Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1043.775.711ON65761531470.0
TPHA0E001505.711ON64661524260.0
SAKL0E15114g5.711ON64962223800.0
KLLA0A00418g5.711ON64261223190.0
TDEL0B020905.711ON64361723110.0
CAGL0H06699g5.711ON65061923080.0
KLTH0E00836g5.711ON64162122840.0
ZYRO0B16522g5.711ON64361122820.0
Kwal_55.196495.711ON64160522790.0
NCAS0G001805.711ON65461922390.0
KAFR0D021705.711ON66062422340.0
AFR295W5.711ON63162221950.0
Ecym_40105.711ON64459921670.0
NDAI0F002105.711ON65362221410.0
TBLA0E017505.711ON66560421200.0
YIL155C (GUT2)5.711ON64962620650.0
Skud_9.135.711ON64962520490.0
Smik_9.145.711ON65260820280.0
KNAG0L021905.711ON64560419930.0
Suva_9.325.711ON53855018830.0
KLLA0F24288g2.141ON433122800.47
ACR158W8.623ON799104780.90
Kwal_55.214185.436ON484160751.7
YOR153W (PDR5)5.500ON151178752.4
Kpol_1067.261.457ON1420145716.5
Skud_4.1452.330ON64572699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1043.77
         (657 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...  1216   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   939   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   921   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   897   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   894   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   893   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   884   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   883   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   882   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   867   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   865   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   850   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   839   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   829   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   821   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   800   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   793   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   785   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   772   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   729   0.0  
KLLA0F24288g Chr6 complement(2265719..2267020) [1302 bp, 433 aa]...    35   0.47 
ACR158W Chr3 (629136..631535) [2400 bp, 799 aa] {ON} Syntenic ho...    35   0.90 
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...    33   1.7  
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    33   2.4  
Kpol_1067.26 s1067 complement(58530..62792) [4263 bp, 1420 aa] {...    32   6.5  
Skud_4.145 Chr4 complement(260712..262649) [1938 bp, 645 aa] {ON...    31   9.1  

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score = 1216 bits (3147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/615 (95%), Positives = 587/615 (95%)

Query: 43  YNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVAL 102
           YNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVL                 RGLNVAL
Sbjct: 43  YNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNVAL 102

Query: 103 VEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKI 162
           VEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKI
Sbjct: 103 VEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKI 162

Query: 163 LPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLV 222
           LPIMIPVYQYWQVPYFYVGTKMYDLFAGSQN           ACEIAPMLDSSKLKAGLV
Sbjct: 163 LPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLV 222

Query: 223 YHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQI 282
           YHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQI
Sbjct: 223 YHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQI 282

Query: 283 KAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNP 342
           KAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNP
Sbjct: 283 KAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNP 342

Query: 343 NMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENP 402
           NMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENP
Sbjct: 343 NMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENP 402

Query: 403 TATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGGATQEVVRSHFIFT 462
           TATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGGATQEVVRSHFIFT
Sbjct: 403 TATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGGATQEVVRSHFIFT 462

Query: 463 SDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLS 522
           SDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLS
Sbjct: 463 SDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLS 522

Query: 523 QKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRY 582
           QKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRY
Sbjct: 523 QKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRY 582

Query: 583 PYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRRE 642
           PYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRRE
Sbjct: 583 PYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRRE 642

Query: 643 REKVYATDYIKTFGV 657
           REKVYATDYIKTFGV
Sbjct: 643 REKVYATDYIKTFGV 657

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/615 (73%), Positives = 509/615 (82%), Gaps = 15/615 (2%)

Query: 44  NDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALV 103
           N+    +PVD+ +V +P+R++L++ LK T QFDVL                 RGLNVALV
Sbjct: 46  NEAVLANPVDSPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVALV 105

Query: 104 EKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL 163
           EK+D+ASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL
Sbjct: 106 EKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL 165

Query: 164 PIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVY 223
           PIMIPVY+YWQVPYFY G KMYD+FAGSQN           ACEIAPMLD SKLKAGLVY
Sbjct: 166 PIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVY 225

Query: 224 HDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIK 283
           HDG+FNDSRMN+TLAI+AIE GATVLNYMEVKQL+KD  + +LTGAIVED ETGE  QI 
Sbjct: 226 HDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQIN 285

Query: 284 AKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPN 343
           AKVIVNATGPYSD ILQMDNNKNG PD F +  ET             SI+ +VAVQNP+
Sbjct: 286 AKVIVNATGPYSDKILQMDNNKNGKPDEFTQSAET-------------SIATKVAVQNPH 332

Query: 344 MVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPT 403
           MVVPSAGVHIILPS+YCP EMGLLDANT+DGRVMFFLPWQGKVLAGTTDIPMKTVPENPT
Sbjct: 333 MVVPSAGVHIILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPT 392

Query: 404 ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPR-VQKGGATQEVVRSHFIFT 462
           ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPR   K GATQE+VRSHFIFT
Sbjct: 393 ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPKEGATQELVRSHFIFT 452

Query: 463 SDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLS 522
           SD+GLVTIAGGKWTTYREMAEETID VVK GKFN KPC TRKLKLAG EN+D NLAALL+
Sbjct: 453 SDHGLVTIAGGKWTTYREMAEETIDTVVKNGKFNVKPCSTRKLKLAGGENYDPNLAALLA 512

Query: 523 QKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRY 582
           QKY++ + ++EHLANNYGTRSP+IC+M    D N+LP+ LAG+E   +    V +DSFRY
Sbjct: 513 QKYHLPSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGT-VDFDSFRY 571

Query: 583 PYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRRE 642
           PY+IAE+KY + +EY RT LDFLMRR+R+AFLDAK+AL +V GTVKIMGD LNWD +RR+
Sbjct: 572 PYSIAEVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRK 631

Query: 643 REKVYATDYIKTFGV 657
           +E  Y+ +YIKTFGV
Sbjct: 632 QETDYSIEYIKTFGV 646

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/622 (70%), Positives = 516/622 (82%), Gaps = 19/622 (3%)

Query: 44  NDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALV 103
           ND +  +PV  + + LP+R DLLSKL KT QFDVL                 RGLNVALV
Sbjct: 39  NDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATRGLNVALV 98

Query: 104 EKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL 163
           E ND+ASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLV+EALNERAH+LYTAPHLCKIL
Sbjct: 99  EMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKIL 158

Query: 164 PIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVY 223
           PIMIPVY YWQ PYFYVG KMYDLFAGSQN           A E+APMLD+SKLKAGLVY
Sbjct: 159 PIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVY 218

Query: 224 HDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIK 283
           HDGSFNDSRMNATLA++A+EKGATVLNYMEVKQL+K+E+T K+ GA+ +D ETGET++IK
Sbjct: 219 HDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIK 278

Query: 284 AKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPN 343
           AKV+VNATGP+SD ILQMD +  GLPD   + +++ N+          +IS +VAV NP 
Sbjct: 279 AKVVVNATGPFSDRILQMDEDSKGLPD--DRLLQSSNINA--------TISSKVAVANPQ 328

