Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1043.755.708ON55855830160.0
TPHA0E001705.708ON57856824060.0
YKR097W (PCK1)5.708ON54952423350.0
Smik_11.3615.708ON54952323230.0
Skud_11.3375.708ON54952423140.0
CAGL0H06633g5.708ON54452223090.0
NCAS0A031605.708ON55253822890.0
Suva_11.3345.708ON54852422890.0
KNAG0C066405.708ON54751822750.0
KLLA0A00484g5.708ON54355922740.0
NDAI0E050805.708ON55152222710.0
TDEL0B021205.708ON54852322600.0
SAKL0E15048g5.708ON54252322590.0
TBLA0E017005.708ON57652222540.0
Ecym_40135.708ON54251822410.0
ZYRO0B16456g5.708ON54851822380.0
KAFR0H001605.708ON54951822350.0
AFR292W5.708ON54151822340.0
KLTH0E00902g5.708ON54455822110.0
Kwal_55.196635.708ON54455821770.0
Suva_7.275singletonON961131431e-10
NDAI0A005601.67ON71482870.058
SAKL0B05126g8.762ON706139780.74
AFR432W1.527ON1284139780.81
KLTH0B01100g1.527ON1298116761.2
TPHA0O006001.380ON137262761.2
CAGL0E00385g1.67ON60895751.5
ZYRO0C15070g2.217ON93186724.5
TBLA0A053001.67ON707110714.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1043.75
         (558 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...  1166   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   931   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   904   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   899   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   895   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   894   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   886   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   886   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   880   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   880   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   879   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   875   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   874   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   872   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   867   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   866   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   865   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   865   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   856   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   843   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    60   1e-10
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    38   0.058
SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} simila...    35   0.74 
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...    35   0.81 
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...    34   1.2  
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    34   1.2  
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...    33   1.5  
ZYRO0C15070g Chr3 (1172681..1175476) [2796 bp, 931 aa] {ON} simi...    32   4.5  
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    32   4.6  

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score = 1166 bits (3016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/558 (100%), Positives = 558/558 (100%)

Query: 1   MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED 60
           MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED
Sbjct: 1   MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED 60

Query: 61  STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID 120
           STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID
Sbjct: 61  STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID 120

Query: 121 YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI 180
           YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI
Sbjct: 121 YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI 180

Query: 181 WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL 240
           WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL
Sbjct: 181 WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL 240

Query: 241 TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK 300
           TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK
Sbjct: 241 TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK 300

Query: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP 360
           CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP
Sbjct: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP 360

Query: 361 CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA 420
           CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA
Sbjct: 361 CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA 420

Query: 421 CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI 480
           CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI
Sbjct: 421 CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI 480

Query: 481 HNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNF 540
           HNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNF
Sbjct: 481 HNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNF 540

Query: 541 TIYQDQATDDVIAAGPAL 558
           TIYQDQATDDVIAAGPAL
Sbjct: 541 TIYQDQATDDVIAAGPAL 558

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/568 (77%), Positives = 489/568 (86%), Gaps = 23/568 (4%)

Query: 14  RENIIKNLKS-----------NSNVKLDN---VMKCLY---------NKDITIKRNPPIA 50
           RE+II N+KS            +N K+ N    +K L          ++ I IKRNPP+A
Sbjct: 11  REDIINNIKSLNDSSSLNTESQNNTKIKNKNDTIKLLEEFISDNLSNHQLINIKRNPPVA 70

Query: 51  ELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELT 110
            LYEDGLKE+ TTLSSTGAL+AYSGVKTGRSPKDKRIVEE  SKDNIWWGPVNK CSE T
Sbjct: 71  TLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWWGPVNKQCSERT 130

Query: 111 WSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEEL 170
           W+INRERA+DYLNTR  LYVIDA+ GWD  YRIKIRVVCAR YHALFMNNMLIRPT EEL
Sbjct: 131 WAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMNNMLIRPTKEEL 190

Query: 171 ENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMF 230
           ENFG+PDFT+WNAG F+ANSLT DM+SKTS+EINFK MEM ILGTEYAGEMKKGIFTVMF
Sbjct: 191 ENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAGEMKKGIFTVMF 250

Query: 231 YLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGV 290
           YLMP+YHNVLTLHSSANQ  NNGDVTLFFGLSGTGKTTLSADPHR+LIGDDEHCWSD+GV
Sbjct: 251 YLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIGDDEHCWSDNGV 310

Query: 291 FNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYP 350
           FNIEGGCYAKCIGL++EKEP+IFNAIKFGSVLENC+YDE TH VDYD+S ITENTRCAYP
Sbjct: 311 FNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNSTITENTRCAYP 370

Query: 351 IDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQG 410
           ID+I +AKIPCL DKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE G
Sbjct: 371 IDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEVG 430

Query: 411 VTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPL 470
           VTEP+PTFS+CFGQPFLALHPMKYA MLA+KM+ HKA+AWL+NTGWTG+SY +GG RCPL
Sbjct: 431 VTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGSSYVSGGSRCPL 490

Query: 471 KYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDPDVTYSQAVK 530
           KYTRAILDAIH+GSL NEEYETLP+FNL IPKN   VPSELLNP+ +W+D    Y  AV+
Sbjct: 491 KYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWTDSSEDYMTAVQ 550

Query: 531 KLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           +LG LF +NF  Y+D+AT++VI AGP L
Sbjct: 551 RLGKLFNENFKTYEDKATNEVIKAGPVL 578

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/524 (79%), Positives = 464/524 (88%)

Query: 35  CLYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSK 94
            L ++  TI+RN P A LYEDGLKE+ T +SS+GAL+AYSGVKTGRSPKDKRIVEEP+SK
Sbjct: 25  ALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIAYSGVKTGRSPKDKRIVEEPTSK 84

Query: 95  DNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYH 154
           D IWWGPVNKPCSE TWSINRERA DYL TR  +Y++DA+AGWD  YRIK+RVVCAR YH
Sbjct: 85  DEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKVRVVCARAYH 144

