Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1043.745.707ON1771777571e-103
NCAS0G002105.707ON2881681114e-06
TPHA0E001805.707ON165101900.001
Suva_9.365.707ON22498840.013
TBLA0I016905.707ON320101810.041
Skud_9.165.707ON22698790.048
YIL152W5.707ON23524750.16
Smik_9.175.707ON25124750.21
ZYRO0B16434g5.707ON23796740.26
NDAI0F002705.707ON298111730.33
KLTH0E00946g5.707ON21577730.33
Ecym_70918.596ON28334672.1
TDEL0B021305.707ON20823645.0
NOTE: 6 genes in the same pillar as Kpol_1043.74 were not hit in these BLAST results
LIST: KAFR0D02200 Kwal_55.19675 KLLA0A00506g KNAG0L02160 Cgla_YGOB_Anc_5.707 SAKL0E15026g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1043.74
         (177 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...   296   e-103
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    47   4e-06
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    39   0.001
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     37   0.013
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    36   0.041
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)     35   0.048
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    33   0.16 
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     33   0.21 
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    33   0.26 
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    33   0.33 
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    33   0.33 
Ecym_7091 Chr7 complement(175846..176697) [852 bp, 283 aa] {ON} ...    30   2.1  
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    29   5.0  

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score =  296 bits (757), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 151/177 (85%)

Query: 1   MTTSTRNSXXXXXXXXXXXXXXXXXPPLHQQPSTELNNIFNNTKFKGFKKRNKHVPTTAN 60
           MTTSTRNS                 PPLHQQPSTELNNIFNNTKFKGFKKRNKHVPTTAN
Sbjct: 1   MTTSTRNSRRIGSIIKRKKIIHKKKPPLHQQPSTELNNIFNNTKFKGFKKRNKHVPTTAN 60

Query: 61  IYSTSNNQLSVSKYSPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCL 120
           IYSTSNNQLSVSKYSPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCL
Sbjct: 61  IYSTSNNQLSVSKYSPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCL 120

Query: 121 VVDHNEMTKNIILYKXXXXXXXXXITLPTTFAKIAINSNSFVHLYGNVNWYLHWRPL 177
           VVDHNEMTKNIILYK         ITLPTTFAKIAINSNSFVHLYGNVNWYLHWRPL
Sbjct: 121 VVDHNEMTKNIILYKNNNNNNNANITLPTTFAKIAINSNSFVHLYGNVNWYLHWRPL 177

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 70/168 (41%), Gaps = 23/168 (13%)

Query: 31  QPSTELNNIFNNTKFKGFKKRNKHVPTTANIY----------STSNNQLSVSKYS---PS 77
           +P   +NNI +N   +     N   P +   Y           TS + +S    S   P 
Sbjct: 116 KPLKSINNIMDNVTIRQSDTLNVEPPRSKRPYLNYPLPKKLSRTSTSDVSSRDNSNNEPK 175

Query: 78  LL--SLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYC-------LVVDHNEMT 128
           +   SL   L   +T++++     +D VW I     LS F++         L++ HN+ +
Sbjct: 176 IFVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTS 235

Query: 129 -KNIILYKXXXXXXXXXITLPTTFAKIAINSNSFVHLYGNVNWYLHWR 175
             NI + K             T   K+AINS SF+ +  ++NWY+ W+
Sbjct: 236 INNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWK 283

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 6/101 (5%)

Query: 75  SPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCLVVDHNEMTKNIILY 134
           S S+  L  S+  FN ++++ S  K+D +  I   + LSQ +     +D    +K +IL+
Sbjct: 56  SASVSDLRLSINKFNMLLKASSN-KYDEIHDINSIEKLSQNEFIVTTID----SKTLILH 110

Query: 135 KXXXXXXXXXITLPTTFAKIAINSNSFVHLYGNVNWYLHWR 175
                           + ++AINS  ++ LY ++NWYL W+
Sbjct: 111 SNEKNVVNSN-NYTLKYQQVAINSKYYLSLYNDLNWYLDWK 150

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 81  LHNSLYVFNTIVRSGSLLKFDHVWHIL-HFQLLSQFQIYCLVVDHNEMTKNIILYKXXXX 139
           LH+S+   +TIV++    +FD + H L H  +LS  ++  L+  H E T  IIL+     
Sbjct: 130 LHSSVKDLDTIVQTHKP-RFDTIIHDLSHTTILSPNEL--LIKLHTEDT--IILHSRTPI 184