Query: 344 MVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPT 403
           MVVPSAGVHI+LPS+YCP E+GLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK +PENPT
Sbjct: 329 MVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPT 388

Query: 404 ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKG--------GATQEVV 455
           ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLV+DPR + G         +TQE+V
Sbjct: 389 ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELV 448

Query: 456 RSHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDA 515
           RSHF+FTSDN LVTIAGGKWTTYREM+EETI+EVVK GKFNAKPCITRKLKLAGAEN+D 
Sbjct: 449 RSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDP 508

Query: 516 NLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHV 575
           NL A+L+Q+Y++S+ MAE+LANNYGTR+P+ICE+ K+ D+NKLP+   G+EN ++   +V
Sbjct: 509 NLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVY-GNV 567

Query: 576 GYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLN 635
            +DSFRYP+TI ELKYS++ EYTRTALDFLMRRTRYAFLDAK+AL AV+GTVK+MGD L+
Sbjct: 568 DFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELS 627

Query: 636 WDNDRREREKVYATDYIKTFGV 657
           WD++RR+ E+  AT++IKTFGV
Sbjct: 628 WDSNRRQEEREKATEFIKTFGV 649

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/612 (70%), Positives = 499/612 (81%), Gaps = 17/612 (2%)

Query: 50  SPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEKNDYA 109
           S +  ++V LPSR +LLS+L KT +FDVL                 RGLNVALVE ND+A
Sbjct: 44  STIKKSNVDLPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFA 103

Query: 110 SGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPV 169
           SGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNERAH+L TAPHLCKILPIMIPV
Sbjct: 104 SGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPV 163

Query: 170 YQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSFN 229
           Y YWQVPYFYVGTKMYDLFAGSQN           A E+APMLD+SKLKAGLVYHDGSFN
Sbjct: 164 YNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFN 223

Query: 230 DSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVN 289
           DSRMN++LAI+AIEKGATVLNY+++KQLVK+++T K+ GAI  D ETG+ YQIKAKV+VN
Sbjct: 224 DSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVN 283

Query: 290 ATGPYSDTILQMDNNKNGLPD--MFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVP 347
           ATGPYSD +LQMD +  GLPD  + +K  E              ++S ++AV NP MVVP
Sbjct: 284 ATGPYSDRLLQMDQSPTGLPDDSVLQKINENA------------TVSTKIAVPNPKMVVP 331

Query: 348 SAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEA 407
           SAGVHI+LPS+YCP E+GLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK +PENPTATEA
Sbjct: 332 SAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEA 391

Query: 408 DIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV--QKGGATQEVVRSHFIFTSDN 465
           DIQDILKELQHYI FPVKREDVLSAWAGIRPLV+DPR      G+TQ++VRSHF+FTS +
Sbjct: 392 DIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGSGSTQQLVRSHFLFTSPS 451

Query: 466 GLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLSQKY 525
            LVTI+GGKWTTYREMAEETIDEVVK G+FN+KPC+T+KLKL G ENW+ NL+ALLSQKY
Sbjct: 452 NLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSALLSQKY 511

Query: 526 NVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYT 585
           ++S+ M+EHLANNYGTR+P+ICE+  E   NKLPV LAG+EN S+   HV YDSFRYPYT
Sbjct: 512 HLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVF-GHVDYDSFRYPYT 570

Query: 586 IAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREK 645
           I ELKYS+ YEY R  LDFLMRRTRYAFLDAK+AL+AV GTVK+MGD L WD+ +R+ E 
Sbjct: 571 IGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEI 630

Query: 646 VYATDYIKTFGV 657
             AT+YIKTFGV
Sbjct: 631 QQATEYIKTFGV 642

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/617 (69%), Positives = 495/617 (80%), Gaps = 17/617 (2%)

Query: 44  NDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALV 103
           ND +  S VDT +V+LPSR DLLSKL KT QFDVL                 RGLNVALV
Sbjct: 41  NDVALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALV 100

Query: 104 EKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL 163
           E +D+ASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNER H+L TAPHLCKIL
Sbjct: 101 EMHDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKIL 160

Query: 164 PIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVY 223
           PIMIPVY YWQ+PYFYVG KMYDLFAGSQN           A +IAPMLD + LKAGLVY
Sbjct: 161 PIMIPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVY 220

Query: 224 HDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIK 283
           HDGSFNDSRMN  LA++AIE GATVLNYMEVKQL+KD++T K+ GA+V + ETGE + +K
Sbjct: 221 HDGSFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVK 280

Query: 284 AKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPN 343
           AKV VNATGPYSD +LQMD NK+G PD             P   +   +IS +VAV+NP 
Sbjct: 281 AKVTVNATGPYSDKLLQMDENKDGKPD-------------PTKPLPNATISTKVAVENPK 327

Query: 344 MVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPT 403
           MVVPSAGVHIILPS+YCP EMGLLD  T+DGRVMFFLPWQGKVLAGTTDIPMK VP+ PT
Sbjct: 328 MVVPSAGVHIILPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPT 387

Query: 404 ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQK---GGATQEVVRSHFI 460
           A E+DIQDIL+ELQHYIKFPVKREDVLSAWAGIRPLV DPR  +   GG+TQ +VRSH  
Sbjct: 388 AAESDIQDILQELQHYIKFPVKREDVLSAWAGIRPLVIDPRKSQGNTGGSTQGLVRSHLC 447

Query: 461 FTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAAL 520
           FT+DNG+VTIAGGKWTTYREMAEETI+EVVK GKFN KPCITRKLKL+GAENW+ NLAAL
Sbjct: 448 FTTDNGMVTIAGGKWTTYREMAEETINEVVKVGKFNVKPCITRKLKLSGAENWNPNLAAL 507

Query: 521 LSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSF 580
           L+QKY++S  M+ HL+ NYGTR+P+ICEM +E + N+LPV   GREN ++   +V +DSF
Sbjct: 508 LAQKYHLSGAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVY-GNVNFDSF 566

Query: 581 RYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDR 640
           RYP+TI EL YS+DYEYTRTALDFLMRRTR+AFLDA++ALDAV GTV +MGD LNWD+ R
Sbjct: 567 RYPFTIGELNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTR 626

Query: 641 REREKVYATDYIKTFGV 657
           R+ E   + ++I+TFGV
Sbjct: 627 RKHEIEKSKEFIRTFGV 643

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/619 (71%), Positives = 498/619 (80%), Gaps = 14/619 (2%)

Query: 44  NDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALV 103
           ND S  SPV+  DV+LP+R +LL KL +T QFDVL                 RGLNVALV
Sbjct: 41  NDVSLISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALV 100

Query: 104 EKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL 163
           EKND+ASGTSSKSTKMAHGGVRYLEKA +++SKAQLDLVIEALNERAHLL TAPHLCK+L
Sbjct: 101 EKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLL 160

Query: 164 PIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVY 223
           PI+IPVY YWQVPYFY G KMYDLFAGSQN             E+APMLD S LKAGLVY
Sbjct: 161 PIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVY 220