Query: 155 ALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILG 214
           ALFM NMLIRPT EEL +FGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEM+ILG
Sbjct: 145 ALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINFKAMEMIILG 204

Query: 215 TEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPH 274
           TEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPH
Sbjct: 205 TEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTGKTTLSADPH 264

Query: 275 RELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVV 334
           R LIGDDEHCWSDHGVFNIEGGCYAKCI L+ EKEPEIF+AIKFGSVLEN +YDE +HVV
Sbjct: 265 RLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGSVLENVIYDEKSHVV 324

Query: 335 DYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMY 394
           DYDDS ITENTRCAYPID+I SAKIPCL D HP N+ILLTCDASGVLPPVSKLTPEQVMY
Sbjct: 325 DYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMY 384

Query: 395 HFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINT 454
           HFISGYTSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA KM+ HKA+A+LINT
Sbjct: 385 HFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHKANAYLINT 444

Query: 455 GWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNP 514
           GWTG+SY +GGKRCPLKYTRAILD+IH+GSLANE YETLP+FNL +P  V  VP+ELLNP
Sbjct: 445 GWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYETLPIFNLQVPTKVNGVPAELLNP 504

Query: 515 SKTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           +K WS  +  Y  AV  L +LFVQNF IYQD+AT DV+AAGP  
Sbjct: 505 AKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/523 (79%), Positives = 463/523 (88%)

Query: 36  LYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKD 95
           L ++  TI+RN P A LYEDGLKE  T +SS+GAL+AYSGVKTGRSPKDKRIVEEP+SKD
Sbjct: 26  LSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDKRIVEEPTSKD 85

Query: 96  NIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHA 155
            IWWGPVNKPCSE TWSINRERA DYL TR  +Y++DA+AGWD  YRIK+RVVCAR YHA
Sbjct: 86  EIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKVRVVCARAYHA 145

Query: 156 LFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGT 215
           LFM NMLIRPT EEL +FGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEM+ILGT
Sbjct: 146 LFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINFKAMEMIILGT 205

Query: 216 EYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHR 275
           EYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPHR
Sbjct: 206 EYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTGKTTLSADPHR 265

Query: 276 ELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVD 335
            LIGDDEHCWSDHGVFNIEGGCYAKCI L+ EKEPEIF+AIKFG+VLEN  YDE +HVVD
Sbjct: 266 LLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAVLENVKYDEKSHVVD 325

Query: 336 YDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYH 395
           YDDS ITENTRCAYPID+I SAKIPCL D HP N+ILLTCDASGVLPPVSKLTPEQVMYH
Sbjct: 326 YDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYH 385

Query: 396 FISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTG 455
           FISGYTSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA KM+ HKA+A+LINTG
Sbjct: 386 FISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAAKMSQHKANAYLINTG 445

Query: 456 WTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPS 515
           WTG+SY +GGKRCPLKYTRAILD+IH+GSLANE YE+LP+FNL +P  V+ VP+ELLNP+
Sbjct: 446 WTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVPTKVKGVPAELLNPA 505

Query: 516 KTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           K WS  +  Y  AV  L +LFV+NF IYQD+AT DV+AAGP  
Sbjct: 506 KNWSQGETKYKGAVTSLATLFVENFKIYQDRATPDVLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/524 (78%), Positives = 463/524 (88%)

Query: 35  CLYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSK 94
            L ++  TI+RN P A LYEDGLKE  T +SS+GAL+AYSGVKTGRSPKDKRIVEE +SK
Sbjct: 25  ALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDKRIVEESTSK 84

Query: 95  DNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYH 154
           D IWWGPVNKPCSE TWSINRERA DYL TR  +Y++DA+AGWD  YRIK+RVVCAR YH
Sbjct: 85  DEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKVRVVCARAYH 144

Query: 155 ALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILG 214
           ALFM NMLIRPT EEL +FGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEM+ILG
Sbjct: 145 ALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINFKAMEMIILG 204

Query: 215 TEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPH 274
           TEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPH
Sbjct: 205 TEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGLSGTGKTTLSADPH 264

Query: 275 RELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVV 334
           R LIGDDEHCWSDHGVFNIEGGCYAKCI L+ EKEPEIF+AIKFG+VLEN  YDE +HVV
Sbjct: 265 RLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAVLENVKYDEKSHVV 324

Query: 335 DYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMY 394
           DYDDS ITENTRCAYPID+I SAKIPCL D HP N+ILLTCDASGVLPPVSKLTPEQVMY
Sbjct: 325 DYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMY 384

Query: 395 HFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINT 454
           HFISGYTSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA KM+HHK++A+LINT
Sbjct: 385 HFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSHHKSNAYLINT 444

Query: 455 GWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNP 514
           GW+G+SY +GGKRCPLKYTRAILD+IH+GSLANE YE+LP+FNL +P  V+ VP+ELLNP
Sbjct: 445 GWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVPTKVKGVPAELLNP 504

Query: 515 SKTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           +K WS  +  Y  +V  L +LFV+NF IYQD+AT DV+AAGP  
Sbjct: 505 AKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPDVLAAGPQF 548

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/522 (78%), Positives = 459/522 (87%), Gaps = 1/522 (0%)

Query: 38  NKDIT-IKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDN 96
           +K++T I+RN P A LY+D LKE  T +SS GAL+AYSG KTGRSPKDKRIVEE +S+DN
Sbjct: 23  SKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDKRIVEEETSRDN 82

Query: 97  IWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHAL 156
           +WWGPVNKPCSE TW+INRERA DYL TR+ LYV+DA+AGWD  YRIK+RVVCAR YHAL
Sbjct: 83  VWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKVRVVCARAYHAL 142

Query: 157 FMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTE 216
           FM NMLIRPT EEL NFGEPDFT+WNAG F AN+ T+DMTSKT+IEINFK+MEMVILGTE
Sbjct: 143 FMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINFKAMEMVILGTE 202

