Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1045.683.190ON1761768681e-120
ZYRO0A04906g3.190ON1601775043e-65
TDEL0H033703.190ON1531784843e-62
TPHA0H006403.190ON1801824751e-60
YDL008W (APC11)3.190ON1651814592e-58
Suva_4.2393.190ON1651764506e-57
Skud_4.2433.190ON1651774436e-56
Smik_4.2243.190ON1651764384e-55
TBLA0A002603.190ON1841844152e-51
SAKL0C10516g3.190ON1441764052e-50
AER016C3.190ON1471343949e-49
NDAI0A065203.190ON2061313954e-48
Kwal_56.231123.190ON1351313869e-48
CAGL0I04576g3.190ON1491403881e-47
KLTH0G16082g3.190ON1351293782e-46
Ecym_53123.190ON1481333792e-46
KAFR0A012403.190ON1731363664e-44
KNAG0J012503.190ON2021373554e-42
KLLA0E17711g3.190ON1621483254e-38
NCAS0I019203.190ON1281272652e-29
TBLA0I019603.279ON184791141e-06
KLLA0E07151g3.28ON110731082e-06
KAFR0C017803.28ON118691055e-06
KLTH0F19228g3.28ON1101151055e-06
SAKL0C13178g3.28ON138671066e-06
NCAS0C044803.28ON1091151047e-06
Kpol_1014.163.28ON107691031e-05
YOL133W (HRT1)3.28ON121691031e-05
Smik_15.203.28ON121691031e-05
Suva_15.263.28ON122691021e-05
Skud_15.203.28ON121691022e-05
Kwal_55.220543.28ON1111151012e-05
NDAI0G038603.28ON123691022e-05
KNAG0A012803.28ON114691012e-05
Ecym_20293.28ON114671003e-05
ZYRO0C03058g3.28ON1161151003e-05
TBLA0B087103.28ON12273986e-05
TPHA0P014703.28ON11173977e-05
CAGL0E01567g3.28ON10269969e-05
KLLA0F18458g3.279ON14099989e-05
TDEL0A004703.28ON11869961e-04
ADL181W3.28ON10867952e-04
TPHA0I005908.799ON159162992e-04
KLLA0C14344g8.799ON151862992e-04
NDAI0K007108.799ON159162973e-04
Kpol_480.258.799ON157162974e-04
KLLA0C05874g6.45ON55362955e-04
KAFR0B036208.799ON156062957e-04
ZYRO0E06996g3.279ON17279928e-04
SAKL0B06226g8.799ON155755940.001
NCAS0B069902.157ON52198930.001
Suva_13.4328.799ON155962930.001
YMR247C (RKR1)8.799ON156262930.001
Skud_13.4198.799ON156462930.001
TDEL0B009808.799ON155962930.001
Smik_13.4608.799ON156662930.001
KNAG0J005408.799ON156162930.001
NCAS0C006808.799ON156462920.001
AGL079C2.542ON50647920.002
TBLA0D006508.799ON156862920.002
Kpol_1023.322.411ON117865920.002
KLTH0F18502gsingletonON26779900.002
ZYRO0F12760g8.799ON155555910.002
Ecym_26583.279ON15960880.002
NCAS0A082803.279ON11851860.003
KLTH0E13992g8.799ON155062900.003
Kwal_27.123278.799ON157462890.004
ABL058C8.799ON154661890.004
KAFR0B055808.288ON112062880.005
Ecym_74188.799ON154762880.006
NDAI0A074503.279ON17361850.006
CAGL0H10274g3.279ON17567850.006
NCAS0G025202.157ON518113870.007
Kpol_1052.193.279ON103106820.007
TDEL0C027707.416ON208119850.007
Ecym_72442.542ON53247870.007
Suva_15.3112.157ON269105860.008
AGR034W3.279ON15968840.008
Ecym_54453.405ON32165860.008
KAFR0C004603.279ON15776840.009
Skud_8.1762.157ON413105860.009
ZYRO0B02244g2.542ON56347850.011
ZYRO0B16258g2.157ON579104850.012
SAKL0A09746g2.542ON54880850.013
KNAG0H035102.157ON551110850.014
TBLA0F032803.405ON55529850.014
CAGL0H02651g8.799ON154462850.016
TDEL0A031802.542ON56747840.016
TDEL0D034603.279ON14441810.016
Kwal_55.21206singletonON27567830.017
KNAG0A074303.405ON10249790.017
Smik_8.1932.157ON416105830.018
Suva_13.4158.761ON102849830.021
SAKL0E04488g2.411ON112748830.024
YHL010C (ETP1)2.542ON58547830.024
KLTH0D07150g2.542ON54065830.025
YMR231W (PEP5)8.761ON102949830.025
Suva_8.422.542ON58547830.025
Skud_8.352.542ON58547830.025
Smik_8.322.542ON58547820.028
NDAI0B018202.542ON62547820.031
CAGL0L03960g2.157ON603121810.036
Kpol_505.182.157ON58559810.036
CAGL0K02563g2.542ON58647810.041
SAKL0D03058g3.279ON15576790.042
KLTH0C05258g3.279ON15277780.046
KLTH0G13068g8.288ON110155810.046
YHR115C (DMA1)2.157ON416104800.049
Suva_16.4203.405ON29085800.051
KLLA0F25740g2.542ON51746800.051
TPHA0A039903.279ON17572780.054
KAFR0A019902.542ON56047800.062
KNAG0J008503.279ON16276770.063
Smik_13.4398.761ON103049800.063
Kwal_27.105463.279ON10461750.067
NDAI0G052001.389ON1586105800.068
Suva_4.3023.279ON15059770.073
Smik_2.1963.279ON18559770.081
YBR062C3.279ON18059770.082
KLLA0C15697g3.405ON30497780.086
TBLA0G023102.542ON67470780.087
NDAI0F027702.157ON55463780.092
Ecym_42808.288ON113261780.094
Ecym_43257.249ON64499780.095
ZYRO0B03938g7.416ON183109760.10
NDAI0C046005.399ON497115780.10
Skud_2.1863.279ON17859760.11
Kwal_26.80902.542ON52065770.12
TPHA0B036501.389ON157687770.14
Kpol_1002.82.542ON55847770.15
Skud_12.992.411ON117190770.16
NCAS0F031405.399ON47359760.16
TBLA0D040208.288ON117854770.16
NCAS0A04680singletonON27466750.18
YOL138C (RTC1)3.22ON134155760.18
TDEL0B061701.389ON147074760.20
ADL064W7.249ON64699760.20
KLLA0E07019g7.416ON27962750.21
Smik_8.1745.399ON36558750.22
YHR097C5.399ON36658750.23
NCAS0A125502.542ON57247750.24
KAFR0A052406.45ON553109750.24
KNAG0C056602.542ON50762750.25
KAFR0B034208.761ON103648750.27
Smik_4.6125.399ON49859740.27
KNAG0A060302.411ON115069750.28
SAKL0B08976g3.405ON32243740.28
Skud_8.1585.399ON36558740.28
CAGL0L01947g2.545ON75794740.29
ZYRO0G13376g8.808ON44531740.31
KAFR0I020901.389ON146651740.32
Suva_15.2925.399ON36258740.33
TBLA0B012602.157ON88559740.34
Suva_15.223.22ON133655740.35
SAKL0G07568g5.399ON52264730.37
TPHA0F018402.157ON52160730.37
KLTH0E09174g2.411ON114851740.38
ACL019C6.45ON57561730.39
TDEL0F02870na 1ON26038720.41
TBLA0A039008.317ON69875730.42
Kwal_55.203188.761ON89987730.43
Ecym_26848.808ON38681730.43
YDR143C (SAN1)8.317ON61060730.45
AGL217W8.808ON41435730.46
Skud_4.4028.317ON61273730.48
TPHA0K008707.249ON605100730.49
Kwal_27.104198.808ON30063720.49
Smik_15.1576.45ON55094720.50
SAKL0E10824g2.157ON475104720.52
KAFR0F007402.157ON51032720.56
Suva_2.3048.317ON62458720.59
KNAG0I010508.288ON115957720.59
Suva_15.1596.45ON55089720.61
Ecym_42508.317ON65768720.66
KLTH0F11044g3.405ON29163710.67
Smik_15.163.22ON132655720.68
TPHA0C042502.542ON55647710.69
Suva_10.1122.411ON116759710.75
NCAS0A041202.411ON113777710.76
NCAS0C033108.317ON57065710.81
Skud_15.163.22ON133255710.83
Smik_12.942.411ON117859710.84
Kpol_480.228.808ON42580700.92
Kwal_56.236858.288ON110255700.96
TBLA0H003202.411ON130152710.96
KNAG0C034107.416ON21954690.98
KNAG0C051505.399ON45675701.0
Kpol_1035.506.45ON60127701.0
ABR104W3.405ON32849701.0
TBLA0H002303.22ON133342701.1
SAKL0D02354g8.808ON33132691.1
KLLA0F25674g2.545ON75736701.1
Kwal_23.58597.249ON61977701.1
SAKL0C03586gsingletonON147463701.2
SAKL0C01760gsingletonON147463701.2
Smik_16.3333.405ON29027691.2
CAGL0E02299g6.45ON54587691.2
Skud_13.4008.761ON103049701.2
KLTH0D07216g2.545ON74731691.2
Kwal_26.80992.545ON75031691.2
Skud_16.3793.405ON28827691.2
Skud_15.1486.45ON54865691.3
KLTH0C04664g8.808ON30643691.3
KLLA0F12166g1.389ON152864691.3
YLR032W (RAD5)2.411ON116931691.3
Skud_4.6175.399ON49559691.3
NDAI0E048507.249ON66099691.4
TBLA0C013301.389ON145249691.4
Kpol_1002.72.545ON75432691.4
KAFR0B014602.545ON76196691.4
Smik_4.3878.317ON63460691.4
KLTH0A04532g7.249ON61177691.5
Ecym_13225.399ON51153691.5
YOL013C (HRD1)6.45ON55127681.6
ZYRO0C07194g6.45ON55827681.6
Suva_14.2232.157ON58059681.7
Kwal_47.177712.411ON97291691.7
YKL034W (TUL1)2.545ON75831681.7
CAGL0A03432g2.411ON115165691.7
YDR348C (PAL1)5.399ON49959681.7
SAKL0H15686g8.317ON59938681.8
TPHA0C008508.317ON78129681.9
TPHA0A033403.405ON384101681.9
TDEL0E022505.399ON45759682.0
YPR093C (ASR1)3.405ON28827672.0
Skud_14.2162.157ON53059682.0
KNAG0I020902.157ON42771672.0
Kpol_1072.552.157ON42035672.1
CAGL0E01441g8.317ON71728682.1
KNAG0G032808.808ON35168672.1
KNAG0E027406.45ON55627672.2
CAGL0B02013g8.288ON112052682.2
Ecym_54282.157ON474107672.4
KNAG0A070902.545ON76231672.4
ZYRO0G15642g8.761ON102466672.4
CAGL0I09988g8.808ON38735672.5
TBLA0I014902.545ON75031672.5
KLLA0F23892g2.157ON51834672.5
ZYRO0C08360g7.249ON65199672.6
ZYRO0E05632g2.545ON76531672.6
Kpol_1030.298.761ON101649672.6
KAFR0D016708.808ON35734672.6
KLLA0F22154g5.399ON53053672.6
TDEL0B052002.157ON524100672.6
Suva_11.1892.545ON75831672.7
Ecym_72412.545ON75831672.7
TPHA0A003803.22ON131034672.8
Smik_14.2122.157ON52959672.8
KLTH0G18150g1.389ON155473672.8
NDAI0G026308.317ON66150672.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1045.68
         (176 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   338   e-120
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   198   3e-65
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   191   3e-62
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...   187   1e-60
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   181   2e-58
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   177   6e-57
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   175   6e-56
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   173   4e-55
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   164   2e-51
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   160   2e-50
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   156   9e-49
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   156   4e-48
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   153   9e-48
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...   154   1e-47
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   150   2e-46
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   150   2e-46
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   145   4e-44
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   141   4e-42
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...   129   4e-38
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   106   2e-29
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    49   1e-06
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    46   2e-06
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    45   5e-06
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    45   5e-06
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    45   6e-06
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       45   7e-06
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    44   1e-05
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    44   1e-05
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    44   1e-05
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    44   1e-05
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    44   2e-05
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    44   2e-05
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    44   2e-05
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    44   2e-05
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    43   3e-05
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    43   3e-05
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    42   6e-05
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    42   7e-05
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    42   9e-05
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    42   9e-05
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    42   1e-04
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    41   2e-04
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    43   2e-04
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    43   2e-04
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    42   3e-04
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    42   4e-04
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    41   5e-04
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    41   7e-04
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    40   8e-04
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    41   0.001
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    40   0.001
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    40   0.001
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    40   0.001
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    40   0.001
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    40   0.001
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    40   0.001
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    40   0.001
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    40   0.001
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    40   0.002
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    40   0.002
Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {...    40   0.002
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    39   0.002
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    40   0.002
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    39   0.002
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    38   0.003
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    39   0.003
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    39   0.004
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    39   0.004
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    39   0.005
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    39   0.006
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    37   0.006
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    37   0.006
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    38   0.007
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    36   0.007
TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON...    37   0.007
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    38   0.007
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    38   0.008
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    37   0.008
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    38   0.008
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    37   0.009
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    38   0.009
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    37   0.011
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    37   0.012
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    37   0.013
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    37   0.014
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    37   0.014
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    37   0.016
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    37   0.016
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    36   0.016
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    37   0.017
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    35   0.017
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    37   0.018
Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR23...    37   0.021
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    37   0.024
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    37   0.024
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    37   0.025
YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Comp...    37   0.025
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    37   0.025
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    37   0.025
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    36   0.028
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     36   0.031
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    36   0.036
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    36   0.036
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    36   0.041
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    35   0.042
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    35   0.046
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    36   0.046
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    35   0.049
Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {O...    35   0.051
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    35   0.051
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    35   0.054
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    35   0.062
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    34   0.063
Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR23...    35   0.063
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    33   0.067
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    35   0.068
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    34   0.073
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    34   0.081
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    34   0.082
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    35   0.086
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    35   0.087
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    35   0.092
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    35   0.094
Ecym_4325 Chr4 complement(699162..701096) [1935 bp, 644 aa] {ON}...    35   0.095
ZYRO0B03938g Chr2 complement(327333..327884) [552 bp, 183 aa] {O...    34   0.10 
NDAI0C04600 Chr3 complement(1049919..1051412) [1494 bp, 497 aa] ...    35   0.10 
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    34   0.11 
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    34   0.12 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    34   0.14 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    34   0.15 
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    34   0.16 
NCAS0F03140 Chr6 complement(628522..629943) [1422 bp, 473 aa] {O...    34   0.16 
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    34   0.16 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      33   0.18 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   0.18 
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    34   0.20 
ADL064W Chr4 (567687..569627) [1941 bp, 646 aa] {ON} Syntenic ho...    34   0.20 
KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some si...    33   0.21 
Smik_8.174 Chr8 complement(273775..274744,274864..274988) [1095 ...    33   0.22 
YHR097C Chr8 complement(297385..298360,298485..298609) [1101 bp,...    33   0.23 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    33   0.24 
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...    33   0.24 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    33   0.25 
KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8....    33   0.27 
Smik_4.612 Chr4 complement(1096510..1098006) [1497 bp, 498 aa] {...    33   0.27 
KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {...    33   0.28 
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    33   0.28 
Skud_8.158 Chr8 complement(271202..272174,272308..272432) [1098 ...    33   0.28 
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    33   0.29 
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    33   0.31 
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    33   0.32 
Suva_15.292 Chr15 complement(499758..500721,500843..500967) [108...    33   0.33 
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    33   0.34 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    33   0.35 
SAKL0G07568g Chr7 (630838..631109,631353..632649) [1569 bp, 522 ...    33   0.37 
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    33   0.37 
KLTH0E09174g Chr5 (830858..834304) [3447 bp, 1148 aa] {ON} simil...    33   0.38 
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...    33   0.39 
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      32   0.41 
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    33   0.42 
Kwal_55.20318 s55 complement(347619..350318) [2700 bp, 899 aa] {...    33   0.43 
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    33   0.43 
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    33   0.45 
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    33   0.46 
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    33   0.48 
TPHA0K00870 Chr11 complement(181868..183685) [1818 bp, 605 aa] {...    33   0.49 
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    32   0.49 
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    32   0.50 
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    32   0.52 
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    32   0.56 
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    32   0.59 
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    32   0.59 
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    32   0.61 
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    32   0.66 
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    32   0.67 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    32   0.68 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    32   0.69 
Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR03...    32   0.75 
NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {...    32   0.76 
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     32   0.81 
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    32   0.83 
Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032...    32   0.84 
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    32   0.92 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    32   0.96 
TBLA0H00320 Chr8 complement(56811..60716) [3906 bp, 1301 aa] {ON...    32   0.96 
KNAG0C03410 Chr3 (669679..670338) [660 bp, 219 aa] {ON} Anc_7.41...    31   0.98 
KNAG0C05150 Chr3 (1001535..1002905) [1371 bp, 456 aa] {ON} Anc_5...    32   1.0  
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...    32   1.0  
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    32   1.0  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    32   1.1  
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    31   1.1  
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    32   1.1  
Kwal_23.5859 s23 (1345113..1346972) [1860 bp, 619 aa] {ON} YER06...    32   1.1  
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    32   1.2  
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    32   1.2  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    31   1.2  
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...    31   1.2  
Skud_13.400 Chr13 (707700..710792) [3093 bp, 1030 aa] {ON} YMR23...    32   1.2  
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    31   1.2  
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    31   1.2  
Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {O...    31   1.2  
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    31   1.3  
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    31   1.3  
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    31   1.3  
YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA ...    31   1.3  
Skud_4.617 Chr4 complement(1099322..1100809) [1488 bp, 495 aa] {...    31   1.3  
NDAI0E04850 Chr5 (1100709..1102691) [1983 bp, 660 aa] {ON} Anc_7...    31   1.4  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    31   1.4  
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    31   1.4  
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    31   1.4  
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    31   1.4  
KLTH0A04532g Chr1 (378016..379851) [1836 bp, 611 aa] {ON} simila...    31   1.5  
Ecym_1322 Chr1 complement(656210..657518,658465..658691) [1536 b...    31   1.5  
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    31   1.6  
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...    31   1.6  
Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116...    31   1.7  
Kwal_47.17771 s47 (548453..551371) [2919 bp, 972 aa] {ON} YLR032...    31   1.7  
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    31   1.7  
CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} simil...    31   1.7  
YDR348C Chr4 complement(1170326..1171825) [1500 bp, 499 aa] {ON}...    31   1.7  
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    31   1.8  
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    31   1.9  
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    31   1.9  
TDEL0E02250 Chr5 (432893..433164,433451..434552) [1374 bp, 457 a...    31   2.0  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    30   2.0  
Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116...    31   2.0  
KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {O...    30   2.0  
Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON} (1262...    30   2.1  
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    31   2.1  
KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {O...    30   2.1  
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...    30   2.2  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    31   2.2  
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    30   2.4  
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    30   2.4  
ZYRO0G15642g Chr7 complement(1271054..1274128) [3075 bp, 1024 aa...    30   2.4  
CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa] {...    30   2.5  
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    30   2.5  
KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]...    30   2.5  
ZYRO0C08360g Chr3 (637103..639058) [1956 bp, 651 aa] {ON} simila...    30   2.6  
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    30   2.6  
Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {...    30   2.6  
KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {O...    30   2.6  
KLLA0F22154g Chr6 (2069922..2070232,2071226..2072507) [1593 bp, ...    30   2.6  
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    30   2.6  
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    30   2.7  
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    30   2.7  
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    30   2.8  
Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116...    30   2.8  
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    30   2.8  
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     30   2.9  
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    30   2.9  
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    30   3.0  
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    30   3.0  
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    30   3.0  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    30   3.2  
TBLA0D00440 Chr4 (107763..108644) [882 bp, 293 aa] {ON} Anc_7.41...    30   3.2  
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    30   3.3  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    30   3.3  
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    30   3.3  
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    30   3.3  
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    30   3.4  
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    30   3.4  
KLLA0F17479g Chr6 complement(1601287..1604631) [3345 bp, 1114 aa...    30   3.4  
SAKL0F08844g Chr6 (675792..677642) [1851 bp, 616 aa] {ON} simila...    30   3.4  
TDEL0H01950 Chr8 complement(335297..337090) [1794 bp, 597 aa] {O...    30   3.6  
Kpol_1056.27 s1056 complement(62728..63555) [828 bp, 275 aa] {ON...    30   3.6  
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    30   3.7  
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    30   3.7  
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    30   3.8  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    30   3.9  
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    30   4.1  
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    30   5.1  
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    30   5.3  
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    29   5.9  
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    29   6.1  
SAKL0B05104g Chr2 (439233..442349) [3117 bp, 1038 aa] {ON} simil...    29   6.3  
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    29   6.6  
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    29   7.1  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    29   7.4  
TBLA0B03370 Chr2 complement(784352..787546) [3195 bp, 1064 aa] {...    29   7.8  
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...    29   7.8  
Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054...    29   8.0  
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...    29   8.1  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    29   8.1  
Ecym_2458 Chr2 (890326..893409) [3084 bp, 1027 aa] {ON} similar ...    29   8.3  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    29   9.0  
Skud_5.77 Chr5 complement(119815..120618) [804 bp, 267 aa] {ON} ...    28   9.8  