Query: 224 HDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIK 283
           HDGSFND+RMNATLA++AIE  ATVLNYMEVKQLVKD K  K+ GA+VED ETG+TY ++
Sbjct: 221 HDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKD-KDGKVAGAVVEDRETGKTYSVR 279

Query: 284 AKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIE---TGNLKTPLNVITPESISKEVAVQ 340
           AKV+VNATGPYSD +LQMD N +GLPD   ++ E    GN        T +SI  +VAV 
Sbjct: 280 AKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGN-------ATVKSIMSQVAVT 332

Query: 341 NPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPE 400
            PNMVVPSAGVHIILPS+YCP EMGLLDA T+DGRVMFFLPWQGKVLAGTTDIP+K VPE
Sbjct: 333 KPNMVVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE 392

Query: 401 NPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPR--VQKGGATQEVVRSH 458
           NPTATEADIQDILKELQ YIKFPVKREDVLSAWAGIRPLV DPR   +  G+TQ +VRSH
Sbjct: 393 NPTATEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKKSKADGSTQGLVRSH 452

Query: 459 FIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLA 518
           FIFTSD+GLVTIAGGKWTTYR MAEETIDEVVK GKF+AKPCITRKLKLAGAENWD NL 
Sbjct: 453 FIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKFDAKPCITRKLKLAGAENWDPNLP 512

Query: 519 ALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYD 578
           ALL+QKY++S  M+ +LA NYGTR+P+ICEM  E  EN+LP+ LA +E   +   HV +D
Sbjct: 513 ALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVL-GHVDFD 571

Query: 579 SFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDN 638
           SFRYP TIAELKY++ YEY RTALDFLMRRTR+AFLDAK+AL+AV GTV++MGD L WD 
Sbjct: 572 SFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDE 631

Query: 639 DRREREKVYATDYIKTFGV 657
            RR+ E  Y+T++IKTFGV
Sbjct: 632 QRRQDEIRYSTEFIKTFGV 650

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/621 (68%), Positives = 495/621 (79%), Gaps = 18/621 (2%)

Query: 43  YNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVAL 102
           +N+     P+      +PSR++LL K+ KT QFDVL                 RGLNVAL
Sbjct: 33  HNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVAL 92

Query: 103 VEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKI 162
           VE ND+ASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER H+L TAPHLCK+
Sbjct: 93  VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKV 152

Query: 163 LPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLV 222
           LPIMIPVY YWQVPYFYVG KMYDLFAGSQN           A E+APMLD+S LKAGLV
Sbjct: 153 LPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLV 212

Query: 223 YHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQI 282
           YHDGSFNDSRMNA LA++AIE+GATVLNYMEV +L+K+EKT ++ GA+  D ETG+ ++I
Sbjct: 213 YHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRI 272

Query: 283 KAKVIVNATGPYSDTILQMDNNKNGLP--DMFKKEIETGNLKTPLNVITPESISKEVAVQ 340
            AKV+VN+TGP+SD ILQMDN K+GLP  D+ +   E             +SI   VAV 
Sbjct: 273 NAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANE-----------GHDSIGSRVAVS 321

Query: 341 NPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPE 400
           NP MVVPSAGVHI+LP++YCP ++GLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK VPE
Sbjct: 322 NPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPE 381

Query: 401 NPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGG----ATQEVVR 456
           NPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLV+DPR  K G    +TQ +VR
Sbjct: 382 NPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVR 441

Query: 457 SHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDAN 516
           +HF+FTSDNGLVTIAGGKWTTYREMAEETIDEVVKQG F AKPCIT+K+KLAGAE WD N
Sbjct: 442 NHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPN 501

Query: 517 LAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVG 576
             A+L+Q+Y++S+ MAEHLANNYGTRSPIICEM +  ++N+LPV   GREN ++   +V 
Sbjct: 502 FVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYK-NVN 560

Query: 577 YDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNW 636
           +DSFRYP+TIAELKYS+ YEYTRTALDFLMRRTR+ FLDAK+AL+AV GTV IMGD L W
Sbjct: 561 FDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGW 620

Query: 637 DNDRREREKVYATDYIKTFGV 657
           D ++R  E   A+D+IKTFGV
Sbjct: 621 DENKRLSEIQQASDFIKTFGV 641

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/611 (70%), Positives = 487/611 (79%), Gaps = 16/611 (2%)

Query: 50  SPVDTT-DVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEKNDY 108
           SP+D    V LPSR DLLS L+KT +FDVL                 RGLNVA VE ND+
Sbjct: 46  SPIDPRPSVNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVACVEANDF 105

Query: 109 ASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIP 168
           ASGTSSKSTKMAHGGVRYLEKAVF+LS+AQLDLVIEALNER H+L TAPHLCKILPIMIP
Sbjct: 106 ASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIP 165

Query: 169 VYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSF 228
           VY YWQVPYF+ G K+YD FAG QN           A E+APMLD SKLKAGLVYHDGSF
Sbjct: 166 VYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSF 225

Query: 229 NDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIV 288
           NDSRMN+TLAISAIE GATVLNY++V QL+KD  T K+ GAIVED ETG+ YQ+KAKV V
Sbjct: 226 NDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTV 285

Query: 289 NATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPS 348
           NATGPYSD ILQMD NKNGLPD    +        P NV    SI+ EVAV  PNMVVPS
Sbjct: 286 NATGPYSDLILQMDKNKNGLPDPQPPQ--------PANV----SIATEVAVNKPNMVVPS 333

Query: 349 AGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEAD 408
           AGVHIILPSYYCP  +GLLD  TADGRVMFFLPWQGKVLAGTTDIPMKTVP+NPTATEAD
Sbjct: 334 AGVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEAD 393

Query: 409 IQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQK--GGATQEVVRSHFIFTSDNG 466
           IQDIL+ELQHYIKFPV+REDVLSAWAGIRPLV DPR +K  GG+T+ +VR+H IFTS+ G
Sbjct: 394 IQDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETG 453

Query: 467 LVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLSQKYN 526
           L+T+AGGKWTTYREMAE+TIDEVVK+G F+ KPCITRK+KLAG ENW  NL+ALL+Q Y 
Sbjct: 454 LITLAGGKWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYK 513

Query: 527 VSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTI 586
           +S  M++HL+NNYGTR+PIICE+ KE + N+LPV   GREN ++ + HV +DSFRYP+TI
Sbjct: 514 LSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLH-HVNFDSFRYPFTI 572

Query: 587 AELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKV 646
            E  YS+ +EY+R A DFLMRRTRYAFLDA  AL AV GTVK+MGD LNWD+ RR+RE  
Sbjct: 573 GEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIE 632

Query: 647 YATDYIKTFGV 657
             T++IKTFGV
Sbjct: 633 ECTEFIKTFGV 643

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/605 (69%), Positives = 491/605 (81%), Gaps = 18/605 (2%)

Query: 59  LPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEKNDYASGTSSKSTK 118
           LP+R++LL K+ KT QFDVL                 RGLNVALVE ND+ASGTSSKSTK
Sbjct: 49  LPTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKSTK 108