Query: 217 YAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRE 276
           YAGEMKKGIFTVMFYLMPV+HNVLTLHSS NQG+ NGDVTLFFGLSGTGKTTLSADPHR 
Sbjct: 203 YAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTGKTTLSADPHRL 262

Query: 277 LIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDY 336
           LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF+AI+FGSVLEN +YD  +H VDY
Sbjct: 263 LIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVIYDSESHEVDY 322

Query: 337 DDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHF 396
           DDS ITENTRCAYPIDFI SAKIPCL   HP N+ILLTCDASGVLPPVSKLTPEQVMYHF
Sbjct: 323 DDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVSKLTPEQVMYHF 382

Query: 397 ISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGW 456
           ISGYTSKMAGTEQGVTEPEPTFS+CFGQPFL+LHPM+YA MLA+KM+ H A+AWLINTGW
Sbjct: 383 ISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHSANAWLINTGW 442

Query: 457 TGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSK 516
           TG+SY +GGKRC LKYTRAILDAIH+GSLA  E+E+LP+FNL +PK VE VPSELLNP++
Sbjct: 443 TGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVEGVPSELLNPAR 502

Query: 517 TWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
            WS+ +  Y  AV KL  LFV+NF  YQD+AT DV+AAGP L
Sbjct: 503 NWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/538 (76%), Positives = 467/538 (86%), Gaps = 2/538 (0%)

Query: 23  SNSNVKLDNVMKCL-YNKDIT-IKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGR 80
           S+S +   ++ K L  ++D+T I+RN P A LYED L E  T ++S+GAL+AYSG KTGR
Sbjct: 15  SDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGR 74

Query: 81  SPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDAN 140
           SP+DKRIVEE +SKDN+WWGPVNKPCSE TW+INRERA DYL TR  LY++DA+AGWD  
Sbjct: 75  SPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPK 134

Query: 141 YRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTS 200
           YRIK+RVVCAR YHA+FM NMLIRPT EEL  FGEPDFTIWNAG F AN  T+DM+SKT+
Sbjct: 135 YRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTT 194

Query: 201 IEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFG 260
           IEINFK+MEM+ILGTEYAGEMKKGIFTVMFYLMPVYHN+LTLHSSANQG+ NGDVTLFFG
Sbjct: 195 IEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFG 254

Query: 261 LSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGS 320
           LSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIFNAIK+GS
Sbjct: 255 LSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGS 314

Query: 321 VLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGV 380
           +LEN +YD+NT VVDYDD+ ITENTRCAYPI++I SAKIPCL D HP N+ILLTCDASGV
Sbjct: 315 ILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV 374

Query: 381 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLAD 440
           LPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFS+CFGQPFLALHP++YA MLA+
Sbjct: 375 LPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAE 434

Query: 441 KMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPI 500
           K++HH A AWLINTGWTG+SY  GGKRCPLKYTRAILD+IH+GSLA + YETLP+FNL +
Sbjct: 435 KISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSV 494

Query: 501 PKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           P  V  VP E+LNP+K WS+ +  YS AV KLGSLFV+NF  YQD+AT DV+AAGP +
Sbjct: 495 PTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQI 552

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/524 (77%), Positives = 459/524 (87%)

Query: 35  CLYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSK 94
            L ++  TI+RN P A LYEDGLKE  T +SS+GAL+AYSGVKTGRSPKDKRIVEEP+SK
Sbjct: 25  ALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDKRIVEEPTSK 84

Query: 95  DNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYH 154
           D IWWGPVNKPCSE TWSINRERA DYL TR  +Y++DA+AGWD  YRIK+RVVCAR YH
Sbjct: 85  DEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKVRVVCARAYH 144

Query: 155 ALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILG 214
           ALFM NMLIRPT EEL +FGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEM+ILG
Sbjct: 145 ALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINFKAMEMIILG 204

Query: 215 TEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPH 274
           TEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPH
Sbjct: 205 TEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLSGTGKTTLSADPH 264

Query: 275 RELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVV 334
           R LIGDDEHCWSD+GVFNIEGGCYAKCI L+ EKEPEIF+AI+FG+VLEN  YDEN+HVV
Sbjct: 265 RLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVLENVKYDENSHVV 324

Query: 335 DYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMY 394
           DYDDS ITENTRCAYPID+I SAKIPCL D HP N+ILLTCDASGVLPPVSKLTPEQVMY
Sbjct: 325 DYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMY 384

Query: 395 HFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINT 454
           HFISGYTSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA KM+ H+A+A+LINT
Sbjct: 385 HFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHRANAYLINT 444

Query: 455 GWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNP 514
           GWTG+SY +GG RC LKYTRAILD+IH+GSLA   YE+LP+FNL +P  V  VP+ELLNP
Sbjct: 445 GWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPTKVNGVPAELLNP 504

Query: 515 SKTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           +K WS  +  Y  AV  L +LFV+NF IYQD+AT DV+AAGP  
Sbjct: 505 AKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVLAAGPQF 548

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/518 (78%), Positives = 454/518 (87%)

Query: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100
           ITI+RN P A LYED L E  T ++S+GAL+AYSG KTGRSPKDKRIVEE +SKDN+WWG
Sbjct: 30  ITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKDKRIVEEETSKDNVWWG 89

Query: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160
           PVNKPCSE TW INRERA DYL TR  LY++DA+AGWD  YRIK+RVVCAR YHALFM N
Sbjct: 90  PVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIKVRVVCARAYHALFMTN 149

Query: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220
           MLIRP+ EEL NFGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEMVILGTEYAGE
Sbjct: 150 MLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEINFKAMEMVILGTEYAGE 209

Query: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280
           MKKGIFTVMFYLMPV+HNVLTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPHR LIGD
Sbjct: 210 MKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGTGKTTLSADPHRLLIGD 269

Query: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340
           DEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF+AI+FGSVLEN  YDE +H VDYDDS 
Sbjct: 270 DEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLENVAYDEKSHEVDYDDST 329

Query: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400
           ITENTRCAYPI++I SAKIPCL D HP N+ILLTCDASGVLPPV+KL+PEQVMYHFISGY
Sbjct: 330 ITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVAKLSPEQVMYHFISGY 389

Query: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460
           TSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA+MLA KM+ HKA+A+LINTGWTG+S
Sbjct: 390 TSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSEHKANAYLINTGWTGSS 449

Query: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520
           Y +GGKRCPLKYTRAILDAIH+GSLA   YE+LP+FNL +P  V  VP ELLNP+K W+ 
Sbjct: 450 YVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAVNGVPHELLNPAKNWAQ 509

Query: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
            +  Y+ AV  L SLFV+NF IYQD+AT DV+AAGP L
Sbjct: 510 GEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/559 (74%), Positives = 468/559 (83%), Gaps = 17/559 (3%)

Query: 1   MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED 60
           M+PTK ++   +  ENI   L  ++ V             +TI+RN P A LYED LKE 
Sbjct: 1   MSPTKTQN---SAEENIRAELGLSAEV-------------VTIRRNAPAALLYEDALKER 44

Query: 61  STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID 120
            T +S+ GAL+AYSG KTGRSP+DKRIVEE +SKDN+WWGPVNKPCSE TW INRERA D
Sbjct: 45  DTAISNAGALIAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAAD 104

Query: 121 YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI 180
           YL TR  +Y++DAYAGWD  YRIK+RVVCAR YHALFM NMLIRP+ EELENFGEPDFT+
Sbjct: 105 YLRTRDHIYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTV 164

Query: 181 WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL 240
           WNAG F AN+ T  MTSKT++EINFK MEMVILGTEYAGEMKKGIFTVMFYLMPV HNVL
Sbjct: 165 WNAGQFPANTHTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVL 224

Query: 241 TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK 300
           TLHSSANQG+ + DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAK
Sbjct: 225 TLHSSANQGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAK 284

Query: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP 360
           C+GL+ EKEPEIFNAIKFGSVLEN +YD NT  VDY+DS ITENTRCAYPI++I SAKIP
Sbjct: 285 CLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIP 344

Query: 361 CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA 420
           CL D HP N++LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFS+
Sbjct: 345 CLADHHPKNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSS 404

Query: 421 CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI 480
           CFGQPFL+LHPMKYA MLA+KM  H A+AWLINTGWTG+SY AGGKRCPLKYTRAILDAI
Sbjct: 405 CFGQPFLSLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAI 464

Query: 481 HNGSLANEEYETLPVFNLPIPKNV-ENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQN 539
           H+GSLA EEYE LP+FNL IPK V + VP+ LLNPSK W++ +  Y+  VK L +LFV+N
Sbjct: 465 HDGSLAKEEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVEN 524

Query: 540 FTIYQDQATDDVIAAGPAL 558
           F  YQD+AT+ V+AAGP L
Sbjct: 525 FKTYQDKATEQVLAAGPQL 543

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/522 (77%), Positives = 458/522 (87%), Gaps = 1/522 (0%)

Query: 38  NKDIT-IKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDN 96
           +KD+T I+RN P A LYED L E +T +SSTGAL+AYSG KTGRSP+DKRIVEE +SKD+
Sbjct: 30  SKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSPRDKRIVEEETSKDD 89

Query: 97  IWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHAL 156
           IWWGPVNKPCSE TWSINRERA DYL TR  LY++DA+AGWD  YRIK+RVVCAR YHAL
Sbjct: 90  IWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYRIKVRVVCARAYHAL 149

Query: 157 FMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTE 216
           FM NMLIRPT EEL  FGEPDFT+WNAG F AN  T+DM+SKT+IEINFK+MEMVILGTE
Sbjct: 150 FMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIEINFKAMEMVILGTE 209

Query: 217 YAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRE 276
           YAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPHR 
Sbjct: 210 YAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLSGTGKTTLSADPHRL 269

Query: 277 LIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDY 336
           LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF AIK+GS+LEN +YD  T VV Y
Sbjct: 270 LIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSILENVIYDPKTRVVHY 329

Query: 337 DDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHF 396
           DDS +TENTRCAYPI+FI SAKIPCL D HP+N+ILLTCDASGVLPPVSKLTPEQVMYHF
Sbjct: 330 DDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPPVSKLTPEQVMYHF 389

Query: 397 ISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGW 456
           ISGYTSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA K++ H A+AWLINTGW
Sbjct: 390 ISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKISKHSANAWLINTGW 449

Query: 457 TGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSK 516
           TG+SY +GGKRCPLKYTRAILD+IH+GSLA +E+ETLPVFNL +P NV NVP ELLNP+K
Sbjct: 450 TGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPTNVNNVPKELLNPAK 509

Query: 517 TWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
            W+  +  Y+ AV  L SLFV+NF IYQD+AT +V+AA P +
Sbjct: 510 NWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAPRI 551

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/523 (77%), Positives = 452/523 (86%)

Query: 36  LYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKD 95
           L N+ ITI+RN P A LYED L E  TT++S+GAL+AYSG KTGRSPKDKRI+EE +SKD
Sbjct: 26  LSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIAYSGDKTGRSPKDKRIIEEETSKD 85

Query: 96  NIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHA 155
           NIWWGPVNKP  E TWSINRERA DYL TR  LY++DA+AGWD  YRIK+RVVCAR YHA
Sbjct: 86  NIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVDAFAGWDPRYRIKVRVVCARAYHA 145

Query: 156 LFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGT 215
           LFM NMLIRPT EEL +FGEPDFT+WNAG F AN  T+ M+SKT++EINFK+MEM+ILGT
Sbjct: 146 LFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHTQGMSSKTTVEINFKAMEMIILGT 205

Query: 216 EYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHR 275
           EYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQG+   DVTLFFGLSGTGKTTLSADPHR
Sbjct: 206 EYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQKNDVTLFFGLSGTGKTTLSADPHR 265

Query: 276 ELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVD 335
           +LIGDDEHCWSDHGVFNIEGGCYAKCIGLT EKEPEI+NAIKFGS+LEN VYD  T  VD
Sbjct: 266 KLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAIKFGSILENVVYDPKTRDVD 325