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  338 bits (868), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 165/176 (93%), Positives = 165/176 (93%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 121 ERFRELAIKRQQEQNEFESNLXXXXXXXXXXXEQEDTGRNVDNQGDIIMDQDLVVR 176
           ERFRELAIKRQQEQNEFESNL           EQEDTGRNVDNQGDIIMDQDLVVR
Sbjct: 121 ERFRELAIKRQQEQNEFESNLDDDAAIARAIAEQEDTGRNVDNQGDIIMDQDLVVR 176

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  198 bits (504), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 123/177 (69%), Gaps = 18/177 (10%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MKV++++VH VF+W+WHIPK+              +  G +  DD++DVCGICRAS+N T
Sbjct: 1   MKVDIEEVHSVFAWTWHIPKD--------------NKDGSLEADDDDDVCGICRASYNAT 46

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CP+CK+PGD C LV+GEC HNFHVHCIY WLDT+TS+GLCPMCRQLFQLK+G++INDS +
Sbjct: 47  CPSCKYPGDECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDSQL 106

Query: 121 ERFRELAI-KRQQEQNEFESNLXXXXXXXXXXXEQEDTGRNVDNQGDIIMDQDLVVR 176
           E+F+EL + KR     EF                Q+D    VD+QGD+IMDQ LVVR
Sbjct: 107 EKFKELQLRKRTNTAGEFADE--DDEEAIERAMAQQDQAE-VDDQGDVIMDQGLVVR 160

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  191 bits (484), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 125/178 (70%), Gaps = 27/178 (15%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MKV++++VH VF+W+WHIPK +        +DA  +    + ++D +DVCGICRAS+N T
Sbjct: 1   MKVKLREVHSVFAWTWHIPKES--------QDAHAET---IDDNDGDDVCGICRASYNAT 49

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CP CKFPGDGCPLV+GEC HNFHVHCIY WLDT+TSRGLCPMCRQ FQLKKG++INDS I
Sbjct: 50  CPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQI 109

Query: 121 ERFRELAIKR-QQEQNEFESNLXXXXXXXXXXXEQEDTGRN-VDNQGDIIMDQDLVVR 176
            +F+EL  K+ Q  Q EF               +Q+D   N +++Q D +MDQ L+VR
Sbjct: 110 SKFQELRNKQWQTRQQEF--------------GDQQDPETNPLEDQDDPMMDQGLIVR 153

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score =  187 bits (475), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 100/182 (54%), Positives = 121/182 (66%), Gaps = 8/182 (4%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESG------LGEDAIGDIHGMVHEDDEEDVCGICR 54
           MKV++K V+ VF+W W IPK+   ++         G D          EDDEED CGICR
Sbjct: 1   MKVQIKNVNGVFAWGWQIPKHDQKVKKDHNNSIVSGSDVDHQEQNSDDEDDEEDFCGICR 60

Query: 55  ASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVS 114
           ASF R CPNCKFP DGCP+VIG+C+HNFHVHCI+EWL+T  SRGLCPMCRQ+F+L+KGV 
Sbjct: 61  ASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGVV 120

Query: 115 INDSHIERFRELAIKRQQEQNEFESNLXXXXXXXXXXXEQEDTGRNVDNQGDIIMDQDLV 174
           IND H   F+EL +KRQ+EQNEFE+              QE  G N D   D I+DQD+V
Sbjct: 121 INDLHYVTFKELILKRQKEQNEFEATAEDDEALARMIAAQE--GNNGDVPVDDILDQDMV 178

Query: 175 VR 176
           VR
Sbjct: 179 VR 180

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  181 bits (459), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 118/181 (65%), Gaps = 21/181 (11%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MKV++ +VH VF+WSWHIP  +   E     D IG+       D++EDVCGICRAS+N T
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSD--EDAANNDPIGN-------DEDEDVCGICRASYNGT 51

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CP+CKFPGD CPLVIG C HNFH HCIY WLDT TS+GLCPMCRQ FQL+KG++IND+H+
Sbjct: 52  CPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHV 111

Query: 121 ERFRELAIKRQQEQNEFESNLXXXXXXXXXXXEQEDTGRNVDN-----QGDIIMDQDLVV 175
           ++F E+  +R++E  E                  E   +N DN     Q D I+D+D ++
Sbjct: 112 QKFVEIVSRRREEMIE-------EGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLL 164

Query: 176 R 176
           R
Sbjct: 165 R 165

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  177 bits (450), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 114/176 (64%), Gaps = 11/176 (6%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MKV++ +VH VF+WSWHIP+ +   E+    +           DD+EDVCGICRAS+N T
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISDENETNEVTN---------ENDDDEDVCGICRASYNGT 51

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CP+CKFPGD CPLVIG C HNFH HCIY WLDTS S+GLCPMCRQ+FQL+KG++IND+HI
Sbjct: 52  CPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGLAINDAHI 111

Query: 121 ERFRELAIKRQQEQNEFESNLXXXXXXXXXXXEQEDTGRNVDNQGDIIMDQDLVVR 176
            +F E+  +R++E    E  +            Q         Q D ++D+D ++R
Sbjct: 112 RKFVEVVSRRREEM--IEEGVAEDFVDFDEPIRQNTDSAIDRQQVDTVLDEDFLLR 165

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  175 bits (443), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 118/177 (66%), Gaps = 13/177 (7%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDE-EDVCGICRASFNR 59
           MKV++ +VH VF+WSWHIP         + ++ IG+   + +E+DE EDVCGICRAS+N 
Sbjct: 1   MKVKINEVHSVFAWSWHIP--------SISDEVIGN--EVPNENDEDEDVCGICRASYNG 50

Query: 60  TCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSH 119
           TCP+CK+PGD CPLVIG C HNFH HCIY WLDTS S+GLCPMCRQ FQL+KG++IND+H
Sbjct: 51  TCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAH 110

Query: 120 IERFRELAIKRQQEQNEFESNLXXXXXXXXXXXEQEDTGRNVDNQGDIIMDQDLVVR 176
           I++F ++  +R++E    E  +            Q         Q D ++D+D ++R
Sbjct: 111 IQKFVDIVSRRREEM--IEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  173 bits (438), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 114/176 (64%), Gaps = 11/176 (6%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MKV++ +VH VF+W+W IP  +   +  +  D + D       D+ EDVCGICRAS+N T
Sbjct: 1   MKVKINEVHSVFAWTWQIPSIS---DEKVTNDKLND------NDENEDVCGICRASYNGT 51

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CP+CKFPGD CPLVIG C HNFH HCIY WLDT TS+GLCPMCRQ FQL+KG++IND+HI
Sbjct: 52  CPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHI 111

Query: 121 ERFRELAIKRQQEQNEFESNLXXXXXXXXXXXEQEDTGRNVDNQGDIIMDQDLVVR 176
           ++F E+  +R++E    E  +            Q        +Q D ++D+D ++R
Sbjct: 112 QKFVEIVSRRREEM--IEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  164 bits (415), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 112/184 (60%), Gaps = 8/184 (4%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MK+EVK ++ VF+W W IP +   I++   E  I    G    D++EDVCGICR ++NRT
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CPNCK PG  CPLV+G C HNFHVHCIY+WLDT+TS+GLCPMCRQ F+LK+GV++N S  
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 121 ERFRELAIKR-QQEQNEFE-------SNLXXXXXXXXXXXEQEDTGRNVDNQGDIIMDQD 172
           + F+ L +K+ +Q    F+       S              +   G N  N G +  D  
Sbjct: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGFINEEDYGVVGEREVGQGANGSNDGGLAQDPT 180

Query: 173 LVVR 176
           +VVR
Sbjct: 181 MVVR 184

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score =  160 bits (405), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 107/176 (60%), Gaps = 32/176 (18%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MKV VKKVH V SWSWHIP++                H     D EEDVCGICR S+N T
Sbjct: 1   MKVVVKKVHAVCSWSWHIPRDG--------------THQHEAADTEEDVCGICRVSYNGT 46

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CP+CK+PGD CPLV+GEC HNFHVHCI +WLDT+TSRGLCPMCRQLF LK+GV+INDS +
Sbjct: 47  CPSCKYPGDECPLVVGECNHNFHVHCIVQWLDTATSRGLCPMCRQLFSLKRGVAINDSQL 106

Query: 121 ERFRELAIKRQQEQNEFESNLXXXXXXXXXXXEQEDTGRNVDNQGDIIMDQDLVVR 176
           + F +L  K  +                      E     +  + D++M+QD +VR
Sbjct: 107 DHFAKLLNKVNR------------------AGATELANAGLAEEQDLMMEQDFLVR 144

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  156 bits (394), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 96/134 (71%), Gaps = 14/134 (10%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHED-DEEDVCGICRASFNR 59
           M++++  + CV SW W +PK        L  D+       V+ED DEEDVCGICR S+N 
Sbjct: 1   MQLQINNIQCVASWYWDVPKE-------LKRDS------PVYEDEDEEDVCGICRGSYNG 47

Query: 60  TCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSH 119
           TCPNCK PG+ CPL++G C HNFHVHCIY+WL+TSTS+GLCPMCRQ F L++G+ IN+ H
Sbjct: 48  TCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPH 107