Query: 119 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYF 178
           MAHGGVRYLEKA ++LSKAQLDLVIEALNER H+L TAPHLCK+LPIMIPVY YWQVPYF
Sbjct: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168

Query: 179 YVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLA 238
           YVG KMYDLFAGSQN           A E+APMLD+S LKAGLVYHDGSFNDSRMNA LA
Sbjct: 169 YVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228

Query: 239 ISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTI 298
           ++AIE+GATVLNYMEV QLVK++++ ++ GA+V D ETGE ++IKAKV+VN+TGP+SD +
Sbjct: 229 VTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRL 288

Query: 299 LQMDNNKNGLP--DMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILP 356
           LQMD  K+G P  D+ +   E             +SI   +AV NP MVVPSAGVHI+LP
Sbjct: 289 LQMDAAKDGKPRNDLVQFANE-----------GHDSIGSRIAVSNPRMVVPSAGVHIVLP 337

Query: 357 SYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKEL 416
           ++YCP E+GLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK VPENPTATEADIQDILKEL
Sbjct: 338 AFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKEL 397

Query: 417 QHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGG----ATQEVVRSHFIFTSDNGLVTIAG 472
           QHYIKFPVKR DVLSAWAGIRPL++DPR  K G    +TQ +VR+HF++TSDNGLVTIAG
Sbjct: 398 QHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAG 457

Query: 473 GKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPMA 532
           GKWTTYREMAEETIDEVVKQGKF AKPCIT+K+KLAGAE WD N  A+L+Q+Y++S+ MA
Sbjct: 458 GKWTTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMA 517

Query: 533 EHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYS 592
           EHLANNYGTRSPIICEM K  ++N+LPV   GREN ++   +V +DSFRYP+TI ELKYS
Sbjct: 518 EHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYK-NVNFDSFRYPFTIGELKYS 576

Query: 593 MDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYI 652
           M YEYTRTALDFLMRRTR+ FLDA++AL AV+GTV +MGD L W +DRR+ E+  A+++I
Sbjct: 577 MQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFI 636

Query: 653 KTFGV 657
           KTFG+
Sbjct: 637 KTFGL 641

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/619 (68%), Positives = 487/619 (78%), Gaps = 17/619 (2%)

Query: 46  PSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEK 105
           P   SPVDT  V LP+R+ LL +LK+  QFDVL                 RGL VALVE+
Sbjct: 46  PGLVSPVDTLQVSLPTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQ 105

Query: 106 NDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPI 165
           ND+ASGTSSKSTKMAHGGVRYLEKA FQLSK+QLDLVIEALNERAHLL TAPHLCKILPI
Sbjct: 106 NDFASGTSSKSTKMAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPI 165

Query: 166 MIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHD 225
           +IPVY YWQVPYFY G K+YDLFAG+QN           A E+APML+++ LKA LVYHD
Sbjct: 166 LIPVYTYWQVPYFYAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHD 225

Query: 226 GSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAK 285
           GSFNDSR+NATLAI+AIE+GATVLNY+EV++L+KD +T  + G  V D ETG+T  + +K
Sbjct: 226 GSFNDSRLNATLAITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSK 285

Query: 286 VIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMV 345
           V+VNATGP+SD ILQMD N  GLPD         ++     +I PE IS ++AV+NPNMV
Sbjct: 286 VVVNATGPFSDKILQMDKNPTGLPD---------DMNLNPKMINPEDISSKIAVKNPNMV 336

Query: 346 VPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTAT 405
           VPS+GVHIILPSYYCP +MGLLD  T+DGRVMFFLPWQGKV+AGTTDIPM  VPE P A 
Sbjct: 337 VPSSGVHIILPSYYCPKQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAK 396

Query: 406 EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV------QKGGATQEVVRSHF 459
           EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLV+DPR+      +  G+TQ +VRSHF
Sbjct: 397 EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHF 456

Query: 460 IFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLA 518
           IFTSDNGLVTIAGGKWTTYREMAEETIDEVVK G F +AKPCITR+LKLAGAE WD N++
Sbjct: 457 IFTSDNGLVTIAGGKWTTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNIS 516

Query: 519 ALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYD 578
           ALLSQKYN+ + MA +L++NYGTRSPIICE+    + NKLPV LAG E E I   +  ++
Sbjct: 517 ALLSQKYNLPSMMANYLSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQIL-GNTDFN 575

Query: 579 SFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDN 638
           +FRYP TI ELKYSM YEY RTALDFLMRRTR+AFLDAKEAL AV+GTVKIMGD  NW +
Sbjct: 576 TFRYPITIGELKYSMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSS 635

Query: 639 DRREREKVYATDYIKTFGV 657
           +RR+ EK     +IK+FGV
Sbjct: 636 ERRQEEKEKTIQFIKSFGV 654

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/624 (67%), Positives = 488/624 (78%), Gaps = 27/624 (4%)

Query: 50  SPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEKNDYA 109
           SP+D   V LP+R DL+SKL KT QFDVL                 RGLNVALVEK D+A
Sbjct: 48  SPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFA 107

Query: 110 SGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPV 169
           SGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNERAHLL TAPHLCKILPIMIPV
Sbjct: 108 SGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPV 167

Query: 170 YQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSFN 229
           Y YWQ+PYFY G KMYDLFAGSQN           A ++APMLD++KLKAGLVYHDG+FN
Sbjct: 168 YNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFN 227

Query: 230 DSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVN 289
           DSRMN+TLA++AIE G+TVLNYMEVKQL+K++ + K+ GAIVED ETG+ Y IKAKV++N
Sbjct: 228 DSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVIN 287

Query: 290 ATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSA 349
           ATGPYSD ILQMD N  GLPD     ++T N            I+ +V+V NP MVVPSA
Sbjct: 288 ATGPYSDAILQMDQNPTGLPDPLNVNLKTNN-----------DIATKVSVSNPKMVVPSA 336

Query: 350 GVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADI 409
           GVHIILPS+YCP ++GLLDA T+DGRVMFFLPWQGKVLAGTTD+PMK +PENPTATEADI
Sbjct: 337 GVHIILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADI 396

Query: 410 QDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV---QKGGATQEVVRSHFIFTSDNG 466
           QDILKELQHYI+FPVKREDVLSAWAGIRPLV+DPR       G+TQ +VRSHFIFTSD+G
Sbjct: 397 QDILKELQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHG 456

Query: 467 LVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLAALLSQKY 525
           LVTIAGGKWTTYR MAEET+DE +K GKF N KPCITR +KLAG ENW+ NL ALL+Q+Y
Sbjct: 457 LVTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRY 516

Query: 526 NVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENES----------ISNAHV 575
           ++S+ +++HLA+NYGTR+PIICEM  +  +NKLP+ LA   NE           I N   
Sbjct: 517 HLSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNER 576

Query: 576 G--YDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDH 633
           G  ++ FRYP+T+ E+KYS++YEY  TALDFLMRR+R+AFLDAKEA+ AV GTVKIMGD 
Sbjct: 577 GDVFECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDE 636