Query: 336 YDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYH 395
           Y+DS ITENTRCAYPI+ I SAKIPCL D HP NL+LLTCDASGVLPP+SKLTPEQVMYH
Sbjct: 326 YEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVLLTCDASGVLPPISKLTPEQVMYH 385

Query: 396 FISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTG 455
           FISGYTSKMAGTEQGVTEPE TFS+CFGQPFLALHP++YA MLA KM+ H+A+AWLINTG
Sbjct: 386 FISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYATMLAKKMSEHRANAWLINTG 445

Query: 456 WTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPS 515
           WTG+SY AGGKRCPLKYTRAILDAIH+GSLA E YETLP FNL IP  V  VP ELLNPS
Sbjct: 446 WTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYETLPTFNLHIPTKVNGVPKELLNPS 505

Query: 516 KTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           K W + +  Y+ AV  L  LFV+NF IYQD+AT +V+AAGP +
Sbjct: 506 KNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPEVLAAGPQV 548

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/523 (77%), Positives = 452/523 (86%)

Query: 36  LYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKD 95
           L ++ +TI+RN P A LYED LKE  TT+SS+GAL+AYSG KTGRSP+DKRIV+E +S D
Sbjct: 20  LSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRDKRIVDESTSTD 79

Query: 96  NIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHA 155
           N+WWGPVNK CSE TW INRERA DYL TR  LY++DAYAGWD  YRIK+RVVCAR YHA
Sbjct: 80  NVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYRIKVRVVCARAYHA 139

Query: 156 LFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGT 215
           LFM NMLIRPT +EL  FGEPDFT+WNAG F AN+ T  MTSKT++EINFK MEM+ILGT
Sbjct: 140 LFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVEINFKEMEMIILGT 199

Query: 216 EYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHR 275
           EYAGEMKKGIFTVMFYLMPV HNVLTLHSSANQG+ + DVTLFFGLSGTGKTTLSADPHR
Sbjct: 200 EYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGTGKTTLSADPHR 259

Query: 276 ELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVD 335
            LIGDDEHCWSDHGVFNIEGGCYAKCIGL+ EKEPEI+NAIKFGSVLEN +Y+  T  VD
Sbjct: 260 LLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLENVIYNPQTREVD 319

Query: 336 YDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYH 395
           Y+DS ITENTRCAYPID+I SAKIPCL D HP+N++LLTCDASGVLPPVS+LTPEQVMYH
Sbjct: 320 YEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLPPVSRLTPEQVMYH 379

Query: 396 FISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTG 455
           FISGYTSKMAGTEQGVTEPE TFS+CFGQPFLALHPMKYA MLA+KM  H A+AWLINTG
Sbjct: 380 FISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAKHNANAWLINTG 439

Query: 456 WTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPS 515
           WTG+SY +GGKRCPLKYTRAILD+IH+GSLA E+YETLP FNL IP  V NVPSELLNP+
Sbjct: 440 WTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRVNNVPSELLNPA 499

Query: 516 KTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           K W + +  Y+ AV+ L  LFV+NF  YQD+AT  V++AGP L
Sbjct: 500 KNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQL 542

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/522 (77%), Positives = 455/522 (87%), Gaps = 4/522 (0%)

Query: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100
           I IK NP  A LYED LKE  T +SS+GAL+AYSG KTGRSPKDKRIV E  SKDN+WWG
Sbjct: 55  INIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWWG 114

Query: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160
           PVNKPCSE TW INRER +DYL TR  LYVIDAY GWD  YR+K+RVVCAR YHALFM N
Sbjct: 115 PVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMTN 174

Query: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220
           MLIRPT EEL+NF EPDFT+WNAG F ANS T DMTSKTS+EINFK+MEM+ILGTEYAGE
Sbjct: 175 MLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAGE 234

Query: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280
           MKKGIFTVMFYLMP++HN+LTLHSSAN+G+   DVT+FFGLSGTGKTTLSADP+R LIGD
Sbjct: 235 MKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIGD 294

Query: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340
           DEHCWSDHGVFNIEGGCYAKCIGLT EKEPEIF+AI+FGSVLEN  Y+E  H VDY+D  
Sbjct: 295 DEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDCA 354

Query: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400
           ITENTRCAYPID+I+SAKIPCL + HP NLILLTCDASGVLPPVSKLTPEQVMYHFISGY
Sbjct: 355 ITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 414

Query: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460
           TSKMAGTEQGVTEPE TFS+CFGQPFLALHP+ YA MLA KM+ +K++AWLINTGWTG+S
Sbjct: 415 TSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGSS 474

Query: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520
           Y+AGG RCPLKYTRAILDAIH+G+LANE YETLPVFNL IP +V  VP+E+LNP  +W+ 
Sbjct: 475 YSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWNS 534

Query: 521 P----DVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
           P    +++Y++AV KL +LFV+NF IYQD+ATDDV+AAGP +
Sbjct: 535 PANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/518 (77%), Positives = 453/518 (87%)

Query: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100
           + I+RN P A LYED L E +T +SSTGAL+AYSG KTGRSPKDKRIV+EP+S + +WWG
Sbjct: 25  LIIRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSANKVWWG 84

Query: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160
           PVN+  SE TW INRERA+DYL TR+ LY++DA+AGWD  YRIKIR+VC R YHALFM N
Sbjct: 85  PVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYRIKIRIVCCRAYHALFMTN 144

Query: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220
           MLIRPT EEL  FGEPDFT+WNAG F AN+ T+ M+SKT++EINFK+MEMVILGTEYAGE
Sbjct: 145 MLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFKAMEMVILGTEYAGE 204

Query: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280
           MKKGIFTVMFYLMP+ HNVLTLHSSANQG+  GDVTLFFGLSGTGKTTLSAD HR LIGD
Sbjct: 205 MKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLSGTGKTTLSADQHRLLIGD 264

Query: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340
           DEHCWSD+GVFNIEGGCYAKCIGL+ EKEPEIFNAI++GSVLEN VY+  + VVDYDDS 
Sbjct: 265 DEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLENVVYEPVSRVVDYDDSS 324

Query: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400
           ITENTRCAYPI++I SAKIPCL++ HP+N++LLTCDASGVLPPVSKLTPEQVMYHFISGY
Sbjct: 325 ITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLPPVSKLTPEQVMYHFISGY 384

Query: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460
           TSKMAGTEQGVTEPE TFS+CFGQPFLALHPMKYA MLA+KM+ H A+AWLINTGWTGAS
Sbjct: 385 TSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNANAWLINTGWTGAS 444

Query: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520
           Y +GGKRCPLKYTRAILDAIH GSLAN +YETLPVF L IP+ VE VPSELLNPS+ W +
Sbjct: 445 YVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPRAVEGVPSELLNPSRNWVE 504

Query: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
            +  YS+AV  L +LFVQNF IYQDQAT +V+ AGP L
Sbjct: 505 GEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQL 542

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/518 (77%), Positives = 446/518 (86%)

Query: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100
           +TI+ N P A LYEDGLKE  T + S+GAL AYSG KTGRSPKDKRI+EE +SK+ +WWG
Sbjct: 31  VTIRHNAPAATLYEDGLKEKKTAVVSSGALAAYSGSKTGRSPKDKRIIEEETSKNEVWWG 90

Query: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160
           PVNKP SE TWSINRERA DYL TR  LY+IDAYAGWD  YRIK+RV+CAR YHALFM N
Sbjct: 91  PVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRYRIKVRVICARAYHALFMTN 150

Query: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220
           MLIRP+ EEL NFGEPDFT+WNAG F AN  T+ MTSKT++EINFK+MEM+ILGTEYAGE
Sbjct: 151 MLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTVEINFKAMEMIILGTEYAGE 210

Query: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280
           MKKGIFTVMFYLMPV+HNVLTLHSSANQG+  GDVTLFFGLSGTGKTTLSADPHR LIGD
Sbjct: 211 MKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGLSGTGKTTLSADPHRALIGD 270

Query: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340
           DEHCWSDHGVFNIEGGCYAKCI LT EKEPEI+NAIKFGSVLEN V+D +   VDY D+ 
Sbjct: 271 DEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSVLENVVFDASNREVDYTDNS 330

Query: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400
           ITENTRCAYPID+I SAKIPCL DKHP+N++LLTCDASGVLPPVSKLTPEQVMYHFISGY
Sbjct: 331 ITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVLPPVSKLTPEQVMYHFISGY 390

Query: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460
           TSKMAGTEQGVTEPE TFS+CFGQPFLALHPM+YA MLA KM+ H A+AWL+NTGWTG+S
Sbjct: 391 TSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKKMHQHNANAWLVNTGWTGSS 450

Query: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520
           YTAGGKRCPLKYTRAILD+IH+GSL+  +YETLP+FNL  P  V  VP  LLNP+K+W +
Sbjct: 451 YTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTPAKVNGVPDSLLNPAKSWVE 510

Query: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
               Y+ AVK L + F +NF IYQDQAT DV+AAGP  
Sbjct: 511 GPTKYNSAVKTLATKFTENFKIYQDQATPDVLAAGPQF 548

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/518 (77%), Positives = 455/518 (87%), Gaps = 1/518 (0%)

Query: 42  TIKRNPPIAELYEDGLK-EDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100
           TI+RN P++ LYED LK E +T +SSTGAL+AYSG KTGR PKDKRIVEE  SK++IWWG
Sbjct: 32  TIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCPKDKRIVEESDSKEDIWWG 91

Query: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160
           PVNKPCSE TW INRERA DYL TR+ +Y++DA+AGWD  YRIK+RVVCAR YHALFM N
Sbjct: 92  PVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTN 151

Query: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220
           MLIRPT +ELENFG+PDFT+WNAG F AN  T+DM+SKT+IEINFK+MEM+ILGTEYAGE
Sbjct: 152 MLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIEINFKAMEMIILGTEYAGE 211

Query: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280
           MKKGIFTVMFYLMP++HNVLTLHSSAN+G+   DVTLFFGLSGTGKTTLSADPHR LIGD
Sbjct: 212 MKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLSGTGKTTLSADPHRLLIGD 271

Query: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340
           DEHCWSD GVFNIEGGCYAKCI L+ EKEPEIFN+IKFGS+LEN VYD  +  VDYDDS 
Sbjct: 272 DEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSILENVVYDPKSREVDYDDSS 331

Query: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400
           ITENTRCAYPI+FI SAKIPC+ + HP N+ILLTCDASGVLPPVSKLT +QVMYHFISGY
Sbjct: 332 ITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLPPVSKLTSDQVMYHFISGY 391

Query: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460
           TSKMAGTEQGVTEP+PTFS+CFGQPFLALHPMKYA MLA+KM  HKA+AWLINTGWTG+S
Sbjct: 392 TSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKMEKHKANAWLINTGWTGSS 451

Query: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520
           Y AGGKRCPL YTRAILDAIH+GSL  E +ETLP+FNL +PKNV NVP++LLNPSK W +
Sbjct: 452 YIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLKVPKNVNNVPTKLLNPSKNWYE 511

Query: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
            ++ YS AVKKL  LF++NF  Y+D+AT +V+AAGP L
Sbjct: 512 GELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGPRL 549

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/518 (77%), Positives = 453/518 (87%), Gaps = 1/518 (0%)

Query: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100
           +TI+RN P A LYED L E  T +SSTGAL+AYSG KTGRSPKDKRIV+EP+S DNIWWG
Sbjct: 25  LTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWG 84

Query: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160
           PVN+  SE TW INRERA D+L TR+ LY++DAYAGWD  YRIKIR+VC R YHALFM N
Sbjct: 85  PVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIRIVCCRAYHALFMTN 144

Query: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220
           MLIRPT EEL  FGEPDFT+WNAG F AN+ T+ M+SKT++EINF++MEMVILGTEYAGE
Sbjct: 145 MLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFRAMEMVILGTEYAGE 204

Query: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280
           MKKGIFTVMFYLMP+ HNVLTLHSSANQG NN DVTLFFGLSGTGKTTLSAD HR+LIGD
Sbjct: 205 MKKGIFTVMFYLMPINHNVLTLHSSANQGPNN-DVTLFFGLSGTGKTTLSADQHRKLIGD 263

Query: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340
           DEHCWSD+GVFNIEGGCYAKCIGL+ EKEPEIFNAIK+GSVLEN VYD  T VVDY+DS 
Sbjct: 264 DEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSS 323

Query: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400
           ITENTRCAYPI++I SA+IPCL++ HP+N++LLTCDASGVLPPVS+LTPEQVMYHFISGY
Sbjct: 324 ITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGY 383

Query: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460
           TSKMAGTEQGVTEPE TFS+CFGQPFLALHPMKYA MLA+KM+ H ASAWLINTGWTG+S
Sbjct: 384 TSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWTGSS 443

Query: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520
           YTAGGKRCPLKYTRAILD+IH+G+LA  EYETLPVF L IPK VE VP+ELLNP+K W +
Sbjct: 444 YTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKNWVE 503

Query: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558
            +  Y+ AV  L S F +NF IYQDQAT++V+ AGP +
Sbjct: 504 GEGKYASAVSALASKFTENFKIYQDQATEEVVRAGPQI 541

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/558 (71%), Positives = 461/558 (82%), Gaps = 14/558 (2%)

Query: 1   MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED 60
           M+PTK  ++ ++ +++I + L     V             +TI+RN P A LYED LKE+
Sbjct: 1   MSPTKTRNH-VSAKDHIRQELALGEEV-------------VTIRRNAPAALLYEDALKEN 46

Query: 61  STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID 120
            TT++S+GAL+A+SG KTGRSPKDKRIV+EP+S  NIWWGPVNK CSE TW +NRERA D
Sbjct: 47  KTTIASSGALIAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAAD 106

Query: 121 YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI 180
           YL TR  LY++DAYAGWD  YRIKIRVVCAR YHALFM NMLIRPT EELENFGEPDFT+
Sbjct: 107 YLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTV 166

Query: 181 WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL 240
           WNAG F AN+ T  MTSKT++EINF+ MEMVILGTEYAGEMKKGIFTVMFYLMPV HNVL
Sbjct: 167 WNAGQFPANTHTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVL 226

Query: 241 TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK 300
           TLHSSANQG+ + DVTLFFGLSGTGKTTLSADP R+LIGDDEHCWSDHGVFNIEGGCYAK
Sbjct: 227 TLHSSANQGIRDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAK 286

Query: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP 360
           CIGLTE KEPEIFNAIKFGSVLEN  YD  T VVDY+D  ITENTRCAYPI++I SAKIP
Sbjct: 287 CIGLTEAKEPEIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIP 346

Query: 361 CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA 420
           CL + HP N++LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFS+
Sbjct: 347 CLANSHPKNIVLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSS 406

Query: 421 CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI 480
           CFGQPFLALHP+KYA MLA+KM+ H+A+AWLINTGWTGAS+  GG RCPLKYTRAILDA+
Sbjct: 407 CFGQPFLALHPLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAV 466

Query: 481 HNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNF 540
           H+GSLA E++ETLP F L +P++V NVP  +LNP+K W + +  Y   V  L  LF +NF
Sbjct: 467 HDGSLAQEDFETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENF 526

Query: 541 TIYQDQATDDVIAAGPAL 558
             YQD+A+ DVI+AGP L
Sbjct: 527 KKYQDRASADVISAGPVL 544

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/558 (70%), Positives = 458/558 (82%), Gaps = 14/558 (2%)

Query: 1   MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED 60
           M+P+KI +  ++ ++ I K L     V             +TI+RN P A LYED LKE+
Sbjct: 1   MSPSKIRNL-VSVKDRIRKELALGEEV-------------VTIRRNAPAALLYEDALKEN 46

Query: 61  STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID 120
            T +S++GAL+A+SG KTGRSPKDKRIV+EP+S  NIWWGPVNK CSE TW +NRERA D
Sbjct: 47  KTRISASGALIAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAAD 106

Query: 121 YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI 180
           +L TR  LY++DAYAGWD  YRIKIRVVCAR YHALFM NMLI+PT +ELE FGEPDFT+
Sbjct: 107 FLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTV 166

Query: 181 WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL 240
           WNAG F AN+ T  MTSKT+IEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP+ H VL
Sbjct: 167 WNAGQFPANTHTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVL 226

Query: 241 TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK 300
           TLHSSANQG+ + DVTLFFGLSGTGKTTLSADP R+LIGDDEHCWSDHGVFNIEGGCYAK
Sbjct: 227 TLHSSANQGIRDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAK 286

Query: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP 360
           CIGLTE KEPEIFNAI+FGSVLEN  YD  T  VD+++  ITENTRCAYPI++I SAKIP
Sbjct: 287 CIGLTEAKEPEIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIP 346

Query: 361 CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA 420
           CL D+HP N++LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFS+
Sbjct: 347 CLADEHPKNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSS 406

Query: 421 CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI 480
           CFGQPFLALHP+KYA MLADKM+HHKA AWLINTGWTG S+  GG RCPLKYTRAILDAI
Sbjct: 407 CFGQPFLALHPLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAI 466

Query: 481 HNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNF 540
           H+G+LA EEYETLP FNL IP +V NVPS +LNP+++W   +  Y   V+ L +LFV+NF
Sbjct: 467 HDGTLAKEEYETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENF 526

Query: 541 TIYQDQATDDVIAAGPAL 558
             Y+  A+ +++ AGP L
Sbjct: 527 KKYEANASTEIMCAGPLL 544

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 56/113 (49%), Gaps = 22/113 (19%)