Query: 120 IERFRELAIKRQQE 133
            ++F ++ +K +Q+
Sbjct: 108 RDKFEKVLMKARQQ 121

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  156 bits (395), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 69/131 (52%), Positives = 91/131 (69%), Gaps = 3/131 (2%)

Query: 1   MKVEVKKVHCVFSWSWHIPKN---AGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASF 57
           MK+EV+ ++ + +WSW +PKN     + E     D+ G      +++  +DVCGICRAS+
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVDDVCGICRASY 60

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSIND 117
           N TCPNCKFPG  CPLV+G C HNFH HCIY+WL T TS+GLCPMCRQ F+LK   ++N 
Sbjct: 61  NGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKPNATVNT 120

Query: 118 SHIERFRELAI 128
            H+  F+ELAI
Sbjct: 121 DHLGAFKELAI 131

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  153 bits (386), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 16/131 (12%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MK+E KKV+ VFSWSW IP +         +  IGD          ED+CGICR S+N T
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGDDN------ADKEIGD----------EDLCGICRVSYNGT 44

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CP C+FPGD CPLVIGEC HNFHVHCI +WL+T+T++GLCPMCRQ F LK+GV+IN+  +
Sbjct: 45  CPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQM 104

Query: 121 ERFRELAIKRQ 131
           +   +L ++ Q
Sbjct: 105 DSLAKLLLQSQ 115

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score =  154 bits (388), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 95/140 (67%), Gaps = 14/140 (10%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           M++E+ +VH VF+W W IPKN   ++  +              D++EDVCGICRAS++  
Sbjct: 1   MRIELTEVHGVFNWVWDIPKNEDRLDESMA-------------DEDEDVCGICRASYHAP 47

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CPNC++PG+ C +V+G C HNFHVHCI  W+DT TS+GLCPMCRQ FQL +   IN+ HI
Sbjct: 48  CPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINEPHI 107

Query: 121 ERFRELAIKR-QQEQNEFES 139
             F+E+ IKR +Q Q E E+
Sbjct: 108 PLFKEIEIKRYRQLQEEIEA 127

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  150 bits (378), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 90/129 (69%), Gaps = 16/129 (12%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           M++E KKV+ VFSWSW IP +         +DA  +I        +ED+CGICR S+N T
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGD---------DDADREI-------GDEDLCGICRVSYNGT 44

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CP CK+PGD CPLVIGEC HNFHVHCI +WL T T++GLCPMCRQ F LK+GV+IN+  +
Sbjct: 45  CPGCKYPGDNCPLVIGECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQV 104

Query: 121 ERFRELAIK 129
           E+   L ++
Sbjct: 105 EKLANLLLQ 113

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  150 bits (379), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 70/133 (52%), Positives = 95/133 (71%), Gaps = 12/133 (9%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           M++++K V CV SW W +PK               D+H    ++D+EDVCGICRAS+N T
Sbjct: 1   MQLQIKNVQCVASWYWDVPKELKR-----------DLHEGE-DEDDEDVCGICRASYNGT 48

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           CPNCK PG+ CPL++G C HNFHVHCIY+WL+TSTS+GLCPMCRQ F L+ G+ IN+ H 
Sbjct: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHK 108

Query: 121 ERFRELAIKRQQE 133
           E+F ++ +K +Q+
Sbjct: 109 EKFEKVLMKARQQ 121

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  145 bits (366), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 93/136 (68%), Gaps = 10/136 (7%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMV--HEDDEEDVCGICRASFN 58
           MKV VKK++ V++WSW I    G  +S        D++ ++  +  +++DVCGICRAS+N
Sbjct: 1   MKVTVKKIYPVYAWSWDIVTRKGEQKS--------DVYSVLDKYRSEKDDVCGICRASYN 52

Query: 59  RTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDS 118
            TCP+CK PG  CPL++G C HNFH HCI+ WL+T  S+GLCPMCRQ F+L K + IN  
Sbjct: 53  GTCPSCKIPGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVINSD 112

Query: 119 HIERFRELAIKRQQEQ 134
           ++++F  LA K ++ +
Sbjct: 113 YLQKFEVLARKNRERR 128

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  141 bits (355), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (63%), Gaps = 10/137 (7%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLG----------EDAIGDIHGMVHEDDEEDVC 50
           MK+++K+V+ VF+WSW     A   +              E A  +    V  D++EDVC
Sbjct: 1   MKLDIKRVNPVFTWSWDTRDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDEDVC 60

Query: 51  GICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLK 110
           GICRAS+N TCP+CK PGD CPLV G C H+FH HCI+ WLDT+TS+GLCPMCRQ FQL 
Sbjct: 61  GICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQFQLN 120

Query: 111 KGVSINDSHIERFRELA 127
             + IN  ++E+F  + 
Sbjct: 121 SKLPINRPYLEKFESIT 137

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score =  129 bits (325), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 87/148 (58%), Gaps = 23/148 (15%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEED------------ 48
           M++EV  V  V +W+W IPK+    + G+ +         VH +  ED            
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQT-------VHMEKWEDIQNEDEDAENDE 53

Query: 49  ----VCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
               VCGICR  ++ TCP+C +PG GCP+V+G C HNFHVHCI +WL T TS+GLCP+CR
Sbjct: 54  EEYEVCGICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCR 113

Query: 105 QLFQLKKGVSINDSHIERFRELAIKRQQ 132
           Q FQL+  V IN  H + F++L +  +Q
Sbjct: 114 QGFQLRPNVLINKMHHDEFQKLLMSVRQ 141

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  106 bits (265), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (59%), Gaps = 6/127 (4%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGED-AIGDIHGMVHEDDEEDVCGICRASFNR 59
           MK+EV++V+ VF WSW I     T E+   ++    +      +DD+++VCGICRA +N 
Sbjct: 1   MKLEVREVYPVFEWSWDI-----TSETEQQQNHEPEEQPEDDDDDDDDEVCGICRAGYNA 55

Query: 60  TCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSH 119
            CP+C  PG  CP+V+G CQH FHVHC+  WL T+ +RG CPMCRQ F L     +N   
Sbjct: 56  VCPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGA 115

Query: 120 IERFREL 126
                +L
Sbjct: 116 TVTLPQL 122

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 15/79 (18%)

Query: 45  DEEDVCGICRASFNRTCPNCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPM 102
           +++++C ICR         CKF  D  PL+I    C+H F + CI  WL  ++S   CP+
Sbjct: 110 NKDEICSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSS---CPI 157

Query: 103 CRQLFQLKKGVSINDSHIE 121
           CR    L+K   I+DS +E
Sbjct: 158 CRNDV-LEKKFKIDDSQVE 175

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPGD-----GCPLVIGECQHNFHVHCIYEWLDTSTSRG 98
           D + D C ICR      C NC+          C    GEC H FH+HCI +W+    SR 
Sbjct: 38  DIDVDNCAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIK---SRN 94

Query: 99  LCPMCRQLFQLKK 111
           +CP+  + ++L +
Sbjct: 95  VCPLDNKPWKLAR 107

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKF-----PGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+      P + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 50  DNCAICRNHIMEPCIECQPKAMTDPDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 106

Query: 103 CRQLFQLKK 111
             Q +QL +
Sbjct: 107 DNQPWQLAR 115

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 43/115 (37%), Gaps = 35/115 (30%)

Query: 2   KVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTC 61
           + EVKK   V  WSW I      +E+                      C ICR      C
Sbjct: 23  RFEVKKWTAVAFWSWDI-----AVEN----------------------CAICRNHIMEPC 55

Query: 62  PNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKK 111
             C+        + C    G C H FH+HCI +WL T   R  CP+  Q +Q  K
Sbjct: 56  IQCQPTAMTDTDNECVAAWGACNHAFHLHCINKWLQT---RNACPLDNQTWQFAK 107

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 50  CGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C ICR      C  C+        + C    G C H FH+HCI +WL T   R  CP+  
Sbjct: 72  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDN 128

Query: 105 QLFQLKK 111
           Q +Q  K
Sbjct: 129 QPWQFAK 135

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 44.7 bits (104), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 42/115 (36%), Gaps = 35/115 (30%)

Query: 2   KVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTC 61
           K E+KK   V  WSW I                             D C ICR      C
Sbjct: 22  KFEIKKWTAVAFWSWDIAV---------------------------DNCAICRNHIMEPC 54

Query: 62  PNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKK 111
             C+        + C    G C H FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 55  IECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 106

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTC----PNCKFPGDG-CPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C    PN     D  C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 39  DNCAICRNHIMEPCIECQPNAMTETDNECVAAWGTCNHAFHLHCINKWIKT---RDACPL 95

Query: 103 CRQLFQLKK 111
             Q +QL +
Sbjct: 96  DNQPWQLAR 104

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+        + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 53  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 109

Query: 103 CRQLFQLKK 111
             Q +QL +
Sbjct: 110 DNQPWQLAR 118

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+        + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 53  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 109

Query: 103 CRQLFQLKK 111
             Q +QL +
Sbjct: 110 DNQPWQLAR 118

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+        + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 54  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 110

Query: 103 CRQLFQLKK 111
             Q +QL +
Sbjct: 111 DNQPWQLAR 119

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+        + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 53  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 109

Query: 103 CRQLFQLKK 111
             Q +QL +
Sbjct: 110 DNQPWQLAR 118

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 42/115 (36%), Gaps = 35/115 (30%)

Query: 2   KVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTC 61
           K EVKK   V  WSW I      +E+                      C ICR      C
Sbjct: 24  KFEVKKWTAVAFWSWDI-----AVEN----------------------CAICRNHIMEPC 56

Query: 62  PNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKK 111
             C+        + C    G C H FH+HCI +WL T   R  CP+  Q +   K
Sbjct: 57  IQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDNQPWSFAK 108

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+        + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 55  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIQT---RDACPL 111

Query: 103 CRQLFQLKK 111
             Q +QL +
Sbjct: 112 DNQPWQLAR 120

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+        + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 46  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGACGHAFHLHCINKWIKT---RDACPL 102

Query: 103 CRQLFQLKK 111
             Q +QL +
Sbjct: 103 DNQPWQLAR 111

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 50  CGICRASFNRTC----PNCKFPGDG-CPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C ICR      C    PN     D  C    G C H FH+HCI +WL T   R  CP+  
Sbjct: 48  CAICRNHIMEPCIQCQPNAMTDTDNECVAAWGTCNHAFHLHCINKWLLT---RNACPLDN 104

Query: 105 QLFQLKK 111
           + +Q  K
Sbjct: 105 KTWQFAK 111

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 42/115 (36%), Gaps = 35/115 (30%)

Query: 2   KVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTC 61
           K E+KK   V  WSW I                             D C ICR      C
Sbjct: 29  KFEIKKWTAVAFWSWDI---------------------------AVDNCAICRNHIMEPC 61

Query: 62  PNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKK 111
             C+        + C    G C H FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 62  IECQPMAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 113

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 8/73 (10%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRG 98
           D   D C ICR      C  C+          C    G C H FH+HCI +W+ T   R 
Sbjct: 50  DIAVDNCAICRNHIMEPCIECQPKAMTDTDTDCVAAWGTCNHAFHLHCINKWIKT---RE 106

Query: 99  LCPMCRQLFQLKK 111
            CP+  Q +QL +
Sbjct: 107 ACPLDNQPWQLAR 119

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 42.0 bits (97), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRG 98
           D   D C ICR      C  C+        + C +    C H FH+HCI +W+ T   R 
Sbjct: 39  DIAVDNCAICRNHIMEPCIECQPMAMTETDNECVVAWAACNHAFHLHCINKWIKT---RD 95

Query: 99  LCPMCRQLFQLKK 111
            CP+  Q +QL +
Sbjct: 96  ACPLDNQPWQLAR 108

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 41.6 bits (96), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+        + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 34  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPL 90

Query: 103 CRQLFQLKK 111
             Q + L +
Sbjct: 91  DNQPWHLAR 99

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 16/99 (16%)

Query: 26  ESGLGEDAIGDIHGMVHED-DEEDVCGICRASFNRTCPNCKFPGDGCPLV--IGECQHNF 82
           + G+ E  I  +  + +     ED C IC+         C F  D  PLV  +  C H F
Sbjct: 46  QKGMSETYIDSLPRVPNSKLKAEDTCAICQ---------CNFLDDPYPLVAKVPRCNHKF 96

Query: 83  HVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHIE 121
            + C+  WL  + +   CPMCR   + KK V I+ S  E
Sbjct: 97  DLECLSIWLQNNHT---CPMCRDDLRSKK-VEIDTSQCE 131

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 48  DVCGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           D C ICR      C  C+        + C    G C H FH+HCI +W+ T   R  CP+
Sbjct: 50  DNCAICRNHIMEPCIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPL 106

Query: 103 CRQLFQLKK 111
             Q + L +
Sbjct: 107 DNQPWHLAR 115

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 50  CGICRASFNRTCPNCKFPG-----DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C ICR      C  C+        + C    G C H FH+HCI +WL T   R  CP+  
Sbjct: 42  CAICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLT---RNACPLDN 98

Query: 105 QLFQLKK 111
           + +Q  K
Sbjct: 99  KTWQFAK 105

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC ++ +    + K P   CP     C + FH  C+Y+W   S++   CP+CR    L
Sbjct: 1537 CAICYSTLHAV--DRKLPTKVCP----TCNNKFHGSCLYKWF-RSSNNNTCPLCRSEIAL 1589

Query: 110  KK 111
            ++
Sbjct: 1590 RR 1591

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC    +    + K P   CP     C + FH  C+Y+W   S+    CP+CR  F L
Sbjct: 1464 CAICYYVLHAI--DRKLPTKVCP----TCNNRFHGACLYKWF-KSSGNNTCPLCRGEFNL 1516

Query: 110  KK 111
            +K
Sbjct: 1517 RK 1518

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CP+CR    L
Sbjct: 1537 CAICYSVLHAV--DRKLPTKTCP----TCKNKFHGACLYKWF-KSSGNNTCPLCRSEIAL 1589

Query: 110  KK 111
            ++
Sbjct: 1590 RR 1591

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CPMCR    +
Sbjct: 1517 CAICYSILHAV--DRKLPTKTCP----TCRNKFHGACLYKWF-RSSGNNTCPMCRSEIAI 1569

Query: 110  KK 111
            ++
Sbjct: 1570 RR 1571

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 43  EDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPM 102
           E  E D+C +C   F    P+ +   DG  + I  C H  H+ C+  W+  S +   CP+
Sbjct: 346 ESGEIDICIVCMEDF---LPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPT---CPI 399

Query: 103 CR 104
           CR
Sbjct: 400 CR 401

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1506 CAICYSILHAI--DRKLPSKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRSEIPF 1558

Query: 110  KK 111
            +K
Sbjct: 1559 RK 1560

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 37/79 (46%), Gaps = 15/79 (18%)

Query: 46  EEDVCGICRASFNRTCPNCKFPGDGCPLV--IGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
           E+D C IC       C  C +  D  PLV  +  C H F + CI  WL  STS   CP+C
Sbjct: 99  EDDSCPIC-------C--CTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTS---CPLC 146

Query: 104 R-QLFQLKKGVSINDSHIE 121
           R  +   K G+  +   +E
Sbjct: 147 RDDVMSHKPGIDTSQVELE 165

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 40.8 bits (94), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
            C IC +  +    + K P   CP     C + FH  C+Y+W   S+    CPMCR
Sbjct: 1503 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWF-RSSGNNTCPMCR 1550