Query: 634 LNWDNDRREREKVYATDYIKTFGV 657
           LNWD  RR +E      YIKTFGV
Sbjct: 637 LNWDESRRHKEIENTIKYIKTFGV 660

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/622 (67%), Positives = 492/622 (79%), Gaps = 28/622 (4%)

Query: 47  SKPSPVDT--TDVRL-------PSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRG 97
           S+PS V+   T+++L       PSR++LL KL+KT QFDVL                 RG
Sbjct: 27  SRPSLVNEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRG 86

Query: 98  LNVALVEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAP 157
           LNVAL+E ND+ASGTSSKSTKMAHGGVRYLEKAV++LSKAQLDLVIEALNERAHLLYTAP
Sbjct: 87  LNVALLEMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAP 146

Query: 158 HLCKILPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKL 217
           HLCK+LPIMIPVY++WQVPYFYVGTKMYD FAGSQN           A E+APMLD+SKL
Sbjct: 147 HLCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKL 206

Query: 218 KAGLVYHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETG 277
           KAGLVYHDGSFNDSRMNAT+A++AIE GATVLNYMEVK+L+K+ +  K+ GA+  D ETG
Sbjct: 207 KAGLVYHDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETG 266

Query: 278 ETYQIKAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPES-ISKE 336
           + Y ++AKV+VNATGP+SD +LQMDN+  GLPD              L+ I  +S I+ E
Sbjct: 267 KEYAVRAKVVVNATGPFSDRLLQMDNHPEGLPD-----------DKILDAINKDSTIATE 315

Query: 337 VAVQNPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMK 396
           VAV NP MVVPS+GVHIILPSYYCP  MGLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK
Sbjct: 316 VAVANPKMVVPSSGVHIILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMK 375

Query: 397 TVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGGATQEVVR 456
            VP NPTATEADIQDILKELQHYIKFPVKREDV SAWAGIRPLV+DPR +    TQ +VR
Sbjct: 376 QVPANPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-KNLSDTQGLVR 434

Query: 457 SHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDA 515
           SH +FTS NG+VTI+GGKWTTYREMAEET++EVVK GKF NAKPCITRKLKL+GAE+WDA
Sbjct: 435 SHLVFTSKNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDA 494

Query: 516 NLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHV 575
           NL ALLS +YN+   +AEHL+ NYGT++  +CE+ ++   N LPV+LA  +  SI     
Sbjct: 495 NLPALLSHQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTSID---- 550

Query: 576 GYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLN 635
            Y++FRYPYTI ELK++M +EY RT LDFLMRRTRYAFLDAK+AL AV+GTVK+MGD L 
Sbjct: 551 -YNAFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALG 609

Query: 636 WDNDRREREKVYATDYIKTFGV 657
           WD+ +R  E  YA +YIKTFGV
Sbjct: 610 WDSAKRVAETKYAIEYIKTFGV 631

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/599 (67%), Positives = 479/599 (79%), Gaps = 16/599 (2%)

Query: 60  PSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEKNDYASGTSSKSTKM 119
           PSR  LL KL+KT QFDVL                 RGLNVAL+E NDYASGTSSKSTKM
Sbjct: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120

Query: 120 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYFY 179
           AHGGVRYLEKA ++LSKAQLDLVIEALNERAH+L+TAPHLCKILPIMIPVY++WQVPYFY
Sbjct: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180

Query: 180 VGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLAI 239
           VGTKMYD FAG QN           A ++APMLD+SKLKAGLVYHDGSFNDSRMN+TLA+
Sbjct: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240

Query: 240 SAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTIL 299
           +AIE GAT+LNYMEVKQL+K+ +T K+ GAI  D ETG+ Y +KAKV+V+ATGP+SD IL
Sbjct: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300

Query: 300 QMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILPSYY 359
           QM+N+  GLPD     +   N           +I+ +VAV +P MVVPS+GVHIILPS+Y
Sbjct: 301 QMENHPKGLPDDL--SLSKAN--------EGATITTKVAVADPKMVVPSSGVHIILPSFY 350

Query: 360 CPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHY 419
           CP +MGLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK VPENPTATEADIQDILKELQHY
Sbjct: 351 CPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHY 410

Query: 420 IKFPVKREDVLSAWAGIRPLVQDPRVQKGGATQEVVRSHFIFTSDNGLVTIAGGKWTTYR 479
           IKFPVKREDV SAWAGIRPLV+DPR +    TQ++VRSHF+FTSD+GLVTI+GGKWTTYR
Sbjct: 411 IKFPVKREDVQSAWAGIRPLVKDPR-KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYR 469

Query: 480 EMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPMAEHLANN 538
           EMA+ETIDEVVK G F NAKPCITRK+KL G+ENWD NL A+LSQ+YN+   ++E+L+ N
Sbjct: 470 EMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSEN 529

Query: 539 YGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYSMDYEYT 598
           YGT++  ICE+ +    N+LPV+LA  +    + A+V YD+FRYP+T+ ELKY++  EY 
Sbjct: 530 YGTKAAAICEIFQSDKRNQLPVSLAAEK----AAANVDYDAFRYPFTVGELKYNIRNEYA 585

Query: 599 RTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYIKTFGV 657
           R  LDFLMRRTRYAFLDAK+A+ AV GTVKIMGD L WD+ +RE E  YA ++IKTFGV
Sbjct: 586 RKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/622 (65%), Positives = 480/622 (77%), Gaps = 19/622 (3%)

Query: 45  DPSKPSPVDTTDVRLPSRTDLLSKLK-KTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALV 103
           +P   SPV+  ++ LPSR+ L ++L  K +QFD+L                 RGLNVALV
Sbjct: 42  NPYLISPVEDVEINLPSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALV 101

Query: 104 EKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL 163
           E++D+ASGTSSKSTKMAHGGVRYLEKA  Q SK+QLDLVIEALNERAHLL TAPHLCKIL
Sbjct: 102 ERDDFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKIL 161

Query: 164 PIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVY 223
           PI+IPVY YWQ+PYFY G K YD FAG QN           A EIAPMLD++ LKA LVY
Sbjct: 162 PILIPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVY 221

Query: 224 HDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIK 283
           HDGSFNDSR+N+++AI+AIE GATVLNY+EV++L+KD  + K+ G  V+D ETGE   +K
Sbjct: 222 HDGSFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVK 281

Query: 284 AKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPN 343
           +KVIVNATGPYSDTILQMD N +GLPD+        N+   +    P  IS ++AV NP 
Sbjct: 282 SKVIVNATGPYSDTILQMDKNLSGLPDL-------ANIDPKM--YDPNDISSKIAVSNPK 332

Query: 344 MVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPT 403
           MVVPS+GVHIILPSYYCP +MGLLDA T DGRVMFFLPWQGKV+AGTTDIPM  VP+ P 
Sbjct: 333 MVVPSSGVHIILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPV 392

Query: 404 ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV------QKGGATQEVVRS 457
           A E DIQDILKELQHYIKFPV+REDVLSAWAGIRPLV+DPR+      QK G TQ +VRS
Sbjct: 393 AKETDIQDILKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRS 452