Query: 387 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHK 446
           LT E+VMYHF SG+ S   G                 +PFLALHP+ Y  ++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 447 ASAWLINTGWTGASYTAGGKRCPLKYTRAILDAIHNGSLANE-----EYETLP 494
            SA+LINTG+             LK TR   D+IH+ SLA E      Y+ LP
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 6/82 (7%)

Query: 247 NQGVNNGDVTLFFGLSGTGKTTLSADPHREL-IGDDEHCWSDHGVFNIEGGCYAKCIGLT 305
           N  +N G+     G SG+GK+T+++   R   + +      D+ + N     Y + IG T
Sbjct: 467 NLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-T 525

Query: 306 EEKEPEIFNAIKFGSVLENCVY 327
            ++EP +FN    GS+L+N +Y
Sbjct: 526 VQQEPSLFN----GSILDNIIY 543

>SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} similar
           to uniprot|Q05670 Saccharomyces cerevisiae YMR232W FUS2
           Cytoplasmic protein localized to the shmoo tip required
           for the alignment of parental nuclei before nuclear
           fusion during mating
          Length = 706

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 17/139 (12%)

Query: 77  KTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWS-INRERAIDYLNTRK--------- 126
           K GR  +DK I+++     N+ W   N+P  + T+S ++  +  DY+             
Sbjct: 103 KRGRDEEDKEIIQKKPPSLNLVWDAFNEPSQKKTYSPLDLHKFKDYMTLESPRIDPKLSN 162

Query: 127 ILYVIDAYAGWDANYRIKIRV---VCARPYHA--LFMNNMLIRPTTEELENFGEPDFTIW 181
           +L  I      +  Y   + +   V  R  H    F N +L + + EEL  FG  D TI+
Sbjct: 163 LLQTIQNLVETEEKYARVLEISNAVYRRELHENRKFKNKLLNKNSNEELLLFGNID-TIF 221

Query: 182 NAGSFYANSLTKDMTSKTS 200
           +    +  S+  D  SK S
Sbjct: 222 SLSKIFVRSIM-DSLSKCS 239

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 56/139 (40%), Gaps = 26/139 (18%)

Query: 242  LHSSANQGVNNGDVTLFFGLSGTGKTTL--------SADPHRELIGDDEHCWSDHGVFNI 293
            ++ + N  +N G      G SG+GK+TL           P    I   + C       N 
Sbjct: 1063 IYKNFNLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDIC-------NW 1115

Query: 294  EGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDF 353
            E     K I + E+K P  FN    G++ EN VY     + D +   +    R    I+F
Sbjct: 1116 EMSALRKIIAVVEQK-PRFFN----GTIRENLVYGLEGTITDNEIYEVLAEVRI---INF 1167

Query: 354  IESAKIP-CLTDKHPTNLI 371
            + S  +P  L  +  TNL+
Sbjct: 1168 VRS--LPEGLETRVDTNLV 1184

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 48/116 (41%), Gaps = 9/116 (7%)

Query: 242  LHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDH-GVFNIEGGCYAK 300
            ++   N  V  G+     GLSG+GK+TL     R         W D   V   E     K
Sbjct: 1077 VYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRK 1136

Query: 301  CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIES 356
             I + E++ P +F     GS+ +N  Y  +T V   D+  I E       +DF+ S
Sbjct: 1137 RIAVVEQR-PSLFR----GSIFDNLTYGLSTSV---DEREIRELLELVGMMDFVNS 1184

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 462 TAGGKRCPLKYTR----AILDAIHN-----GSLANEEYETLPVFNLPIPKNVENVPSELL 512
           T    +CP+ +T+    AI   ++N      S+   E E +P+  +  PK ++N+P E  
Sbjct: 354 TKAPNKCPIDHTKYQELAITSKVNNQPITSASIQKSEEEKIPIIQMTSPKIIKNIPLEST 413

Query: 513 NP 514
           NP
Sbjct: 414 NP 415

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 236 YHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSA---DPHRELIGDDEHCWSDHGVFN 292
           Y N  ++ S  N  ++ G+   F G SG GK+T+S+     +R   G+      D   FN
Sbjct: 375 YSNGKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFN 434

Query: 293 IEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVY 327
           +    Y + +G+ ++ EP +FN    G++L+N  Y
Sbjct: 435 LR--KYRRMLGVVQQ-EPLLFN----GTILDNITY 462

>ZYRO0C15070g Chr3 (1172681..1175476) [2796 bp, 931 aa] {ON} similar
           to uniprot|P40462 Saccharomyces cerevisiae YIL137C
           RBF108 Hypothetical ORF
          Length = 931

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 12/86 (13%)

Query: 348 AYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKL----TPEQVM--------YH 395
           +YP+D ++   +P LTD    N  +++   S +L P S L    T +Q+M        + 
Sbjct: 279 SYPLDKLDFVLLPFLTDMAMENFGMISIQTSHLLIPPSMLADVYTRQQLMQLIVHELVHQ 338

Query: 396 FISGYTSKMAGTEQGVTEPEPTFSAC 421
           ++  Y S  +       E   TF+AC
Sbjct: 339 WVGNYVSFDSWCHLWFNESFATFTAC 364

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 20/110 (18%)

Query: 247 NQGVNNGDVTLFFGLSGTGKTTLSA------DPHRELIGDDEHCWSDHGVFNIEGGCYAK 300
           N  +N G+     G SG+GK+T+S+      DP   L G       D   +++    Y K
Sbjct: 482 NIKINPGEHVCIIGPSGSGKSTISSLLLRYYDP---LAGTISIGGKDIKEYSLRK--YRK 536

Query: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRIT---ENTRC 347
            +G+  + EP +FN    G++LEN +Y+    + + D  R++   E++ C
Sbjct: 537 LMGVVHQ-EPVLFN----GTILENILYNVPEEIAN-DKERLSNAIESSNC 580

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,370,418
Number of extensions: 2998096
Number of successful extensions: 8921
Number of sequences better than 10.0: 47
Number of HSP's gapped: 9116
Number of HSP's successfully gapped: 47
Length of query: 558
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 443
Effective length of database: 40,294,809
Effective search space: 17850600387
Effective search space used: 17850600387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)