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 39/98 (39%), Gaps = 19/98 (19%)

Query: 15  SWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEE---DVCGICRASFNRTCPNCKFPGDGC 71
           SW +PK      +    +A  ++  ++   DE    D C +C +             +G 
Sbjct: 313 SWKLPK------TQFSTNAFKNVKKVLFSGDEPNATDNCSLCLSKIT----------EGK 356

Query: 72  PLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
           P+ I  C H++H  C+ + +        CP C+  F L
Sbjct: 357 PIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDL 394

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEIPF 1557

Query: 110  KK 111
            ++
Sbjct: 1558 RR 1559

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1508 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEIPF 1560

Query: 110  KK 111
            ++
Sbjct: 1561 RR 1562

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1510 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEIPF 1562

Query: 110  KK 111
            ++
Sbjct: 1563 RR 1564

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWF-RSSGNNTCPLCRSEIPF 1557

Query: 110  KK 111
            +K
Sbjct: 1558 RK 1559

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1512 CAICYSILHAV--DRKLPSKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRSEIPF 1564

Query: 110  KK 111
            ++
Sbjct: 1565 RR 1566

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1507 CAICYSILHAV--DRKLPNKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRNEIPF 1559

Query: 110  KK 111
            ++
Sbjct: 1560 RR 1561

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 40.0 bits (92), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C++ FH  C+Y+W   S+    CP+CR    L
Sbjct: 1510 CAICYSILHAV--DRKLPTKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEIPL 1562

Query: 110  KK 111
             +
Sbjct: 1563 HR 1564

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   D   L+   CQH FH  C+ +W D     G CP+CR
Sbjct: 211 TCPVCLERMDSDTTGLITTACQHTFHCQCLDKWKD-----GRCPVCR 252

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C + +H  C+Y+W   S+    CPMCR     
Sbjct: 1514 CAICYSILHAV--DRKLPSKTCP----TCNNKYHGACLYKWF-RSSGNNTCPMCRSEIPF 1566

Query: 110  KK 111
            ++
Sbjct: 1567 RR 1568

>Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {ON}
           complement(68737..72273) [3537 nt, 1179 aa]
          Length = 1178

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 61  CPNCKF-PGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQLFQLKKGVSIN 116
           CP C   P D   ++  EC H F   C+ E+ D    + L   CP CRQ+    + + +N
Sbjct: 925 CPICTTEPIDANNIIFTECGHCFCESCLQEYFDFQVQKKLETKCPNCRQIISTNRVLKLN 984

Query: 117 DSHIE 121
              +E
Sbjct: 985 HDTVE 989

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 12/79 (15%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
            DEE+ C IC+  FN    N +  G         C H FH HCI  W+  ++    CP+C
Sbjct: 104 SDEEESCVICQEQFNEL-NNIRVLG---------CSHIFHSHCIDRWICRNS--ACCPLC 151

Query: 104 RQLFQLKKGVSINDSHIER 122
           ++ + L  G     ++IE+
Sbjct: 152 KRSYSLPVGSCHVIAYIEK 170

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
            C IC +  +    + K P   CP     C + FH  C+Y+W   S+    CP+CR
Sbjct: 1501 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGSCLYKWF-RSSGNNTCPLCR 1548

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 14/60 (23%)

Query: 47  EDVCGICRASFNRTCPNCKFPGDGCPLVIG--ECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           +D C IC       C  C +  D  PLV+    C H F + CI  WL  S++   CPMCR
Sbjct: 87  DDTCAIC-------C--CVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSST---CPMCR 134

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 58  NRTCP--NCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           N  CP   CKF  D  PL++    C H F + CI  WL  S +   CP+CR
Sbjct: 46  NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT---CPLCR 93

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 39.3 bits (90), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1496 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWF-RSSGNNTCPLCRSEIPF 1548

Query: 110  KK 111
            ++
Sbjct: 1549 RR 1550

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 38.9 bits (89), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1520 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWF-RSSGNNTCPLCRSEIPF 1572

Query: 110  KK 111
            ++
Sbjct: 1573 RR 1574

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 38.9 bits (89), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 9/61 (14%)

Query: 44   DDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
            D EE  C IC +  +    + K P   CP     C + FH  C+Y+W   S+    CP+C
Sbjct: 1488 DFEE--CAICYSILHVV--DRKLPSKVCP----TCSNRFHGACLYKWF-KSSGNNTCPLC 1538

Query: 104  R 104
            R
Sbjct: 1539 R 1539

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_8.288
            YDR128W
          Length = 1120

 Score = 38.5 bits (88), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 8/62 (12%)

Query: 54   RASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCP-----MCRQLFQ 108
            ++  +R+C  C     G   + G CQH  H  C  EW    T+ G CP     +C +++ 
Sbjct: 1062 KSHTHRSCNYCNLKVKGTAFICGSCQHILHSSCAKEWW---TTGGECPAGCGCICPEMYD 1118

Query: 109  LK 110
            L+
Sbjct: 1119 LE 1120

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 38.5 bits (88), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   CP     C + FH  C+Y+W  +S +   CP+CR     
Sbjct: 1493 CAICYSILHPV--DRKLPTKVCP----TCNNRFHGACLYKWFRSSGNNS-CPLCRSEIPF 1545

Query: 110  KK 111
            ++
Sbjct: 1546 RR 1547

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 6/61 (9%)

Query: 64  CKFPGDGCPLV--IGECQHNFHVHCIYEWLDTSTSRGLCPMCR-QLFQLKKGVSINDSHI 120
           CKF  D  PLV  +  C H F + CI  WL  S +   CP+CR  +   K  + ++ + +
Sbjct: 109 CKFLEDKYPLVAELPHCGHRFDLECISVWLSKSDT---CPLCRDSVLSHKTDIDVSKTEM 165

Query: 121 E 121
           E
Sbjct: 166 E 166

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 60  TCPNC--KFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVS- 114
           TCP C   F  D  PLV+    C H F   C+  WL  +T+   CPMCR     KK +  
Sbjct: 103 TCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWLTKNTT---CPMCRDDVTHKKELPE 159

Query: 115 INDSHIE 121
           ++ S +E
Sbjct: 160 LDTSKVE 166

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 20/113 (17%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           M+VE+ +       SW +  NA   E+      I ++  M    ++E+ C IC +   R 
Sbjct: 390 MRVELNR-------SWKLKANAFNKEA---LQRIKNLQMMTTGTEQEEDCSICLSKI-RP 438

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGV 113
           C           + I  C H++H HCI   +  S  + +CP CR    L+  +
Sbjct: 439 CQA---------IFISPCAHSWHFHCIRRLVMLSYPQFVCPNCRSACDLEAAL 482

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 36.2 bits (82), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 44/106 (41%), Gaps = 18/106 (16%)

Query: 21  NAGTIESGLGEDAIGDIHGMVHEDDEE---DVCGICRASFNRTCPNCKFPGDGCPLV--I 75
           N  + E G  E  I  +  +   D ++   D C IC          C +  D  PL+  +
Sbjct: 2   NDNSSEKGCSESFISSLPRLKLSDLKDPINDSCSICC---------CTYADDKYPLISKL 52

Query: 76  GECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHIE 121
             C HNF   C+  WL   +    CPMCR      K V I+ S++E
Sbjct: 53  PHCGHNFDYECLSIWL---SKNKTCPMCRDDITSHKEV-IDTSNVE 94

>TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON}
           Anc_7.416 YER116C
          Length = 208

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 17/119 (14%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHED--DEEDVCGIC-RASFNRTCPNCKFPGDGCPLV 74
           IP +   IE+    D   +I G  +ED  +E  V     +A  +  CP C  P +    V
Sbjct: 96  IPSDEEVIEAI---DLEAEILGQKNEDSGNERSVTPAPHKAVRDYQCPICFDPPENS--V 150

Query: 75  IGECQHNFHVHCIYEWLDTS---TSRGLCPMCRQLFQLKKGVSINDSHIERFRELAIKR 130
           I  C H F V C+++ L++S      GLC +CR      K V+I D  + + ++  +++
Sbjct: 151 ITPCGHTFCVSCLFQMLNSSRGPKKNGLCALCR------KSVAIRDIKMIKLKKKRVRK 203

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   D   L+   CQH FH  C+ +W       G CP+CR
Sbjct: 234 TCPVCLERMDSDTTGLITTACQHTFHCQCLDQW-----KGGRCPVCR 275

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
           YHR115C (REAL)
          Length = 269

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 21/105 (20%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MK+E+ K       SW +  NA   E+    + I ++  +    ++ED C IC    N+ 
Sbjct: 142 MKIELNK-------SWKLKANAFNKEA---LNRIKNLQKLTTGLEQED-CSIC---LNKI 187

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
            P C+       + I  C H++H HC+   +  S  + +CP CR 
Sbjct: 188 KP-CQ------AIFISPCAHSWHFHCVRRLVILSYPQFMCPNCRS 225

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 14/68 (20%)

Query: 46  EEDVCGICRASFNRTCPNCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMC 103
           E D C IC          C +  D  PLV+    C H F + C+  WL  ST+   CPMC
Sbjct: 86  EGDNCAIC---------CCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---CPMC 133

Query: 104 RQLFQLKK 111
           R    ++K
Sbjct: 134 RSDVLVRK 141

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 57  FNRTCPNC-KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC----RQLFQLKK 111
            ++ CP C     D    +I  CQH FH+ CI +W  +  S   CP C    R+L  +  
Sbjct: 5   VSKECPICWDSMADNVAKLIP-CQHEFHLSCIRKWYHSRISDRTCPNCRVEIRELIDMDH 63

Query: 112 GVSIN 116
            V+IN
Sbjct: 64  NVNIN 68

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 14/76 (18%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
           D+C IC  +F           D  PLVI    C H F + CI  WL   +S   CP+CR 
Sbjct: 85  DLCSICFENFRE---------DEYPLVIELPHCSHKFDLQCISVWL---SSNSTCPVCRD 132

Query: 106 LFQLKKGVSINDSHIE 121
                  + I+ +  E
Sbjct: 133 KVNHNAKLDIDTTEAE 148

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 21/105 (20%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MK+E+ K       SW +  NA   E+    + I ++  +    ++ED C IC    N+ 
Sbjct: 284 MKIELNK-------SWKLKANAFNKEA---LNRIKNLQKLTTGLEQED-CSIC---LNKI 329

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
            P C+       + I  C H++H HC+   +  S  + +CP CR 
Sbjct: 330 KP-CQ------AIFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRS 367

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   D   L+   CQH FH  C+ +W ++      CP+CR
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 274

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 37.4 bits (85), Expect = 0.012,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 21/104 (20%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           M+VE+ +       SW    NA   E+      I +I  M    +EED C IC +   + 
Sbjct: 455 MRVEINR-------SWKRRANAFNKEA---LQRIKNIQRMTMGLEEED-CSICLSKI-KP 502

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C           + I  C H++H  CI   + TS  + +CP CR
Sbjct: 503 CQ---------AMFISPCSHSWHFQCIRRLVMTSYPQFVCPNCR 537

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 11/80 (13%)

Query: 29  LGEDAIGDIHGMVHE--DDEEDVCGICRASFNRTCPNC--KFPGDGCPLVIGECQHNFHV 84
           L ED   D   ++H+   +E    GI R     +CP C  +   D   L+   CQH FH 
Sbjct: 205 LPEDCKSDFPYLLHDPFTNELTTKGIDREF--PSCPVCLERMDSDITGLITIPCQHTFHC 262

Query: 85  HCIYEWLDTSTSRGLCPMCR 104
            C+ +W D+      CP+CR
Sbjct: 263 QCLDKWKDSR-----CPVCR 277

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 37.4 bits (85), Expect = 0.014,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 45/110 (40%), Gaps = 18/110 (16%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           M+VE+ K       SW    NA   E+      +  I     E +EED C IC +   + 
Sbjct: 410 MRVELNK-------SWKRKANAFNKEALKRIKHLQKISNGGVEQEEED-CSICLSKI-KP 460

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLK 110
           C           + I  C H++H HC+   +  S  + +CP CR    L+
Sbjct: 461 CQ---------AIFISPCSHSWHFHCVRRLVMLSYPQFVCPNCRSACDLE 501

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQL 106
           CQHNFH +CI +W  TS S   CP+CR++
Sbjct: 22  CQHNFHFNCIRQWHLTSKSLE-CPVCRRV 49

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 37.4 bits (85), Expect = 0.016,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
            C IC +  +    + K P   C      C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1490 CAICYSILHAV--DRKLPTKTC----STCKNKFHGACLYKWF-RSSGNNTCPLCRSEINF 1542

Query: 110  KK 111
            ++
Sbjct: 1543 RR 1544

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   D   L+   CQH FH  C+ +W ++      CP+CR
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 274

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 35.8 bits (81), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 66  FPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           +  DG PLV+    C H+F + C+  W   STS   CP+CR
Sbjct: 82  YLNDGYPLVVRLPHCGHDFDLECLSVWFSKSTS---CPLCR 119

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 45  DEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           D    C IC+  FN+    C         ++G C H FH +CI +W+    +   CP+C+
Sbjct: 115 DSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCK 162

Query: 105 QLFQLKK 111
           + + L +
Sbjct: 163 RSYSLPR 169

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 35.0 bits (79), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 8/49 (16%)

Query: 78  CQHNFHVHCIYEWLDTSTS---RGLCPMCRQ-----LFQLKKGVSINDS 118
           C H FH  CI +W  T+T    R LCP CR+     L Q   G     S
Sbjct: 29  CHHKFHSDCIRKWHTTTTGEIRRPLCPFCREQSETLLIQYDHGAPAGSS 77

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 21/105 (20%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MK+E+ K       SW +  NA   E       I ++  +    ++ED C IC    N+ 
Sbjct: 289 MKIELNK-------SWKLKANAFNKE---ALSRIKNLQKLTTGLEQED-CSIC---LNKI 334

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
            P C+       + I  C H++H HC+   +  S  + +CP CR 
Sbjct: 335 KP-CQA------IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRS 372

>Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR231W
           (REAL)
          Length = 1028

 Score = 36.6 bits (83), Expect = 0.021,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDT-STSRGL--CPMC 103
           N+TC  C    D  P+V  +C H +H HC+ E  DT  + R L  CP C
Sbjct: 923 NQTCFMCNLTLD-IPVVFFKCGHTYHQHCLNEEEDTLESERKLFKCPKC 970

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 36.6 bits (83), Expect = 0.024,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 73  LVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQLFQLKKGVSIND 117
           ++  EC H F  HC+ E++D  T + L   CP CR+    K+ +++ +
Sbjct: 888 VIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLTLKE 935

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   +   LV   CQH FH  C+ +W ++      CP+CR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 12/65 (18%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSIND 117
           TCP C  +   +   L    CQH FH  C+ +W D+      CP+CR       G+ +  
Sbjct: 246 TCPVCLERLDSEVTGLATIPCQHTFHCQCLNKWKDSR-----CPVCRY-----SGLKVTK 295

Query: 118 SHIER 122
           S + R
Sbjct: 296 SSLLR 300

>YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}
           PEP5Component of CORVET tethering complex; peripheral
           vacuolar membrane protein required for protein
           trafficking and vacuole biogenesis; interacts with Pep7p
          Length = 1029

