIVDLDLHKNGNILQN 184

Query: 204 FVNKQTGHNT-----VPNFVINGKSLGGYD---DILKLH 234
           ++  +   N      VP   ING S+   +   DI+ LH
Sbjct: 185 YIQTKKIINKDDTLDVPYLFINGVSVINSNLNKDIISLH 223

>NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON}
           Anc_1.38 YCL035C
          Length = 138

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 159 IILYTKTFCPYCKRLAK-LLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNF 217
           II++ K++CPY     + L  +    Q +   ++LD    G E+QQ +    G  TVP+ 
Sbjct: 48  IIVFAKSYCPYSIATRRTLFNDCKVPQSKALVLELDLMQDGQEIQQALLAINGQKTVPHV 107

Query: 218 VINGKSLGGYDDILKLHEAGKL 239
            I G+ +GG  ++ ++ ++G+L
Sbjct: 108 YIAGEFIGGNHELQQIFQSGEL 129

>SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W Hypothetical ORF
          Length = 110

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 4/87 (4%)

Query: 163 TKTFCPYCKRLAKLLEESYSFQPE---FHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVI 219
           T  +CP C   A  + + Y    +   F   KL     G+  +   +K +G   +P   +
Sbjct: 21  TAGWCPDCV-YANSIWKKYGVLDKVYLFDIAKLPTREEGNAYRDAFHKISGIRWLPTIFV 79

Query: 220 NGKSLGGYDDILKLHEAGKLIETIQEM 246
           NG   G   D+ +L + GKL++ ++++
Sbjct: 80  NGTKWGTEADLRRLDKEGKLVDELKKV 106

>NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519
          Length = 155

 Score = 32.3 bits (72), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 8/94 (8%)

Query: 157 SPIILYTKTF-----CPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGH 211
           +P++L+ K       C + K   +LL +      +F A  +       EL+  + + T  
Sbjct: 43  APVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFAAYNV---LEDPELRDAIKEFTEW 99

Query: 212 NTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
            T+P   +N + +GG D I  +  +G+L E ++E
Sbjct: 100 PTIPQLFVNKEFVGGCDVITSMSRSGELAEVLEE 133

>Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to
           Ashbya gossypii ADR053W
          Length = 139

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 47/93 (50%), Gaps = 8/93 (8%)

Query: 157 SPIILYTKTF-----CPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGH 211
           +P++L+ K       C + +   ++L +      +F A  + +H    EL++ + + +  
Sbjct: 40  APVVLFMKGTPEFPQCGFSRASIQILGQQGVDPSKFAAYNVLEH---PELREGIKEYSEW 96

Query: 212 NTVPNFVINGKSLGGYDDILKLHEAGKLIETIQ 244
            T+P   IN + +GG D +  + ++G+L E ++
Sbjct: 97  PTIPQLYINKEFIGGCDILTNMAQSGELAELLE 129

>NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519
          Length = 139

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL+  + + T   T+P   +NG+ +GG D I+ + + G L    +E
Sbjct: 83  ELRDGIKEYTDWPTIPQLFVNGEFIGGCDVIVSMSKNGDLNSVFEE 128

>NDAI0C05390 Chr3 complement(1246280..1246714) [435 bp, 144 aa] {ON}
           Anc_8.519
          Length = 144

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 27/46 (58%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL++ + + T   T+P   +N + +GG D I+ + ++G+L    +E
Sbjct: 88  ELREGIKEFTQWPTIPQLFVNKEFIGGCDVIVSMSKSGELTSVFEE 133

>KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.519
           YPL059W
          Length = 149

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 27/46 (58%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL+  + + +   T+P   +N + +GG D I  + ++G+L + ++E
Sbjct: 87  ELRTAIKEFSDWPTIPQLYVNNEFVGGCDVITSMAKSGELADVLEE 132

>Suva_8.54 Chr8 (102513..103823) [1311 bp, 436 aa] {ON} YHR001W
           (REAL)
          Length = 436

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 150 YAIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFV 205
           + IIS+L P    ++   P      K + E  + Q +F  V L+ H++G+ELQ+FV
Sbjct: 51  FNIISQLKPGCDLSRITLPTFILEKKSMLERITNQLQFPDVLLEAHSNGNELQRFV 106

>Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON}
           complement(30908..31351) [444 nt, 148 aa]
          Length = 147

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 27/46 (58%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL+Q + + +   T+P   +N + +GG D I  + + G+L + ++E
Sbjct: 92  ELRQGIKEYSEWPTIPQLYVNKEFVGGCDIITTMAQDGQLADLLEE 137

>NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519
          Length = 161

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 8/94 (8%)

Query: 157 SPIILYTK-----TFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGH 211
           +P++L+ K       C + K   +LL +      +F A  +       EL++ + + T  
Sbjct: 46  APVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFAAYNV---LEDPELREAIKEFTEW 102

Query: 212 NTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
            T+P   +  + +GG D I  +  +G+L E + E
Sbjct: 103 PTIPQLFVENEFVGGCDVITSMARSGELAELLDE 136

>CAGL0M07271g Chr13 (731627..732076) [450 bp, 149 aa] {ON} similar
           to uniprot|Q02784 Saccharomyces cerevisiae YPL059w GRX5
          Length = 149

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 27/46 (58%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL++ + + +   T+P   +N + +GG D I  +  +G+L + ++E
Sbjct: 90  ELREGIKEFSNWPTIPQLYVNKEFIGGCDVITSMARSGELADVLEE 135

>Smik_12.105 Chr12 complement(212747..213058) [312 bp, 103 aa] {ON}
           YLR043C (REAL)
          Length = 103

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 9/87 (10%)

Query: 143 KFDPAQEY--AIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDE 200
           +F  A E+  AI  +   ++ +  T+C  CK +A ++E+     P+    KLD    GD 
Sbjct: 4   QFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGD- 62

Query: 201 LQQFVNKQTGHNTVPNFVI--NGKSLG 225
               V ++   + +P  V+  NGK + 
Sbjct: 63  ----VAQKNEVSAMPTLVLFKNGKEVA 85

>Skud_12.109 Chr12 complement(216544..216855) [312 bp, 103 aa] {ON}
           YLR043C (REAL)
          Length = 103

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 9/87 (10%)

Query: 143 KFDPAQEY--AIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDE 200
           +F  A E+  AI  +   ++ +  T+C  CK +A ++E+     P+    KLD    GD 
Sbjct: 4   QFKTASEFDSAIAQDKLVVVDFFATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGD- 62

Query: 201 LQQFVNKQTGHNTVPNFVI--NGKSLG 225
               V ++   + +P  V+  NGK + 
Sbjct: 63  ----VAQKNEVSAMPTLVLFKNGKEVA 85

>ADR053W Chr4 (804734..805150) [417 bp, 138 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL059W (GRX5)
          Length = 138

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/96 (20%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 157 SPIILYTKTF-----CPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGH 211
           +P++L+ K       C + K   ++L        +F A  + + +   EL+  + + +  
Sbjct: 39  APVVLFMKGTPEFPQCGFSKAAIEILGRQGVDPAKFAAFNVLEDS---ELRSGIKEYSEW 95

Query: 212 NTVPNFVINGKSLGGYDDILKLHEAGKLIETIQEMS 247
            T+P   +N + +GG D +  + ++G+L   ++E S
Sbjct: 96  PTIPQLYVNKEFVGGCDILTNMAQSGELTTMLEEAS 131

>KLLA0B09636g Chr2 (836265..836693) [429 bp, 142 aa] {ON} similar to
           uniprot|Q02784 Saccharomyces cerevisiae YPL059W GRX5
           Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase mitochondrial
           matrix protein involved in the synthesis/assembly of
           iron-sulfur centers monothiol glutaredoxin subfamily
           member along with Grx3p and Grx4p
          Length = 142

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 11/46 (23%), Positives = 28/46 (60%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL++ + + +   T+P   +N + +GG D ++ + + G+L + ++E
Sbjct: 87  ELREGIKEISEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLEE 132

>Suva_16.255 Chr16 (447649..448098) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL++ + + +   T+P   +N + +GG D I  +  +G+L E + E
Sbjct: 90  ELREGIKEFSEWPTIPQLYVNKEFVGGCDVITSMARSGELAELLDE 135

>TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON}
           Anc_8.519 YPL059W
          Length = 149

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 44/94 (46%), Gaps = 8/94 (8%)

Query: 157 SPIILYTKTF-----CPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDELQQFVNKQTGH 211
           +P++L+ K       C + +    LL +      +F A  +       EL+  + + T  
Sbjct: 46  APVVLFMKGTPEFPQCGFSRATISLLGQQGVDPAKFAAFNV---LEDPELRNGIKEYTEW 102

Query: 212 NTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
            T+P   +N + +GG D I  + ++G+L + +++
Sbjct: 103 PTIPQLFVNKEFVGGCDIITNMSQSGELAKLLED 136

>Smik_16.178 Chr16 (319960..320409) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 27/46 (58%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL++ + + +   T+P   +N + +GG D I  +  +G+L + ++E
Sbjct: 90  ELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>Skud_16.224 Chr16 (408961..409410) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 27/46 (58%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL++ + + +   T+P   +N + +GG D I  +  +G+L + ++E
Sbjct: 90  ELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>YPL059W Chr16 (444579..445031) [453 bp, 150 aa] {ON}
           GRX5Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; mitochondrial
           matrix protein involved in the synthesis/assembly of
           iron-sulfur centers; monothiol glutaredoxin subfamily
           member along with Grx3p and Grx4p
          Length = 150

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 27/46 (58%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL++ + + +   T+P   +N + +GG D I  +  +G+L + ++E
Sbjct: 90  ELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>Suva_2.347 Chr2 (612620..617095) [4476 bp, 1491 aa] {ON} YDR180W
           (REAL)
          Length = 1491

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 7/48 (14%)

Query: 8   RNIRILSITGVLLFVIFLISQNNNGM-----LTDPSGLISDAFESTSV 50
           R I +LSI  V+LF IFL+ +N+N +     + +P   +SD  ES  V
Sbjct: 278 RYIALLSI--VILFNIFLLGKNDNNLHRESYIMEPLNFLSDLVESLRV 323

>KLTH0E12034g Chr5 complement(1069449..1069859) [411 bp, 136 aa]
           {ON} similar to uniprot|Q02784 Saccharomyces cerevisiae
           YPL059W GRX5 Hydroperoxide and superoxide- radical
           responsive glutathione-dependent oxidoreductase
           mitochondrial matrix protein involved in the
           synthesis/assembly of iron-sulfur centers monothiol
           glutaredoxin subfamily member along with Grx3p and Grx4p
          Length = 136

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 10/46 (21%), Positives = 29/46 (63%)

Query: 200 ELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETIQE 245
           EL++ + + +   T+P   +N + +GG D ++ + ++G+L + +++
Sbjct: 81  ELREGIKELSEWPTIPQLYVNEEFIGGCDILVSMAQSGELTKLLED 126

>YLR043C Chr12 complement(231702..232013) [312 bp, 103 aa] {ON}
           TRX1Cytoplasmic thioredoxin isoenzyme of the thioredoxin
           system which protects cells against oxidative and
           reductive stress, forms LMA1 complex with Pbi2p, acts as
           a cofactor for Tsa1p, required for ER-Golgi transport
           and vacuole inheritance
          Length = 103

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 143 KFDPAQEY--AIISELSPIILYTKTFCPYCKRLAKLLEESYSFQPEFHAVKLDKHTHGDE 200
           +F  A E+  AI  +   ++ +  T+C  CK +A ++E+     P+    KLD    GD 
Sbjct: 4   QFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDV 63

Query: 201 LQQFVNKQTGHNTVPNFVINGKSLG 225
            Q+  N+ +   T+  F  NGK + 
Sbjct: 64  AQK--NEVSAMPTLLLFK-NGKEVA 85

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,729,482
Number of extensions: 1046185
Number of successful extensions: 2579
Number of sequences better than 10.0: 105
Number of HSP's gapped: 2560
Number of HSP's successfully gapped: 125
Length of query: 262
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 155
Effective length of database: 41,212,137
Effective search space: 6387881235
Effective search space used: 6387881235
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)