Query: 140 XXXXXI--TLPTTFAKIAINSNSFVHLYGNVNWYLHWR 175
                +   +    A + I+S SF+ L  N+ WYLHW+
Sbjct: 185 INAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWK 222

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 5/101 (4%)

Query: 75  SPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCLVVDHNEMTKNIILY 134
           +P +  LH  L   NT + S   LKFD ++ I     LS  ++  LV+ +   T + +L 
Sbjct: 223 TPLVNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTEL--LVITN---TNSSLLL 277

Query: 135 KXXXXXXXXXITLPTTFAKIAINSNSFVHLYGNVNWYLHWR 175
                         T   K+A NS S + +  ++NWYL W+
Sbjct: 278 HSDSTIGQSEFNNYTLKEKVATNSISILKITEDLNWYLKWK 318

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 8/98 (8%)

Query: 81  LHNSLYVFNTIVRSGSLLKFDHVWHIL-HFQLLSQFQIYCLVVDHNEMTKNIILYKXXXX 139
           LH S+   +TIV++    +FD + H L H  +LS  ++   +     M   IIL+     
Sbjct: 132 LHTSVKDLDTIVQTHKP-RFDTIIHDLSHTAILSSNELLIKL----PMNDTIILHSRIPK 186

Query: 140 XXXXXITLPTT--FAKIAINSNSFVHLYGNVNWYLHWR 175
                +   T+   A + I+S SF+ L  N+ WYLHW+
Sbjct: 187 INAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWK 224

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 152 AKIAINSNSFVHLYGNVNWYLHWR 175
           A + I+S SF+ L  N+ WYLHW+
Sbjct: 210 ASLVIDSRSFLTLCNNIKWYLHWK 233

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 152 AKIAINSNSFVHLYGNVNWYLHWR 175
           A + I+S SF+ L  N+ WYLHW+
Sbjct: 226 ASLVIDSRSFLILCNNIKWYLHWK 249

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 14/96 (14%)

Query: 84  SLYVFNTIVRSGSLLK-FDHVWHILHFQLLSQFQIYCLVVDHNEMTKNIILYKXXXXXXX 142
           +L  FN +V++    + +D +  I H   LS F+I  +V+  +   K  IL+        
Sbjct: 150 ALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEI--MVISDDPRVKRAILHSHK----- 202

Query: 143 XXITLPT---TFAKIAINSNSFVHLYGNVNWYLHWR 175
               +P    + +++AI S   + LY ++NWYL W+
Sbjct: 203 ---AIPKFVNSPSRLAICSKCCLTLYNDMNWYLKWK 235

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 3/111 (2%)

Query: 68  QLSVSKYSPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCLVVDHNEM 127
            L  +K S  L SL  SL   +T +++ S   +D +  +  F++LS  +I    V +   
Sbjct: 186 DLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYTA 245

Query: 128 TKNIILYKXXXXXXXXXITLPTTF---AKIAINSNSFVHLYGNVNWYLHWR 175
                +           + LP       K+A++S  ++ L  NV WYL W+
Sbjct: 246 GFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWK 296

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 99  KFDHVWHILHFQLLSQFQIYCLVVDHNEMTKNIILYKXXXXXXXXXITLPTTFAKIAINS 158
           ++D   H+ + +LLS  ++  L V    + + +++              P + +++ ++S
Sbjct: 142 EYDRKLHVQYTKLLSPTEL--LAVAAGPLGREVLILHMLPSTKDAE---PKSGSQLLLSS 196

Query: 159 NSFVHLYGNVNWYLHWR 175
           N+   LY  + WY  WR
Sbjct: 197 NASALLYPGLRWYFEWR 213

>Ecym_7091 Chr7 complement(175846..176697) [852 bp, 283 aa] {ON}
           similar to Ashbya gossypii AGR220C
          Length = 283

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 102 HVWHILHFQLLSQFQIYCLVV--DHNEMTKNIIL 133
           H+WHI+ +    + +IYC+    + N+M   II+
Sbjct: 55  HIWHIVLYNDTGELEIYCMCYFKERNDMEPKIIM 88

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 153 KIAINSNSFVHLYGNVNWYLHWR 175
           K+A+NS  +  LY +V W++ W+
Sbjct: 184 KLAVNSQCYYVLYNDVVWFMRWK 206

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.133    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,604,747
Number of extensions: 729507
Number of successful extensions: 2890
Number of sequences better than 10.0: 42
Number of HSP's gapped: 2944
Number of HSP's successfully gapped: 43
Length of query: 177
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 75
Effective length of database: 41,785,467
Effective search space: 3133910025
Effective search space used: 3133910025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)