 Score = 36.6 bits (83), Expect = 0.025,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDT-STSRGL--CPMC 103
           N+TC  C+   D  P+V  +C H +H HC+ E  DT  + R L  CP C
Sbjct: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   +   LV   CQH FH  C+ +W ++      CP+CR
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   +   LV   CQH FH  C+ +W ++      CP+CR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   +   LV   CQH FH  C+ +W ++      CP+CR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   +   L+   CQH FH  C+ +W D+      CP+CR
Sbjct: 267 TCPVCLERMDSETTGLITIPCQHTFHCSCLDKWNDSR-----CPVCR 308

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 35.8 bits (81), Expect = 0.036,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 49/121 (40%), Gaps = 21/121 (17%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           M+VE+ +       SW +  NA   E+      +  +  M    DEED C IC +   + 
Sbjct: 477 MRVELNR-------SWKLKANAFNKEA---LQKMRKLQKMTTGSDEED-CSICLSKI-KP 524

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120
           C           + I  C H +H  C+   +  +  + +CP CR    L+  +  +DS  
Sbjct: 525 CQ---------AIFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRSTCDLEASLDNSDSES 575

Query: 121 E 121
           E
Sbjct: 576 E 576

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 35.8 bits (81), Expect = 0.036,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 46  EEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           EE+ C IC ++  + C           + I  C H++H HCI   +  S  + +CP CR
Sbjct: 498 EEEDCSICLSAI-KPCQ---------AIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCR 546

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   +   L+   CQH FH  C+ +W ++      CP+CR
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 287

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 35.0 bits (79), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 15/76 (19%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
           D C IC + +N          D  PLV+    C H F + C+  WL  +++   CP+CR 
Sbjct: 84  DECSICCSKYNE---------DDYPLVVELPHCSHRFDLECLTPWLLKNST---CPLCRD 131

Query: 106 LFQLKKGVSINDSHIE 121
              ++K  SI+ S++E
Sbjct: 132 DV-MEKVDSIDVSNVE 146

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 34.7 bits (78), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 15/77 (19%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLVIG--ECQHNFHVHCIYEWLDTSTSRGLCPMCR- 104
           D C IC          C +  D  PLV+    C H F + C+  WL  S +   CP+CR 
Sbjct: 81  DACSIC---------CCGYLDDTHPLVVKLPHCSHRFDLECVAVWLSKSRT---CPLCRD 128

Query: 105 QLFQLKKGVSINDSHIE 121
            +   K  V I++  +E
Sbjct: 129 DVLSHKPKVDISNVELE 145

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
            {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128W Hypothetical ORF
          Length = 1101

 Score = 35.8 bits (81), Expect = 0.046,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 57   FNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTST--SRGLCPMCRQLFQL 109
            F+R C  C+   DG   V G CQH  H  C   W + S   + G    C + F +
Sbjct: 1046 FSRNCNYCELRVDGRGSVCGNCQHILHAECAKVWWEVSNECASGCGCACVEFFDV 1100

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
           DMA1Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma2p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 21/104 (20%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           MK+E+ K       SW +  NA   E+      I ++  +    ++ED C IC    N+ 
Sbjct: 289 MKIELNK-------SWKLKANAFNKEA---LSRIKNLQKLTTGLEQED-CSIC---LNKI 334

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
            P C+       + I  C H++H HC+   +  +  + +CP CR
Sbjct: 335 KP-CQ------AIFISPCAHSWHFHCVRRLVIMNYPQFMCPNCR 371

>Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 38/85 (44%), Gaps = 12/85 (14%)

Query: 59  RTCPNCKFPGD------GCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR-QLFQLKK 111
           + CP C F GD      GC  V   C+H FH++CI EW   S     CP+CR +   LK 
Sbjct: 2   KECPIC-FEGDQDGEQFGCLEV---CRHEFHLNCIREWHKYSIDLK-CPICRTESSHLKV 56

Query: 112 GVSINDSHIERFRELAIKRQQEQNE 136
           G   N   ++      IK   E  E
Sbjct: 57  GEGQNAVSVDLKMGFMIKHALEHAE 81

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 61  CPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           CP C  K   +   LV   CQH FH  C+ +W       G CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW-----KNGNCPVCR 255

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 34.7 bits (78), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 52  ICRASFNRTCPNCKFPGDGCPLV--IGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQL 109
           I  A  N +   CK+  D  PL+  +  C H+F   CI  WL  + +   CP+CR     
Sbjct: 99  IKAAHLNCSICYCKYTDDDYPLIAQLPHCGHHFDFECISIWLSKNET---CPICRDNLTS 155

Query: 110 KKGVSINDSHIE 121
            K V I+ S++E
Sbjct: 156 HKEV-IDTSNVE 166

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   +   L+   CQH FH  C+ +W ++      CP+CR
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSQ-----CPVCR 281

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 34.3 bits (77), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 14/76 (18%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLV--IGECQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
           D C IC   F R      F  D  PL+  +  C H F + CI  WL    +   CPMCR 
Sbjct: 90  DTCSIC---FER------FGNDNYPLLAQLPHCGHIFDLQCISMWLSNQVT---CPMCRD 137

Query: 106 LFQLKKGVSINDSHIE 121
           +    K   ++ S  E
Sbjct: 138 VVNGHKVQDLDTSKAE 153

>Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 35.4 bits (80), Expect = 0.063,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDT-STSRGL--CPMC 103
           N+TC  C    D  P+V  +C H +H HC+ E  DT    R L  CP C
Sbjct: 926 NQTCFMCNLTLD-VPVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC 973

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 33.5 bits (75), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 64  CKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCR-QLFQLKKGVSINDSHI 120
           C +  D  PLV+    C H F + C+  WL  S +   CP+CR  +   K  V ++   +
Sbjct: 40  CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---CPLCRDDVLSHKPNVDVSQVEM 96

Query: 121 E 121
           E
Sbjct: 97  E 97

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 35.4 bits (80), Expect = 0.068,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 25/105 (23%)

Query: 45   DEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
            ++E  C IC  +  +          GC L   +C H F   CIY+WL T   R +CP+C+
Sbjct: 1262 NKEFQCTICLDAITK----------GCML---KCGHFFCEDCIYDWLQT---RTICPICK 1305

Query: 105  QL--------FQLKKGVSINDSHIERFRELAIKRQQEQNEFESNL 141
                      F  K G    D++ ++  E   + ++EQ E   +L
Sbjct: 1306 HKASLDGNYNFTFKNGPLKTDAN-KQMNEKENETKKEQPETSPDL 1349

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 34.3 bits (77), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           D C IC  ++           D  PLV+    C H F + C+  WL  ST+   CP+CR
Sbjct: 77  DNCSICYTNYLE---------DKYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 123

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 34.3 bits (77), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           D C IC  ++           D  PLV+    C H F + C+  WL  ST+   CP+CR
Sbjct: 112 DNCSICYTNYLE---------DEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 158

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 34.3 bits (77), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           D C IC  ++           D  PLV+    C H F + C+  WL  ST+   CP+CR
Sbjct: 107 DNCSICYTNYLE---------DEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 153

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 34.7 bits (78), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 21/97 (21%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQ-- 105
           ++CGIC  S N T      P          C+H +HV CI +W   S     CP CR+  
Sbjct: 3   EICGICLESMNETDQGELLP----------CEHRYHVSCIRKWHLYSNDFK-CPTCRKES 51

Query: 106 --LFQLKKGVSI------NDSHIERFRELAIKRQQEQ 134
             L +    + I      N S IE+F +L +    EQ
Sbjct: 52  KSLRRKHDDIEIDLKYWCNVSLIEQFAKLRLLNDDEQ 88

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 15/70 (21%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC--------RQLFQL 109
           +CP C  +       L+   CQH FH  C+ +W ++      CP+C        R L   
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKWKNSK-----CPICRFSTLRISRDLVIN 336

Query: 110 KKGVSINDSH 119
           KK V+I DS+
Sbjct: 337 KKQVNIKDSN 346

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 34.7 bits (78), Expect = 0.092,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 11/63 (17%)

Query: 42  HEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCP 101
           H +++ED C IC +   + C           + I  C H++H HCI   +  +  + +CP
Sbjct: 464 HANEDED-CSICLSKI-KACQ---------AIFISPCAHSWHFHCIRRLVMLTYPQFVCP 512

Query: 102 MCR 104
            CR
Sbjct: 513 NCR 515

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
            similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 34.7 bits (78), Expect = 0.094,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 52   ICRASF-NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEW--LDTSTSRGLCPMCRQLFQ 108
            I ++SF ++ C  C        LV G CQH  H  C  EW  LD     G    C ++F 
Sbjct: 1071 IKKSSFTSKNCTYCGLKTKRRILVCGNCQHILHASCAVEWWQLDEECPSGCGCYCPKMFN 1130

Query: 109  L 109
            +
Sbjct: 1131 V 1131

>Ecym_4325 Chr4 complement(699162..701096) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii ADL064W
          Length = 644

 Score = 34.7 bits (78), Expect = 0.095,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 13/99 (13%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
           DDEED C +C  + + T  N K     CP     CQ      C           G CP C
Sbjct: 27  DDEEDYCPLCMEALDITDKNFK----PCPCGYQICQ-----FCYNNIRQNPELNGRCPAC 77

Query: 104 RQLFQLKK----GVSINDSHIERFRELAIKRQQEQNEFE 138
           R+ +  +      +S  +  +ER ++   +R+++Q E E
Sbjct: 78  RRKYDDESVEYIVLSPEELKMERAKQARKERERKQREKE 116

>ZYRO0B03938g Chr2 complement(327333..327884) [552 bp, 183 aa] {ON}
           some similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 183

 Score = 33.9 bits (76), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 11/109 (10%)

Query: 25  IESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHV 84
           +E    E  + D+    +E +        +A     CP C  P D    V+  C H F V
Sbjct: 82  LEDEAAEQQVKDVPREENEQENPPKPPANKAVREYHCPICFEPPDTA--VMTPCGHIFCV 139

Query: 85  HCIYEWLDTSTS---RGLCPMCRQLFQLKKGVSINDSHIERFRELAIKR 130
            C+++ +++S +    G C +CR   +LK      D  +   R+L +K+
Sbjct: 140 ACLFQMVNSSRTHRKSGNCALCRSEVKLK------DIRLVVLRKLRVKK 182

>NDAI0C04600 Chr3 complement(1049919..1051412) [1494 bp, 497 aa]
           {ON} Anc_5.399 YDR348C
          Length = 497

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 42/115 (36%), Gaps = 12/115 (10%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGE 77
           +PKN  TI+     D      G  H D   D C   R   N+  P   FP DG    IG 
Sbjct: 229 MPKNVDTIDK---MDVTALFGGSFHHDGPFDACTPHRNKNNKAAPVMAFPVDGPNSTIGG 285

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSIND---SHIERFRELAIK 129
                        +D    R        L++LK G S  D   ++I  F+++  K
Sbjct: 286 AS------SKQSAMDEVFGRDDVDDDNDLYKLKGGNSTKDAIRTNIGDFKQMDAK 334

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 48  DVCGICRASFNRTCPNCKFPGDGCPLVI--GECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           D C IC  ++           D  PLV+    C H F + C+  WL  ST+   CP+CR
Sbjct: 105 DNCSICYTNYLE---------DEYPLVVELPHCNHRFDLECLSVWLSRSTT---CPLCR 151

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 12/65 (18%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSIND 117
           TCP C  +   +   L    CQH FH  C+ +W D       CP+CR       G+ +  
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKWGDNR-----CPVCRY-----SGLKLTK 275

Query: 118 SHIER 122
           S + R
Sbjct: 276 SSLAR 280

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 34.3 bits (77), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 19/87 (21%)

Query: 71   CPLVIG--------ECQHNFHVHCIYEWLDTSTSRGLCPMCR------QL--FQLKKGVS 114
            CP+ +G         C H F  +CI+ WL  +++   CP+C+      QL  F+ K  ++
Sbjct: 1271 CPICLGLIHTGSMISCGHFFCNNCIFSWLKLNSN---CPLCKRDTTQSQLYNFKFKNEIT 1327

Query: 115  INDSHIERFRELAIKRQQEQNEFESNL 141
               ++ E   ++   ++      ESN+
Sbjct: 1328 EESTNNEELSDIRAPQKPNHPNIESNI 1354

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +       L+   CQH FH  C+ +W ++      CP+CR
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 275

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 34.3 bits (77), Expect = 0.16,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 26/90 (28%)

Query: 50  CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQL 106
           C IC A           P D    +  EC H+F   C++E++D    + L   CP CR  
Sbjct: 916 CSICTAE----------PIDLNKALFTECGHSFCEKCLFEYIDFQNGKKLCLKCPNCR-- 963

Query: 107 FQLKKGVSINDSHIERFRELAIKRQQEQNE 136
                     DS I+  R LA+ RQ+  +E
Sbjct: 964 ----------DS-IDGGRLLALGRQRSDSE 982

>NCAS0F03140 Chr6 complement(628522..629943) [1422 bp, 473 aa] {ON}
           Anc_5.399 YDR348C
          Length = 473

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 24/59 (40%), Gaps = 3/59 (5%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
           +PKN  TI+     D  G   G  H D   D C   R   N+  P   FP DG    IG
Sbjct: 221 MPKNVDTIDK---LDVTGLFGGSFHHDGPFDACTPHRNKGNKVAPVMAFPADGPNSTIG 276

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] {ON}
            Anc_8.288 YDR128W
          Length = 1178

 Score = 34.3 bits (77), Expect = 0.16,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 2/54 (3%)

Query: 59   RTCPNCKFPGDGCPLVIGECQHNFHVHCIYEW--LDTSTSRGLCPMCRQLFQLK 110
            + C  C  P D    + G CQH  H  C   W  +D+    G    C  +F L+
Sbjct: 1125 KNCVYCNHPADRSVFICGNCQHIMHPKCAQVWWKVDSECPSGCGCHCPDVFDLE 1178

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 22/66 (33%)

Query: 45  DEEDVCGICRASFNR------TCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRG 98
           +  D C ICR +++       TC             +  C H+FH  CI  WL  ++   
Sbjct: 205 NSSDECPICRIAYSDDFETEITC-------------LPNCSHHFHFECIKLWLQKNS--- 248

Query: 99  LCPMCR 104
           LCP+CR
Sbjct: 249 LCPLCR 254

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 33.9 bits (76), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 4/55 (7%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEW-LDTSTSR--GLCP 101
            C  C+   N +C  C+ P     +VI  C H  H  CI EW LD +     G CP
Sbjct: 1283 CDSCKKK-NTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCP 1336

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 33.9 bits (76), Expect = 0.20,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 17/74 (22%)

Query: 71   CPLVIGE--------CQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHIER 122
            CP+ +G+        C H F   CI+ WL    S   CPMC      K   SI + +  +
Sbjct: 1154 CPICLGKITMGAIIKCGHFFCRSCIHSWLKNHNS---CPMC------KTSTSIMEVYNFK 1204

Query: 123  FRELAIKRQQEQNE 136
            F+    +  + QNE
Sbjct: 1205 FQNDDAEVNEPQNE 1218

>ADL064W Chr4 (567687..569627) [1941 bp, 646 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER068W (MOT2)
          Length = 646

 Score = 33.9 bits (76), Expect = 0.20,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 41/99 (41%), Gaps = 13/99 (13%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
           DDEED C +C    + T  N K     CP     C +     C           G CP C
Sbjct: 27  DDEEDYCPLCMEPLDITDKNFK----PCP-----CGYQICQFCYNNIRQNPELNGRCPAC 77