Query: 458 HFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFN--AKPCITRKLKLAGAENWDA 515
           HF+FTSDNGL+TIAGGKWTTYREMAEETIDEVVK G F   AKPC T+ LKL GAENWD 
Sbjct: 453 HFLFTSDNGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDP 512

Query: 516 NLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHV 575
           NL ALLSQK+N+S+ MA++L+ NYGTRS IIC++ +  + NKLPV LAG E++ I   +V
Sbjct: 513 NLVALLSQKFNLSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPIL-GNV 571

Query: 576 GYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLN 635
            +++FRYP TIAELKY+M YEY RT LDFLMRRTR+A+LDA +AL AV GTVK+MGD   
Sbjct: 572 DFNTFRYPITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFG 631

Query: 636 WDNDRREREKVYATDYIKTFGV 657
           WD+ RRE+E   AT +I++FGV
Sbjct: 632 WDSKRREQEIKNATLFIESFGV 653

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/604 (66%), Positives = 474/604 (78%), Gaps = 12/604 (1%)

Query: 60  PSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEKNDYASGTSSKSTKM 119
           PSR++LLS L+KT +FDVL                 RGLNVAL+E ND+AS TSSKSTKM
Sbjct: 68  PSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTKM 127

Query: 120 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYFY 179
           AHGGVRYLEKAVFQLSKAQLDLVIEALNER H+L TAPHLCKILPIMIPVY YW+VPYFY
Sbjct: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187

Query: 180 VGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLAI 239
            G KMYD FAGSQN           A +IAPMLD  KLKA LVYHDGSFND+RMN +LA+
Sbjct: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247

Query: 240 SAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTIL 299
           +AIE GATVLNYMEV++L+KD KT K+ GA V D ET + Y + AKV+VN+TGP+SD IL
Sbjct: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307

Query: 300 QMDNNKNGLPDMF-KKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILPSY 358
           QMD NK+G PD+F K  I+T  L +    I  +++S+ +AV NP MVVPSAGVHIILPSY
Sbjct: 308 QMDRNKSGYPDIFDKANIDTSKLPS----IDHDNLSR-IAVDNPKMVVPSAGVHIILPSY 362

Query: 359 YCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQH 418
           YCP +MG+LD  TADGRVMFFLPWQ KVLAGTTDIPMK VPENP ATEADI+DIL ELQH
Sbjct: 363 YCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQH 422

Query: 419 YIKFPVKREDVLSAWAGIRPLVQDPRV----QKG-GATQEVVRSHFIFTSDNGLVTIAGG 473
           Y KFPVKREDVLSAWAGIRPLV+DPR      KG  +TQ +VRSHFIFTS+N LVTIAGG
Sbjct: 423 YCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGG 482

Query: 474 KWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPMAE 533
           KWTTYR MAEETIDE +K G+   KP +T+ L L+G ENW  N AALLSQKY++ + +++
Sbjct: 483 KWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSK 542

Query: 534 HLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYSM 593
           +L+ NYGTR+PIICE++K+  +N+LPV LAG+E+  I   +V + + RYPYT+AE+KY +
Sbjct: 543 YLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEIL-GNVDFQALRYPYTVAEVKYCI 601

Query: 594 DYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYIK 653
           D EY+RTALDFL+RRTR+ FLDAKEA++AV GTV IMGD LNWD+++R  E   + +YIK
Sbjct: 602 DNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIK 661

Query: 654 TFGV 657
           T GV
Sbjct: 662 TLGV 665

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/626 (63%), Positives = 463/626 (73%), Gaps = 23/626 (3%)

Query: 43  YNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVAL 102
           +NDPS      T      SR DLL +L KT+QFDVL                 RGLNVAL
Sbjct: 36  HNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVAL 95

Query: 103 VEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKI 162
           VEK D+ASGTSSKSTKM HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC +
Sbjct: 96  VEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTV 155

Query: 163 LPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLV 222
           LPI+IP+Y  WQVPY Y+G K YD FAGSQN             E APML +  LKA LV
Sbjct: 156 LPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLV 215

Query: 223 YHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQI 282
           YHDGSFNDSR+NATLAI+A+E GATVLNY+EV++L+KD  + K+ GA   D ET E  +I
Sbjct: 216 YHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRI 275

Query: 283 KAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITP-ESISKEVAVQN 341
            AK +VNATGPYSD ILQMD N +GLPD            +PLN  +  +S   ++AV +
Sbjct: 276 NAKCVVNATGPYSDAILQMDRNPSGLPD------------SPLNDNSKIKSTFNQIAVMD 323

Query: 342 PNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPEN 401
           P MV+PS GVHI+LPS+YCP +MGLLD  T+DGRVMFFLPWQGKVLAGTTDIP+K VPEN
Sbjct: 324 PKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPEN 383

Query: 402 PTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV-----QKGGATQEVVR 456
           P  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR      +KG ATQ VVR
Sbjct: 384 PMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVR 443

Query: 457 SHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDA 515
           SHF+FTSDNGL+TIAGGKWTTYR+MAEET+D+VV+ G F N KPC TR +KLAGAE W  
Sbjct: 444 SHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQ 503

Query: 516 NLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESI----S 571
           N  ALL+Q Y++S+ M+ +L  NYGTRS IICE  KES ENKLP++LA +EN  I     
Sbjct: 504 NYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEE 563

Query: 572 NAHVGYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMG 631
           N  V +D+FRYP+TI ELKYSM YEY RT LDFL+RRTR+AFLDAKEAL+AV+ TVK+MG
Sbjct: 564 NNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMG 623

Query: 632 DHLNWDNDRREREKVYATDYIKTFGV 657
           D  NW   +R+ E     ++IKTFGV
Sbjct: 624 DEFNWSEKKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/625 (62%), Positives = 461/625 (73%), Gaps = 23/625 (3%)

Query: 44  NDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALV 103
           ND S   P  T      SR DLL +L KT+QFDVL                 RGLNVALV
Sbjct: 37  NDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALV 96

Query: 104 EKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL 163
           EK D+ASGTSSKSTKM HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC +L
Sbjct: 97  EKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVL 156

Query: 164 PIMIPVYQYWQVPYFYVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVY 223
           PI+IP+Y  WQVPY Y+G K YD FAGSQN             E APML +  LKA LVY
Sbjct: 157 PILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVY 216

Query: 224 HDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIK 283
           HDGSFNDSR+NATLAI+A+E GATVLNY+EV++L+KD  + K+ GA   D ET E  +I 
Sbjct: 217 HDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKIN 276

Query: 284 AKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVIT-PESISKEVAVQNP 342
           AK +VNATGPYSD ILQMD N +G P+            +PLN  +  +S   ++AV +P
Sbjct: 277 AKCVVNATGPYSDAILQMDRNPSGQPN------------SPLNDNSLIKSTFNQIAVTDP 324

Query: 343 NMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENP 402
            MV+PS GVHI+LPS+YCP +MGLLD  T+DGRVMFFLPWQGKVLAGTTDIP+K VPENP
Sbjct: 325 KMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENP 384

Query: 403 TATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV-----QKGGATQEVVRS 457
             TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR      +KG ATQ VVRS
Sbjct: 385 MPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRS 444

Query: 458 HFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDAN 516
           HF+FTSDNGL+TIAGGKWTTYR+MAEET+D+VV+ G+F N KPC TR +KLAGAE W  N
Sbjct: 445 HFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQN 504

Query: 517 LAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESI----SN 572
             ALL+Q Y++S+ M+ +L  NYGTRS IICE  KES ENKLP++LA +EN  I     N
Sbjct: 505 YVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEEN 564

Query: 573 AHVGYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGD 632
             V +D+FRYP+TI ELKYSM YEY RT LDFL+RRTR+AFLDAKEAL++ + TVK+MGD
Sbjct: 565 NLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGD 624

Query: 633 HLNWDNDRREREKVYATDYIKTFGV 657
             NW   +R+ E     ++IKTFGV
Sbjct: 625 EFNWSEKKRQWELEKTINFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/608 (63%), Positives = 454/608 (74%), Gaps = 23/608 (3%)

Query: 61  SRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEKNDYASGTSSKSTKMA 120
           SR DLL +L KT+QFDVL                 RGLNVALVEK D+ASGTSSKSTKM 
Sbjct: 57  SRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 116

Query: 121 HGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYFYV 180
           HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC +LPI+IP+Y   QVPY Y+
Sbjct: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176

Query: 181 GTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLAIS 240
           G K YD FAGSQN             E APML +  LKA LVYHDGSFNDSR+NATLAI+
Sbjct: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236

Query: 241 AIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTILQ 300
           A+E GATVLNY+EV++L+KD  + K+ GA   D ET E  +IKAK +VNATGPYSD ILQ
Sbjct: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296

Query: 301 MDNNKNGLPDMFKKEIETGNLKTPLNVIT-PESISKEVAVQNPNMVVPSAGVHIILPSYY 359
           MD N +G PD            +PLN  +  +S   ++AV +P MV+PS GVHI+LPS+Y
Sbjct: 297 MDRNPSGQPD------------SPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFY 344

Query: 360 CPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHY 419
           CP +MGLLD  T+DGRVMFFLPWQGKVLAGTTDIP+K VPENP  TEADIQDILKELQHY
Sbjct: 345 CPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHY 404

Query: 420 IKFPVKREDVLSAWAGIRPLVQDPRV-----QKGGATQEVVRSHFIFTSDNGLVTIAGGK 474
           I+FPVKREDVLSAWAG+RPLV+DPR      +KG ATQ VVRSHF+FTSDN L+TIAGGK
Sbjct: 405 IEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGK 464

Query: 475 WTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPMAE 533
           WTTYR+MAEETID+VV+ G F N  PC TR +KLAGAE W  N  ALL+Q Y++S+ M+ 
Sbjct: 465 WTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSN 524

Query: 534 HLANNYGTRSPIICEMMKESDENKLPVNLAGRENESI----SNAHVGYDSFRYPYTIAEL 589
           +L  NYGTRS IICE  KES ENKLP++LA +EN  I     N  V +D+FRYP+TI EL
Sbjct: 525 YLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGEL 584

Query: 590 KYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYAT 649
           KYSM YEY RT LDFL+RRTR+AFLDAKEAL++V+ TVK+MGD  NW   +R+ E     
Sbjct: 585 KYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTV 644

Query: 650 DYIKTFGV 657
           ++IKTFGV
Sbjct: 645 NFIKTFGV 652

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/604 (63%), Positives = 454/604 (75%), Gaps = 23/604 (3%)

Query: 60  PSRTDLLSKLKKTYQFDVLXXXXXXXXXXXXXXXXXRGLNVALVEKNDYASGTSSKSTKM 119
           P R  +L +L+ T +FDVL                 RGL VALVEK D+A+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 120 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYFY 179
           AHGGVRYLEKAVF+LSK QLDLV+EALNERAHLLY APHL KILPI+IPVY+YW+VPYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 180 VGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLAI 239
            G KMYD FAG+QN              IAPMLD  KLK GLVYHDG FNDSR+ ATLAI
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 240 SAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTIL 299
           SA+E+GATV NY+ V+QL+KD+ T  +TGA VED ETG T+ + AK++VNATGPYSD IL
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 300 QMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILPSYY 359
           QMD N  GLP+   KE E     TP N +        +AV+NP MVVPS GVHI LPS+Y
Sbjct: 298 QMDANPQGLPE---KEPEKA---TPENAL--------IAVRNPKMVVPSRGVHITLPSFY 343

Query: 360 CPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHY 419
           CPSEMGLLDA+T+DGRVMFFLPWQGKV+AGTTDIP+K VP +P+ TEADIQDIL+ELQHY
Sbjct: 344 CPSEMGLLDASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHY 403

Query: 420 IKFPVKREDVLSAWAGIRPLVQDPRVQKG----GATQEVVRSHFIFTSDNGLVTIAGGKW 475
           I+FPV+REDVLSAWAGIRPLV+DPRV +G    G T+ +VRSHFIFTS   LVTIAGGKW
Sbjct: 404 IQFPVRREDVLSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKW 463

Query: 476 TTYREMAEETIDEVVKQGKFNA-KPCITRKLKLAGAENWDANLAALLSQKYN-VSTPMAE 533
           TTYREMAEET+DEV+K GKF   KPC TRK KL GA++W+ N  A L Q+Y  +   +AE
Sbjct: 464 TTYREMAEETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAE 523

Query: 534 HLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYSM 593
           HLANNYG R+PIICEM +    +KLPV L G  ++ + N     ++F YP+TIAELKY +
Sbjct: 524 HLANNYGDRAPIICEMFEADKSSKLPVGLYGDGDDKVKNMDA--NAFDYPFTIAELKYCI 581

Query: 594 DYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYIK 653
            +EY RTALDFL+RR+R+AFLDA+EAL+AV+ TV ++GD L WD ++R  E      YIK
Sbjct: 582 RFEYVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIK 641

Query: 654 TFGV 657
           TFGV
Sbjct: 642 TFGV 645

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/550 (64%), Positives = 419/550 (76%), Gaps = 23/550 (4%)

Query: 119 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYF 178
           M HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC +LPI+IP+Y  WQVPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 179 YVGTKMYDLFAGSQNXXXXXXXXXXXACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLA 238
           Y G K YD FAG QN             E APML +  LKA LVYHDGSFNDSR+NATLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 239 ISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTI 298
           I+A+E GATVLNY+EV++L+KD  + K+ GA   D ET E  +I AK +VNATGPYSD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 299 LQMDNNKNGLPDMFKKEIETGNLKTPLNVITP-ESISKEVAVQNPNMVVPSAGVHIILPS 357
           LQMD N +G P+            +PLN  +  +S   +VAV +P MV+PS GVHI+LPS
Sbjct: 181 LQMDRNASGQPN------------SPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPS 228