Query: 104 RQLFQLKK----GVSINDSHIERFRELAIKRQQEQNEFE 138
           R+ +  +      +S  +  +ER ++   +R+++Q E E
Sbjct: 78  RRKYDDESVEYIVLSPEELKLERAKQARKERERKQREKE 116

>KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 279

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 53  CRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTS----RGLCPMCRQLFQ 108
            + + +  CP C  P +    ++ +C H F   C+Y  +++S       GLC +CR+  +
Sbjct: 204 TKKAADYVCPICMEPPEAA--LVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVK 261

Query: 109 LK 110
           L+
Sbjct: 262 LQ 263

>Smik_8.174 Chr8 complement(273775..274744,274864..274988) [1095 bp,
           365 aa] {ON} YHR097C (REAL)
          Length = 365

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 3/58 (5%)

Query: 19  PKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
           PKN  TI+     D  G   G  H D   D C   R   N+  P   FP DG    +G
Sbjct: 126 PKNVDTIDK---MDVTGLFGGSFHHDGPFDACTPQRNKNNKVAPVLAFPADGPNNTVG 180

>YHR097C Chr8 complement(297385..298360,298485..298609) [1101 bp,
           366 aa] {ON} Putative protein of unknown function; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and the nucleus
          Length = 366

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 3/58 (5%)

Query: 19  PKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
           PKN  TI+     D  G   G  H D   D C   R   N+  P   FP DG    +G
Sbjct: 127 PKNVDTIDK---MDVTGLFGGSFHHDGPFDACTPQRNKNNKVAPVLAFPADGPNNTVG 181

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  +   +   L+   CQH FH  C+ +W ++      CP+CR
Sbjct: 237 TCPVCLEQLDCETTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 278

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score = 33.5 bits (75), Expect = 0.24,   Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 42/109 (38%), Gaps = 38/109 (34%)

Query: 16  WHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRA-------------------- 55
           W I KN   ++  L   ++ D+     E+D +++C +C                      
Sbjct: 325 WKIYKNNKQLDDKLPTLSVNDV-----ENDNDNICIVCMDDLVPSLHGKEAVEMTQADID 379

Query: 56  SFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           S +++    K P          C H  H+ C+  W++ S +   CP+CR
Sbjct: 380 SISKSKRPKKLP----------CGHMLHLSCLKNWMERSQT---CPICR 415

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR-QLFQLKKGVSIN 116
            CP C  +   +   L+   CQH FH  C+  W ++      CP+CR   F+L +   + 
Sbjct: 170 ACPVCLERMDSETTGLITIPCQHTFHCQCLNRWKNSK-----CPVCRYSSFRLSRDTLMR 224

Query: 117 DS 118
            S
Sbjct: 225 TS 226

>KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8.761
           YMR231W
          Length = 1036

 Score = 33.5 bits (75), Expect = 0.27,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL--CPMC 103
           N+TC  CK P    P+V  +C H +H +C+ E   T  +  +  CP C
Sbjct: 933 NQTCFMCKLPMH-LPMVYFKCGHIYHQNCMDEEYSTEENELIFKCPKC 979

>Smik_4.612 Chr4 complement(1096510..1098006) [1497 bp, 498 aa] {ON}
           YDR348C (REAL)
          Length = 498

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
           IPKN  TI+     D  G   G  H D   D     R   N+  P   FP DG    IG
Sbjct: 230 IPKNVDTIDK---LDVTGLFGGSFHHDGPFDAVTPHRNKNNKAAPVLAFPADGPNSTIG 285

>KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1150

 Score = 33.5 bits (75), Expect = 0.28,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 58  NRTCPNCKF-PGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQLFQLKKGV 113
           N  C  C   P D   L++ +C H F   CI E++     + L   CP+CR++     G+
Sbjct: 891 NLECSICTTEPIDPHKLILTDCGHPFCDKCILEYITYQKEKKLDVKCPICREMLDDTSGM 950

Query: 114 SINDSHIER 122
                 +E+
Sbjct: 951 FCLKGEVEQ 959

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 5/43 (11%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR----QLFQLKKGVSIN 116
           CQH +H+ CI EW + S     CP CR    +L  ++  V+IN
Sbjct: 23  CQHEYHLECIREWHNHSQDFK-CPTCRVESNKLLDVENNVTIN 64

>Skud_8.158 Chr8 complement(271202..272174,272308..272432) [1098 bp,
           365 aa] {ON} YHR097C (REAL)
          Length = 365

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 3/58 (5%)

Query: 19  PKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
           PKN  TI+     D  G   G  H D   D C   R   N+  P   FP DG    +G
Sbjct: 126 PKNVDTIDK---MDVTGLFGGSFHHDGPFDACTPQRNKDNKVAPVLAFPADGPNNTVG 180

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 33.1 bits (74), Expect = 0.29,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 34/94 (36%), Gaps = 10/94 (10%)

Query: 16  WHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDV--CGICRASFN---RTCPNCKFPGDG 70
           W +PK++   E       +   H M H   E     C IC A F       P      D 
Sbjct: 663 WFLPKHSIPEEYSY-HRVVSLQHLMEHGGSENHTVDCAICMAEFPVYVEELPETH-QVDK 720

Query: 71  CPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
              +I  C H FH  C+  W+        CP+CR
Sbjct: 721 DSYMITPCDHMFHTSCLESWMSYKLQ---CPVCR 751

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
           {ON} some similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 445

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           V+ +C HN+   C+  W D++++   CP CR
Sbjct: 41  VMTQCGHNYCYDCLSSWFDSNSNELSCPQCR 71

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 33.1 bits (74), Expect = 0.32,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 9/51 (17%)

Query: 56   SFN-RTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
            SFN   C N  + G      I +C H F  HCI+ WL    ++ +CP+C++
Sbjct: 1148 SFNCPICLNTIYMGS-----IIKCGHFFCKHCIFSWL---KNKSVCPICKK 1190

>Suva_15.292 Chr15 complement(499758..500721,500843..500967) [1089
           bp, 362 aa] {ON} YHR097C (REAL)
          Length = 362

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 3/58 (5%)

Query: 19  PKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
           PKN  TI+     D  G   G  H D   D C   R   N+  P   FP DG    +G
Sbjct: 126 PKNVDTIDK---MDVTGLFGGSFHHDGPFDACTPQRNKDNKVAPVLAFPADGPNNTVG 180

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 33.1 bits (74), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 46  EEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           E D C IC +   + C           + I  C H++H HCI   +     + +CP CR
Sbjct: 765 EGDDCSICLSKI-KPCQ---------AIFISPCSHSWHFHCIRRLVMLQYPQFVCPNCR 813

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 33.1 bits (74), Expect = 0.35,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSR---GLCP 101
            C  C+   N  C  C+ P     +V+  C H  H  CI EW      R   G CP
Sbjct: 1278 CDSCKKR-NSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEWFLNEKERECPGGCP 1331

>SAKL0G07568g Chr7 (630838..631109,631353..632649) [1569 bp, 522 aa]
           {ON} similar to uniprot|Q66RD5 Saccharomyces cerevisiae
           YDR348C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cell
           periphery and bud neck potential Cdc28p substrate
          Length = 522

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 3/64 (4%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGE 77
           +PKN  TI+     D  G   G  H D   D C   R   N+  P   FP DG    I  
Sbjct: 263 VPKNVDTIDK---LDVTGLFGGAFHHDGPFDACTPHRNKNNKVAPVLAFPADGPNSSISG 319

Query: 78  CQHN 81
              N
Sbjct: 320 ATAN 323

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 46  EEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
           EE+ C IC ++  + C           + I  C H++H HCI   +  S  + +CP CR 
Sbjct: 409 EEEDCSICLSAI-KPCQ---------AIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRS 458

>KLTH0E09174g Chr5 (830858..834304) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1148

 Score = 33.1 bits (74), Expect = 0.38,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 73  LVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQLFQLKKGVSI-NDSH 119
           +V  EC H F   CI E++   + R     CP CRQ    KK +++ NDS+
Sbjct: 909 VVFTECGHTFCELCILEYIRFQSERKQEVKCPNCRQAIDSKKLLTLENDSN 959

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score = 32.7 bits (73), Expect = 0.39,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 25/61 (40%), Gaps = 6/61 (9%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
           DD + +C IC      T    K       L    C H  H  C+  W++ S +   CP+C
Sbjct: 314 DDTDSMCIICMDDMLPTTETTKMNRRAKML---PCGHMLHFGCLKSWMERSQT---CPIC 367

Query: 104 R 104
           R
Sbjct: 368 R 368

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%)

Query: 73  LVIGECQHNFHVHCIYEWLDTSTSRG-----LCPMCRQ 105
           +V+  CQH FH  C+ EW  +   RG     +CP+CR 
Sbjct: 180 IVMIPCQHYFHAGCLKEWF-SPQRRGKRRPLVCPLCRM 216

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 32.7 bits (73), Expect = 0.42,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 11/75 (14%)

Query: 38  HGMVHEDDEEDVCGICRASFNRTCPNCKFPGDG-------CPLVIGECQHNFHVHCIYEW 90
           +G+   ++   +  +  +S + T P    P +         P+ +  C+H F   C+YEW
Sbjct: 291 NGIAQFNETTQLTTVAPSSMDSTIPTSSTPDENKKHEYHNSPVQL-SCKHIFCRSCLYEW 349

Query: 91  LDTSTSRGLCPMCRQ 105
              S  +  CP+CR+
Sbjct: 350 ---SKLKNSCPLCRK 361

>Kwal_55.20318 s55 complement(347619..350318) [2700 bp, 899 aa] {ON}
           YMR231W (PEP5) - peripheral vaculor membrane protein;
           putative Zn-finger protein [contig 151] PARTIAL
          Length = 899

 Score = 32.7 bits (73), Expect = 0.43,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 10/87 (11%)

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRG----LCPMCRQLFQLKKGV 113
           N+ C  C    +  P+V  +C H +H  C+ E  + S  RG     CP C   F+  +G+
Sbjct: 797 NQNCNTCHTTLNA-PIVYFKCGHIYHQRCLNE--EESLERGSRFFKCPQCVIDFETSEGM 853

Query: 114 ---SINDSHIERFRELAIKRQQEQNEF 137
               I         +LA+K Q  ++ F
Sbjct: 854 KNAQIKAQMDADLLKLALKDQNNKDRF 880

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 13/81 (16%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGL-CPMCRQ------------LFQLKKGVSINDSHI 120
           V+  C HN+  +CI  WL+ + +  L CP CR             L  L+  + + D   
Sbjct: 5   VMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTIGAMPALNVSLLQTLESLIDVLDKGD 64

Query: 121 ERFRELAIKRQQEQNEFESNL 141
                L   +++  NE++S++
Sbjct: 65  PEVASLLAAKEESMNEYKSDV 85

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 32.7 bits (73), Expect = 0.45,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 14/60 (23%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKG-----------VSINDSHIERFREL 126
           C H F   CIY+W     S   CP+CRQ      G           V+ N++  ER R +
Sbjct: 257 CGHIFGRECIYKWSRLENS---CPLCRQKISESVGVQRAAQQDTDEVAANEAAFERIRRV 313

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%)

Query: 72  PLVIGECQHNFHVHCIYEWLDTSTSRGL-CPMCRQ 105
           P++ G C HN+   CI  WL+ ++S  L CP CR 
Sbjct: 48  PVMTG-CGHNYCYFCISNWLNNTSSTELNCPQCRS 81

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 32.7 bits (73), Expect = 0.48,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 27/73 (36%), Gaps = 14/73 (19%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKG-----------VSINDSHIERFREL 126
           C H F   CIY+W     S   CP+CR       G           V+ N++  ER R +
Sbjct: 256 CGHIFGRECIYKWSKLENS---CPLCRHKISESAGIQNTAQQDTDEVAANEAAFERIRRV 312

Query: 127 AIKRQQEQNEFES 139
                   N  E+
Sbjct: 313 LYDPAARNNNTEN 325

>TPHA0K00870 Chr11 complement(181868..183685) [1818 bp, 605 aa] {ON}
           Anc_7.249 YER068W
          Length = 605

 Score = 32.7 bits (73), Expect = 0.49,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 22/100 (22%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
           DDEED+C +C  + + T  N K     CP     C +     C           G CP C
Sbjct: 29  DDEEDLCPLCLEALDITDKNFK----PCP-----CGYQICQFCYNNIRQNEELNGRCPAC 79

Query: 104 RQLFQLKKGVSINDSHIERF----RELAIKRQ-QEQNEFE 138
           R+ +        +D ++E       EL ++R+ Q + E+E
Sbjct: 80  RRKY--------DDENVEYVILTSEELKMEREKQTRKEWE 111

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGL-CPMCRQLFQLKKGVSINDSHIERFRELAIKRQQ 132
           V+  C HN+   CI  WL ++ +  L CP CR    LK+  S+N S ++   E    R  
Sbjct: 5   VMTTCGHNYCYDCISNWLVSNNANELTCPQCRS--PLKEQPSLN-SALQNLLEFVFDRFA 61

Query: 133 EQN 135
           + N
Sbjct: 62  KDN 64

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 32.3 bits (72), Expect = 0.50,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 39/94 (41%), Gaps = 16/94 (17%)

Query: 16  WHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGIC-----RASFNRTCPNCKFPGDG 70
           W I +N   ++  L    +  +    +ED+   +C IC      ++  +T  N       
Sbjct: 317 WKIWRNNKQLDDSLLTVTVEQLQNSANEDN---ICIICMDELIHSTNQQTWKNKNKKPKR 373

Query: 71  CPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
            P     C H  H+ C+  W++ S +   CP+CR
Sbjct: 374 LP-----CGHILHLSCLKNWMERSQT---CPICR 399

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 21/104 (20%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60
           M+VE+ K       SW    NA   E+      + ++  +    +EED C IC    ++ 
Sbjct: 351 MRVELNK-------SWKRRANAFNKEA---LQRLKNLQKLTTGSEEED-CSIC---LSKI 396

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
            P C+       + I  C H++H  C+   + TS  + +CP CR
Sbjct: 397 KP-CQ------AIFISPCSHSWHYQCVRRLVMTSYPQFVCPNCR 433

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 73  LVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           + I  C H++H HCI   +  S  + +CP CR
Sbjct: 416 IFISPCSHSWHFHCIRRLVMVSYPQFVCPNCR 447

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 32.3 bits (72), Expect = 0.59,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 12/58 (20%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSI---------NDSHIERFREL 126
           C H F   C+Y+W     S   CP+CR       GV +         N++  ER R +
Sbjct: 275 CGHVFGRECLYKWSRLENS---CPLCRHKISESAGVPVQQDTDEVAANEAAFERIRRV 329

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
            Anc_8.288 YDR128W
          Length = 1159

 Score = 32.3 bits (72), Expect = 0.59,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 21/57 (36%), Gaps = 8/57 (14%)

Query: 59   RTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCP-----MCRQLFQLK 110
            R+C  C     G   + G CQH  H  C  +W         CP      C  LF ++
Sbjct: 1106 RSCSYCNLRVKGDAFICGNCQHVLHAKCARQWWTVGDE---CPSGCGCSCPNLFDVR 1159