Query: 358 YYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQ 417
           +YCP ++GLLD  T+DGRVMFFLPWQGKVLAGTTDIP+K VPENP  TEADIQDILKELQ
Sbjct: 229 FYCPKDIGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQ 288

Query: 418 HYIKFPVKREDVLSAWAGIRPLVQDPRV-----QKGGATQEVVRSHFIFTSDNGLVTIAG 472
           HYI+FPVKREDVLSAWAG+RPLV+DPR      +KG ATQ VVRSHF+FTSDNGL+TIAG
Sbjct: 289 HYIEFPVKREDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAG 348

Query: 473 GKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPM 531
           GKWTTYR+MAEETID+VV+ G F N KPC TR +KLAGAE W  N  ALL+Q Y++S+ M
Sbjct: 349 GKWTTYRQMAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKM 408

Query: 532 AEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESI----SNAHVGYDSFRYPYTIA 587
           + +L  NYGTRS IICE  K+S ENKLP++LA +EN +I     N  V +D+FRYP+TI 
Sbjct: 409 SNYLVENYGTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIG 468

Query: 588 ELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVY 647
           ELKYSM YEY RT LDFL+RRTR+AFLDAKEAL++V+ TVK+MGD  NW + +R+ E   
Sbjct: 469 ELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEK 528

Query: 648 ATDYIKTFGV 657
             ++IKTFGV
Sbjct: 529 TVNFIKTFGV 538

>KLLA0F24288g Chr6 complement(2265719..2267020) [1302 bp, 433 aa]
           {ON} similar to uniprot|P53916 Saccharomyces cerevisiae
           YNL128W
          Length = 433

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 26/122 (21%)

Query: 240 SAIEKGATV---LNYMEVKQL-VKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYS 295
           + I KG T+   L Y++ +++ ++ E  Q+    I+++  T E ++I +    N+ G YS
Sbjct: 228 TGISKGVTIASQLRYLKYQEMFLRYEAKQR--EEIIKNLSTIE-FKILSIEFTNSIGQYS 284

Query: 296 DTILQMDNN-------------KNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNP 342
              L+  NN             K+GL D+F K+  TG  K  L  +T    SK++ V N 
Sbjct: 285 SEFLKKANNTTVSIKIQSHSSGKSGLIDLFSKQCSTG--KGSLRSLT----SKQIIVPNI 338

Query: 343 NM 344
           N+
Sbjct: 339 NV 340

>ACR158W Chr3 (629136..631535) [2400 bp, 799 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR208W (PTP2)
          Length = 799

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 8/104 (7%)

Query: 254 VKQLVKDEKTQKLTGAIVEDTETGE--TYQIKAKVIVNATGPYSDTILQMDNNKNGL--- 308
           + ++ K +K   + G+  ED+++     YQI+ K  +++ G      LQ+ N KN L   
Sbjct: 618 IVRVFKVQKKSTVAGSSAEDSQSNTHIVYQIQYKKWLDSCGIVMSDFLQLYNVKNALLND 677

Query: 309 PDMF-KKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGV 351
           PD F ++++E  N  T +++    S+ +     +P +V  SAG 
Sbjct: 678 PDSFIRQQLEDRN--TLIDIDEDPSLFRRTESHSPLLVHCSAGC 719

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 69/160 (43%), Gaps = 25/160 (15%)

Query: 251 YMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTILQMDNNK--NGL 308
           Y  V + V  +  Q L  ++   TE      IK K+I   TG +SD  + +D +   NGL
Sbjct: 48  YNSVLEPVLSQPLQTLEQSLANFTE------IKKKLIY--TGMFSDVKISLDKDTSGNGL 99

Query: 309 PDMFKKEIETGNLKTPLNVIT-----PESISKEVAVQNPNMVVPSAGVHIILPSYYCPSE 363
            D+ +  I+  +L++P+  I      P   +K     + N  VPS G       Y   + 
Sbjct: 100 KDLHQDAIKELSLESPVPTIARILLKPLEFNKLCFTSSTNDTVPSLGAR-----YSFVNA 154

Query: 364 MGLLDANTADGRVMFFLPWQGKVLAGTTD----IPMKTVP 399
           +G  +  T    V  ++P++   L  T D    +P++  P
Sbjct: 155 LGKAEIVTLQSEVK-YIPFKNTALEKTLDAKVVVPLQKNP 193

>YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plasma
           membrane ATP-binding cassette (ABC) transporter,
           multidrug transporter actively regulated by Pdr1p; also
           involved in steroid transport, cation resistance, and
           cellular detoxification during exponential growth
          Length = 1511

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 9/78 (11%)

Query: 524 KYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFR-- 581
           K  +  P      N+Y  +SP   E+MKE D+  L  + A R  E+I  AH+   S R  
Sbjct: 435 KKGIHIPQTPKEMNDYWVKSPNYKELMKEVDQRLLNDDEASR--EAIKEAHIAKQSKRAR 492

Query: 582 --YPYTIAELKYSMDYEY 597
              PYT++   Y M  +Y
Sbjct: 493 PSSPYTVS---YMMQVKY 507

>Kpol_1067.26 s1067 complement(58530..62792) [4263 bp, 1420 aa] {ON}
           complement(58530..62792) [4263 nt, 1421 aa]
          Length = 1420

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 69/145 (47%), Gaps = 9/145 (6%)

Query: 228 FNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVI 287
           ++  +MN +  +  + KG    + +++ QL+ D+  Q    A+VE   TG    I+ K+ 
Sbjct: 343 YDKDKMNLSFIVHDL-KGFVKHSTLDISQLI-DKDIQP--TAVVEQIFTGHNKSIQ-KLF 397

Query: 288 VNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVP 347
            ++ G    TI +   N    P+   K + T  +K   N+IT ES  K+  V     +V 
Sbjct: 398 RSSDGEAILTISRFSENCVWCPERLSKGV-TLWMK---NIITTESPVKQAVVHEKGKLVI 453

Query: 348 SAGVHIILPSYYCPSEMGLLDANTA 372
           +   +  + +++CP++   L+  +A
Sbjct: 454 TLLENSKIQAWWCPNKCKELETESA 478

>Skud_4.145 Chr4 complement(260712..262649) [1938 bp, 645 aa] {ON}
           YDL109C (REAL)
          Length = 645

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 10/72 (13%)

Query: 309 PDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILPSYYCPSEMGLLD 368
           PD FKK +E      P+N IT  S    +A   PN V  S  + II  +     E+GL D
Sbjct: 292 PDFFKK-VE------PINFITLASPLLGIATNTPNYVKKSLSMGIIGTT---GQELGLKD 341

Query: 369 ANTADGRVMFFL 380
            N  D  +++ L
Sbjct: 342 TNFCDKPLLYLL 353

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,262,450
Number of extensions: 2662812
Number of successful extensions: 7517
Number of sequences better than 10.0: 32
Number of HSP's gapped: 7634
Number of HSP's successfully gapped: 32
Length of query: 657
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 541
Effective length of database: 40,180,143
Effective search space: 21737457363
Effective search space used: 21737457363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)