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 32.3 bits (72), Expect = 0.61,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 36/89 (40%), Gaps = 6/89 (6%)

Query: 16  WHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVI 75
           W I +N   ++  L       I  M +  +E+++C IC      +     +         
Sbjct: 316 WKIWRNNKQLDDTL---ITVTIEQMQNSANEDNICIICMDELIHSANQQAWKNKNKKPKR 372

Query: 76  GECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
             C H  H+ C+  W++ S +   CP+CR
Sbjct: 373 LPCGHILHLSCLKNWMERSQT---CPICR 398

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 32.3 bits (72), Expect = 0.66,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 16/68 (23%)

Query: 71  CPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGV--SINDSHI-------- 120
           CP  +  C H F   CI++W     S   CP+CR      +G+  +INDS +        
Sbjct: 275 CPTEL-PCGHIFGRDCIFKWTKEHNS---CPICRSRIVEDEGLNHAINDSPVVMDEFDRQ 330

Query: 121 --ERFREL 126
             ER R+L
Sbjct: 331 SFERIRQL 338

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC----RQLFQLKKGV 113
           +CP C        C LV  EC H +H +CI  W   S +   CP C    R L  +++ V
Sbjct: 3   SCPICFESLSKGACRLV--ECGHKYHFNCIRRWHYHSKNLQ-CPTCRIKSRHLEDIERKV 59

Query: 114 SIN 116
           +IN
Sbjct: 60  TIN 62

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 32.3 bits (72), Expect = 0.68,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 4/55 (7%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSR---GLCP 101
            C  C+   N  C  C+ P     +VI  C H  H  CI EW          G CP
Sbjct: 1268 CDSCKKK-NTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLNENEHECPGGCP 1321

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           TCP C  K       L+   C H FH  C+ +W ++      CP+CR
Sbjct: 240 TCPVCLEKMDSLVTGLITIPCSHTFHCQCLDKWKNSK-----CPVCR 281

>Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR032W
           (REAL)
          Length = 1167

 Score = 32.0 bits (71), Expect = 0.75,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 13/59 (22%)

Query: 50  CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQ 105
           C IC A           P D    V  EC H+F   C++E+++    + L   CP CR+
Sbjct: 914 CSICTAE----------PIDLDNAVFTECGHSFCEKCLFEYIEFQNGKQLSLKCPNCRE 962

>NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {ON}
           Anc_2.411
          Length = 1137

 Score = 32.0 bits (71), Expect = 0.76,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 30/77 (38%), Gaps = 14/77 (18%)

Query: 62  PNCKFPGDGC--------PL---VIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQLF 107
           P   FP   C        PL   V  EC H F   CI E+ +    + L   CP CR+  
Sbjct: 875 PQIDFPALECSICTTDPIPLDKIVFTECGHPFCESCIEEYFEFQAGKNLELKCPNCREQI 934

Query: 108 QLKKGVSINDSHIERFR 124
              + +++     E F+
Sbjct: 935 NSNRLLTVEKIEAETFK 951

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 32.0 bits (71), Expect = 0.81,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 25/65 (38%), Gaps = 9/65 (13%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQLF------QLKKGVSINDSHIERFRELAIKRQ 131
           C H F   C+Y W     +   CP+CR +       Q +   + +D   ER R L     
Sbjct: 235 CGHIFGRECLYRWCKLENT---CPLCRHVIAEVDTTQHQAQDAASDQAFERIRNLVYNTN 291

Query: 132 QEQNE 136
              N+
Sbjct: 292 PTSND 296

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 32.0 bits (71), Expect = 0.83,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 4/55 (7%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEW-LDTSTSR--GLCP 101
            C  C+   N  C  C+ P     +VI  C H  H  CI EW LD       G CP
Sbjct: 1274 CDSCKKK-NTPCILCERPLKKLTMVILPCGHEGHFQCIQEWFLDEKEHECPGGCP 1327

>Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032W
           (REAL)
          Length = 1178

 Score = 32.0 bits (71), Expect = 0.84,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 13/59 (22%)

Query: 50  CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQ 105
           C IC A           P D   ++  EC H+F   C++E+++    + L   CP CR+
Sbjct: 923 CSICTAE----------PIDIDKVLFTECGHSFCEKCLFEYIEFQKGKNLCLKCPNCRK 971

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 16/80 (20%)

Query: 72  PLVIGECQHNFHVHCIYEWLDTSTSRGL-CPMCR--------------QLFQLKKGVSIN 116
           P+++  C HN+   C+  W  ++ ++ L CP CR              QL +    VS++
Sbjct: 46  PMMVA-CGHNYCYSCLSSWFTSNETQELSCPQCRANVTTAPALNTTLQQLLETLAEVSLD 104

Query: 117 DSHIERFRELAIKRQQEQNE 136
           D+  E+  E   K   E N+
Sbjct: 105 DTKKEKEGEDVNKDGSENND 124

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] {ON}
            YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 31.6 bits (70), Expect = 0.96,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 2/55 (3%)

Query: 57   FNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTS--TSRGLCPMCRQLFQL 109
             +R C  C+    G   V G CQH  H  C   W   S   + G    C ++F +
Sbjct: 1047 LSRNCNYCELHVKGRGFVCGNCQHILHATCAKRWWSVSDECASGCGCKCVEMFDV 1101

>TBLA0H00320 Chr8 complement(56811..60716) [3906 bp, 1301 aa] {ON}
            Anc_2.411 YLR032W
          Length = 1301

 Score = 32.0 bits (71), Expect = 0.96,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 4/52 (7%)

Query: 58   NRTCPNCKF-PGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQ 105
            N  CP C   P D    +  EC H F   C+ ++L   + +G    CP CR+
Sbjct: 1043 NMECPICTTDPIDFTDSLFTECGHAFCKSCLEDYLKFQSEKGRDHNCPTCRK 1094

>KNAG0C03410 Chr3 (669679..670338) [660 bp, 219 aa] {ON} Anc_7.416
           YER116C
          Length = 219

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 5/54 (9%)

Query: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSR---GLCPMCRQLFQLKK 111
           CP C  P D    +   C H F   C++  ++ S +R   GLC +CR     K+
Sbjct: 153 CPICFDPPDVA--MAAPCGHVFCCECLFNMVNNSRNRGNFGLCALCRSKVDFKR 204

>KNAG0C05150 Chr3 (1001535..1002905) [1371 bp, 456 aa] {ON}
           Anc_5.399 YDR348C
          Length = 456

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 28/75 (37%), Gaps = 9/75 (12%)

Query: 2   KVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTC 61
           K E +K   V S      KN  TI+     D  G   G  H D   D C   R   N+  
Sbjct: 217 KKEKRKSSAVLS------KNVDTIDK---LDVTGLYGGSFHHDGPFDACTPQRNKNNKAA 267

Query: 62  PNCKFPGDGCPLVIG 76
           P   FP DG    IG
Sbjct: 268 PVLAFPVDGPNSTIG 282

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C H  H++C+  W++ S +   CP+CR
Sbjct: 371 CGHILHLNCLKNWMERSQT---CPICR 394

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 5/49 (10%)

Query: 61  CPN--CKFPGDGCPLVIGE---CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           CP   C    +  P  +G    C H +H+ CI +W    +    CP+CR
Sbjct: 13  CPQDECSICWESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1333

 Score = 31.6 bits (70), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWL 91
            C  CR   N  C  C+ P     + + EC H FH  C  +W 
Sbjct: 1275 CDSCRKP-NTLCVICEQPMKKLAICLLECGHEFHFECGQQWF 1315

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGL-CPMCR 104
           V+  C HN+   CI  WL+ + +  L CP CR
Sbjct: 5   VMTSCGHNYCYDCISNWLNNNNATELTCPQCR 36

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 31.6 bits (70), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 3/36 (8%)

Query: 69  DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           D    +I  C H FH  C+  W+        CP+CR
Sbjct: 719 DAQSYMITPCSHIFHTECLENWMSYKLQ---CPVCR 751

>Kwal_23.5859 s23 (1345113..1346972) [1860 bp, 619 aa] {ON} YER068W
           (MOT2) - putative zinc finger protein [contig 11] FULL
          Length = 619

 Score = 31.6 bits (70), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 30/77 (38%), Gaps = 9/77 (11%)

Query: 31  EDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEW 90
           ++A+ +       DDEED C +C  + + T  N K     CP     C +     C    
Sbjct: 14  QNALANYDTSFLSDDEEDYCPLCIETLDITDKNFK----PCP-----CGYQICQFCYNNI 64

Query: 91  LDTSTSRGLCPMCRQLF 107
                  G CP CR+ +
Sbjct: 65  RQNPELNGRCPACRRKY 81

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 16/63 (25%)

Query: 42   HEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCP 101
            H++ EE  C +C   FN       F G      + +C H F   CI+ WL    +   CP
Sbjct: 1156 HKEGEELSCAVC---FNEI-----FVGS-----VVKCGHFFCYSCIHTWLKEHNT---CP 1199

Query: 102  MCR 104
            +C+
Sbjct: 1200 LCK 1202

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 16/63 (25%)

Query: 42   HEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCP 101
            H++ EE  C +C   FN       F G      + +C H F   CI+ WL    +   CP
Sbjct: 1156 HKEGEELSCAVC---FNEI-----FVGS-----VVKCGHFFCYSCIHTWLKEHNT---CP 1199

Query: 102  MCR 104
            +C+
Sbjct: 1200 LCK 1202

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C+H FH++CI EW   S     CP+CR
Sbjct: 23  CRHQFHLNCIREWHKYSIDLK-CPICR 48

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGE 77
           I KN+  +++ L      D++   ++ + ++VC +C        P+     DG       
Sbjct: 321 IWKNSKQLDTKLPTMTSDDLN---NDPNFDNVCIVCMDELVSENPH-HHQSDGKKPKKLP 376

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C H  H+ C+  W++ S +   CP+CR
Sbjct: 377 CGHVLHLSCLKNWMERSQT---CPICR 400

>Skud_13.400 Chr13 (707700..710792) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDT-STSRGL--CPMC 103
           N+ C  C    +  P+V  +C H +H HC+ E  DT    R L  CP C
Sbjct: 925 NQVCFMCNLKLE-IPVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC 972

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           +I  C H FH  C+  W+        CP+CR
Sbjct: 714 MITPCSHIFHTQCLESWMSYKLQ---CPVCR 741

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           +I  C H FH  C+  W+        CP+CR
Sbjct: 717 MITPCSHIFHTQCLESWMSYKLQ---CPVCR 744

>Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {ON}
           YPR093C (REAL)
          Length = 288

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C+H FH++CI EW   S     CP+CR
Sbjct: 23  CKHKFHLNCIREWHKYSIDLK-CPICR 48

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 13/65 (20%)

Query: 45  DEEDVCGIC-----RASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL 99
           +E+++C IC      +  ++T  N        P     C H  H+ C+  W++ S +   
Sbjct: 339 NEDNICIICMDELMHSQADQTWKNKNKKPKRLP-----CGHILHLSCLKNWMERSQT--- 390

Query: 100 CPMCR 104
           CP+CR
Sbjct: 391 CPICR 395

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGL-CPMCRQLFQLKKGVSI 115
           V+  C HN+   CI  WL ++ +  L CP CR   +    +++
Sbjct: 5   VMTSCGHNYCYECISNWLVSNNANELTCPQCRSPLKEPPALNV 47

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 9/64 (14%)

Query: 75   IGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHIERFRELAIKRQQEQ 134
            I +C H F   C+  W   +TS   CPMC      K  +S ++ +  +FRE  +K + + 
Sbjct: 1220 ILKCGHFFCKDCVTHWFKKNTS---CPMC------KNRMSSSEVYHFKFREEELKEEDDT 1270

Query: 135  NEFE 138
            +  E
Sbjct: 1271 DNPE 1274

>YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA
           helicase proposed to promote replication fork regression
           during postreplication repair by template switching;
           RING finger containing ubiquitin ligase; stimulates the
           synthesis of free and PCNA-bound polyubiquitin chains by
           Ubc13p-Mms2p
          Length = 1169

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 77  ECQHNFHVHCIYEWLDTSTSRGL---CPMCR 104
           EC H+F   C++E+++   S+ L   CP CR
Sbjct: 931 ECGHSFCEKCLFEYIEFQNSKNLGLKCPNCR 961

>Skud_4.617 Chr4 complement(1099322..1100809) [1488 bp, 495 aa] {ON}
           YDR348C (REAL)
          Length = 495

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
           IPKN  TI+     D  G   G  H D   D     R   N+  P   FP DG    IG
Sbjct: 228 IPKNVDTIDK---LDVTGLFGGSFHHDGPFDAVTPHRNKNNKAAPVLAFPIDGPNSTIG 283

>NDAI0E04850 Chr5 (1100709..1102691) [1983 bp, 660 aa] {ON}
           Anc_7.249 YER068W
          Length = 660

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 40/99 (40%), Gaps = 13/99 (13%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
           DDEED C +C    + T  N  FP   CP     C +     C           G CP C
Sbjct: 28  DDEEDFCPLCIEPLDITDKNF-FP---CP-----CGYQICQFCYNNIRQNPELNGRCPAC 78

Query: 104 RQLFQLKK----GVSINDSHIERFRELAIKRQQEQNEFE 138
           R+ +         +S  +  +ER +    +R+++Q E E
Sbjct: 79  RRKYDDDSVRYVVLSPEELKLERAKLARKERERKQKEKE 117

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 75   IGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHIERF 123
            I +C H +   CI+ WL+ S  +  CP+C      K   +IND++  +F
Sbjct: 1149 ILKCGHYYCQDCIWNWLEKSKKKN-CPIC------KIETNINDTYNFKF 1190

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 3/32 (9%)

Query: 73  LVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
            +I  C H FH  C+  W+        CP+CR
Sbjct: 720 FMITPCNHVFHTQCLENWMGYKLQ---CPVCR 748

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 36/96 (37%), Gaps = 13/96 (13%)

Query: 16  WHIPKNAGTIESGLGE-DAIGDIHGMVHEDDEEDV---CGICRAS---FNRTCPNCKFPG 68
           W +P++A  I  G     AI   H M H    E     C IC +    +    P      
Sbjct: 666 WFLPRHA--IPEGYSYFKAISSQHLMEHGQTSEVNTVDCSICMSEIPVYVEELPETH-KV 722

Query: 69  DGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           D    ++  C H FH  C+  W+        CP+CR
Sbjct: 723 DQHSYMVTPCNHIFHTSCLENWMSYKLQ---CPVCR 755

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 14/60 (23%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKG-----------VSINDSHIERFREL 126
           C H F   CIY+W     S   CP+CR       G           V+ N++  ER R +
Sbjct: 267 CGHIFGRECIYKWSRLENS---CPLCRHKISENAGVQRAAEQDTDEVAANEAAFERIRRV 323

>KLTH0A04532g Chr1 (378016..379851) [1836 bp, 611 aa] {ON} similar
           to uniprot|P34909 Saccharomyces cerevisiae YER068W MOT2
           Component of the CCR4-NOT transcription regulatory
           complex which represses transcription at least in part
           by inhibiting functional TBP-DNA interactions and also
           aids in transcription elongation interacts with C-
           terminal region of Not1p
          Length = 611

 Score = 31.2 bits (69), Expect = 1.5,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 30/77 (38%), Gaps = 9/77 (11%)

Query: 31  EDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEW 90
           ++A+ +       DDEED C +C  + + T  N K     CP     C +     C    
Sbjct: 14  QNALANYDTSFLSDDEEDYCPLCIETLDITDKNFK----PCP-----CGYQICQFCYNNI 64

Query: 91  LDTSTSRGLCPMCRQLF 107
                  G CP CR+ +
Sbjct: 65  RQNPELNGRCPACRRKY 81

>Ecym_1322 Chr1 complement(656210..657518,658465..658691) [1536 bp,
           511 aa] {ON} similar to Ashbya gossypii ACR152W
           1-intron
          Length = 511

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 3/53 (5%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDG 70
           +PKN  TI+     D  G   G  H D   D C   R   N+  P   FP DG
Sbjct: 268 MPKNVDTIDK---LDVTGLFGGAFHHDGPFDACTPHRNKNNKVAPVLAFPKDG 317

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C H  H+ C+  W++ S +   CP+CR
Sbjct: 377 CGHILHLSCLKNWMERSQT---CPICR 400

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C H  H+ C+  W++ S +   CP+CR
Sbjct: 367 CGHVLHLFCLKNWMERSQT---CPICR 390

>Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116W
           (REAL)
          Length = 580

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 46  EEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           EE+ C IC     + C           + I  C H++H  C+   +  S  + +CP CR
Sbjct: 487 EEEDCSICLCKI-KPCQ---------AIFISPCAHSWHFRCVRRLVMLSYPQFICPNCR 535

>Kwal_47.17771 s47 (548453..551371) [2919 bp, 972 aa] {ON} YLR032W
           (RAD5) - putative ATPase/DNA helicase [contig 204]
           PARTIAL
          Length = 972

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 37/91 (40%), Gaps = 16/91 (17%)

Query: 31  EDAIGDIHGMV-HEDDEEDV-CGICRASFNRTCPNCKFPGDGCPLVI-GECQHNFHVHCI 87
           E  I  IH    HED   ++ C IC +           P D    VI  EC H F   CI
Sbjct: 698 ESTISQIHEKYPHEDRLRNLECSICTSE----------PIDPVTQVIFTECGHAFCELCI 747

Query: 88  YEWLDTSTSRGL---CPMCRQLFQLKKGVSI 115
            E++   T R     CP CR     K+ ++I
Sbjct: 748 LEYIRFQTERQQDIKCPNCRHEINPKRLLTI 778

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           ++  C H FH  C+  W++       CP+CR
Sbjct: 725 MVTPCNHVFHTSCLENWMNYKLQ---CPVCR 752

>CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032w RAD5
          Length = 1151

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 27/65 (41%), Gaps = 13/65 (20%)

Query: 50  CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL---CPMCRQL 106
           C IC A           P +    V+ EC+H F   C+ E+ +    + L   CP CR+ 
Sbjct: 897 CSICTAE----------PIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRRD 946

Query: 107 FQLKK 111
             L +
Sbjct: 947 INLNR 951

>YDR348C Chr4 complement(1170326..1171825) [1500 bp, 499 aa] {ON}
           PAL1Protein of unknown function thought to be involved
           in endocytosis; Pal1p physically interacts with Ede1p
           and is found at endocytic sites at the cell periphery
           during the early stages of endocytosis; green
           fluorescent protein (GFP)-fusion protein also localizes
           to the bud neck; potential Cdc28p substrate; similar to
           the S. pombe Pal1 protein
          Length = 499

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
           +PKN  TI+     D  G   G  H D   D     R   N+  P   FP DG    IG
Sbjct: 231 VPKNVDTIDK---LDVTGLFGGSFHHDGPFDAVTPHRNKNNKAAPVLAFPVDGPNSTIG 286

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 3/38 (7%)

Query: 77  ECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVS 114
           +C H F   CIY+W     S   CP+CR     ++G++
Sbjct: 246 KCGHRFGRMCIYQWTKEHNS---CPICRAEIVGREGLN 280

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 30.8 bits (68), Expect = 1.9,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 3/29 (10%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQL 106
           C+H F   C+Y+W     +   CP+CR +
Sbjct: 281 CKHIFGRECLYKWTRVQNT---CPLCRHI 306

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 33/101 (32%)

Query: 49  VCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR---- 104
           +C IC  + +++              +  C H +H+ CI  W + S     CP CR    
Sbjct: 18  ICAICLDAIDKSIAK-----------LEPCNHKYHIDCIRTWHNYSNDLN-CPTCRIETN 65

Query: 105 QL--------------FQLKKGVSINDSHIERFRELAIKRQ 131
           QL                LK G +IN   IE + EL I+RQ
Sbjct: 66  QLSVNIYPEIQSPPVKITLKTGFNIN--KIEEYCEL-IRRQ 103

>TDEL0E02250 Chr5 (432893..433164,433451..434552) [1374 bp, 457 aa]
           {ON} Anc_5.399 YDR348C
          Length = 457

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIG 76
            PKN  TI+     D  G   G  H D   D C   R   ++  P   FP DG    IG
Sbjct: 219 TPKNVDTIDK---MDVTGLFGGSFHHDGPFDACTPHRNKNSKAAPVMAFPADGPNNSIG 274

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C H FH++CI EW   S +   CP+CR
Sbjct: 23  CGHKFHLNCIREWHKYSINLK-CPICR 48

>Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116W
           (REAL)
          Length = 530

 Score = 30.8 bits (68), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 46  EEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           EE+ C IC     + C           + I  C H++H  C+   +  S  + +CP CR
Sbjct: 437 EEEDCSICLCKI-KPCQ---------AIFISPCAHSWHFRCVRRLVMLSYPQFVCPNCR 485

>KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {ON}
           Anc_2.157 YHR115C
          Length = 427

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 28/71 (39%), Gaps = 10/71 (14%)

Query: 41  VHEDDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLC 100
           + ED   ++C IC          CK       L    C H +H  CI  +++       C
Sbjct: 330 LTEDTRHELCSICLEE-------CKLQHR---LFFAPCSHCWHSACIQPYMNKDVPLFTC 379

Query: 101 PMCRQLFQLKK 111
           P CR +F L +
Sbjct: 380 PNCRCIFDLSE 390

>Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON}
           (126281..127543) [1263 nt, 421 aa]
          Length = 420

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 72  PLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQL 106
           P+ I  C H +H +CI   + T+  +  CP CR  
Sbjct: 356 PVFISHCFHFWHFNCIMPIIQTTYPQFNCPNCRSF 390

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 30.8 bits (68), Expect = 2.1,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQ 105
           C H F   C+YEW     S   CP+CR+
Sbjct: 295 CGHIFGRSCLYEWTRLENS---CPLCRK 319

>KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {ON}
           Anc_8.808 YOL054W
          Length = 351

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 72  PLVIGECQHNFHVHCIYEWLDTSTSRGL-CPMCRQLFQLKKGVSIN-DSHIERFRELAIK 129
           P+++ EC HN+   C+  WL ++ +  L CP CR +      +++  D  ++   E+ +K
Sbjct: 39  PMMV-ECGHNYCYTCLKHWLTSNENTVLKCPDCRSVVSHPPNMNMFLDHQLKYILEMLVK 97

Query: 130 RQQEQNEF 137
                +E+
Sbjct: 98  NAAPDSEW 105

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           C H  H  C+  W++ S +   CP+CR
Sbjct: 400 CGHMLHFSCLKNWMERSQT---CPICR 423

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 6/52 (11%)

Query: 50   CGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCP 101
            CG  R   NR C  C         V G CQH  H+ C  EW + S     CP
Sbjct: 1061 CG--REGLNR-CTYCHLKAQYSIFVCGNCQHVLHLKCSKEWWNVSKE---CP 1106

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 27/107 (25%)

Query: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGM--VHEDDEEDVCGICRASFN 58
           M+VE+ K       SW +  NA        ++A+  +  +  +    EE+ C IC     
Sbjct: 339 MRVELNK-------SWKMRANA------FNKEALARLRNLQKLTVGLEEEDCSICL---- 381

Query: 59  RTCPNCKFPGDGC-PLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
                CK     C  + I  C H++H  CI   + T   + +CP CR
Sbjct: 382 -----CKI--KPCQAIFISPCSHSWHYQCIRRLVMTQYPQFVCPNCR 421

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           ++  C H FH  C+  W+        CP+CR
Sbjct: 729 MVTPCNHIFHTECLENWMSYKLQ---CPVCR 756

>ZYRO0G15642g Chr7 complement(1271054..1274128) [3075 bp, 1024 aa]
           {ON} similar to uniprot|P12868 Saccharomyces cerevisiae
           YMR231W PEP5 Peripheral vacuolar membrane protein
           required for protein trafficking and vacuole biogenesis
           forms complex with Pep3p that promotes vesicular
           docking/fusion reactions in conjunction with SNARE
           proteins also interacts with Pep7p
          Length = 1024

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%)

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL--CPMC-------RQLFQ 108
           N+TC  C    +  P+V  +C+H +H  C+ E       R L  CP C        ++FQ
Sbjct: 920 NKTCFMCHTALE-LPIVFFKCRHIYHQRCLNEEESAKEGRRLFRCPRCMAELETSEKIFQ 978

Query: 109 LKKGVS 114
            ++ +S
Sbjct: 979 TQQEMS 984

>CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa] {ON}
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054w
          Length = 387

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRG--LCPMCRQL 106
           +  EC H++   C+  W  + T+RG   CP CR +
Sbjct: 41  MTTECGHSYCYTCLKTWFSSDTNRGGLSCPECRAI 75

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 30.4 bits (67), Expect = 2.5,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           +I  C H FH  C+  W+        CP+CR
Sbjct: 717 MITPCNHIFHTTCLENWMSYKLQ---CPVCR 744

>KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]
           {ON} some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 518

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 19/34 (55%)

Query: 73  LVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQL 106
           + I  C H++H  CI + +  +  + +CP CR +
Sbjct: 405 VFIAPCSHSWHFKCIRQLVSKTYPQFVCPNCRAV 438

>ZYRO0C08360g Chr3 (637103..639058) [1956 bp, 651 aa] {ON} similar
           to uniprot|P34909 Saccharomyces cerevisiae YER068W MOT2
           Component of the CCR4-NOT transcription regulatory
           complex which represses transcription at least in part
           by inhibiting functional TBP-DNA interactions and also
           aids in transcription elongation interacts with C-
           terminal region of Not1p
          Length = 651

 Score = 30.4 bits (67), Expect = 2.6,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 13/99 (13%)

Query: 44  DDEEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMC 103
           DDEED C +C    + T  N K     CP     C +     C           G CP C
Sbjct: 28  DDEEDFCPLCLEPMDITDKNFK----PCP-----CGYQICQFCYNNIRQNEELNGRCPAC 78

Query: 104 RQLFQLKK----GVSINDSHIERFRELAIKRQQEQNEFE 138
           R+ +         +++ +  +ER ++   + +++Q E E
Sbjct: 79  RRKYDDDSVEYVVLTVEELRMEREKQTRKEWERKQREKE 117

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 30.4 bits (67), Expect = 2.6,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           ++  C H FH  C+  W+        CP+CR
Sbjct: 732 MVTPCAHIFHTQCLENWMSYKLQ---CPVCR 759

>Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {ON}
           complement(56650..59700) [3051 nt, 1017 aa]
          Length = 1016

 Score = 30.4 bits (67), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 5/49 (10%)

Query: 58  NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGL---CPMC 103
           N  C  C+  G   P+V+ +C HN+H  C+ E  D  T   +   CP C
Sbjct: 914 NVNCCMCE-AGLELPIVVFKCTHNYHQRCLNE-EDKKTDGSIVYKCPKC 960

>KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {ON}
           Anc_8.808 YOL054W
          Length = 357

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 72  PLVIGECQHNFHVHCIYEWLDTSTSRGL-CPMCR 104
           P+++  C H +   C+  W   + +R L CP CR
Sbjct: 43  PMMVTPCGHTYCYECLLTWFKNNENRELNCPDCR 76

>KLLA0F22154g Chr6 (2069922..2070232,2071226..2072507) [1593 bp, 530
           aa] {ON} similar to uniprot|Q66RD5 Saccharomyces
           cerevisiae YDR348C Protein of unknown function; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cell periphery and bud neck; potential Cdc28p
           substrate
          Length = 530

 Score = 30.4 bits (67), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 3/53 (5%)

Query: 18  IPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRTCPNCKFPGDG 70
           +PKN  TI+     D  G   G  H D   D C   R    +  P   FP DG
Sbjct: 282 LPKNVDTIDK---LDVTGLFGGAFHHDGPFDACTPHRNKNAKAAPVMAFPADG 331

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 18/100 (18%)

Query: 7   KVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGM--VHEDDEEDVCGICRASFNRTCPNC 64
           K+    + SW    NA        ++AI  I  +  +    EE+ C IC    ++  P C
Sbjct: 397 KIRVELNRSWKRRANA------FNKEAIQRIRNLQKLTTGVEEEDCSIC---LSKIKP-C 446

Query: 65  KFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           +       + I  C H +H  CI   + TS  + +CP CR
Sbjct: 447 QA------MFISPCSHCWHFQCIRRLVMTSYPQFVCPNCR 480

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           ++  C H FH  C+  W+        CP+CR
Sbjct: 725 MVTPCNHVFHTSCLENWMSYKLQ---CPVCR 752

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 74  VIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           ++  C H FH  C+  W+        CP+CR
Sbjct: 725 MVTPCAHVFHTECLENWMSYKLQ---CPVCR 752

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1310

 Score = 30.4 bits (67), Expect = 2.8,   Method: Composition-based stats.
 Identities = 10/34 (29%), Positives = 17/34 (50%)

Query: 58   NRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWL 91
            N+ C  C+ P  G  + + +C H  H  C+ +W 
Sbjct: 1261 NKLCVVCEKPMKGLTMSVLQCGHGGHFECMRDWF 1294

>Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116W
           (REAL)
          Length = 529

 Score = 30.4 bits (67), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 46  EEDVCGICRASFNRTCPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCR 104
           EE+ C IC     + C           + I  C H++H  C+   +  S  + +CP CR
Sbjct: 436 EEEDCSICLCKI-KPCQ---------AIFISPCAHSWHFRCVRRLVMLSYPQFVCPNCR 484

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 30.4 bits (67), Expect = 2.8,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 17/73 (23%)

Query: 71   CPLVIGE--------CQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHIER 122
            C + +GE        C H F   CI+ WL    S   CP+C      K   S+++ +  +
Sbjct: 1223 CTICLGEIYMGSVIKCGHFFCQSCIFSWLKNHAS---CPLC------KMQTSMSEVYSFK 1273

Query: 123  FRELAIKRQQEQN 135
            F++   +   EQ+
Sbjct: 1274 FQDAQPEADSEQD 1286

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 30.4 bits (67), Expect = 2.9,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 11/50 (22%)

Query: 78  CQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHIERFRELA 127
           C H F   C+Y+W     S   CP+CR          I +S  ER  E++
Sbjct: 246 CDHIFGRECLYKWSKLENS---CPLCRH--------KIIESDSERASEIS 284

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,893,152
Number of extensions: 769448
Number of successful extensions: 2036
Number of sequences better than 10.0: 323
Number of HSP's gapped: 1990
Number of HSP's successfully gapped: 323
Length of query: 176
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 74
Effective length of database: 41,785,467
Effective search space: 3092124558
Effective search space used: 3092124558
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)