Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1043.735.706ON1260126061320.0
TPHA0E001905.706ON136198532480.0
ZYRO0B16412g5.706ON137296728370.0
TDEL0B021405.706ON114793528290.0
KNAG0C066305.706ON1281100327600.0
KAFR0H001805.706ON124197427530.0
Smik_11.3605.706ON118095726580.0
SAKL0E15004g5.706ON119697526170.0
NCAS0A031705.706ON1319103026090.0
Kwal_55.196785.706ON117895825890.0
Skud_11.3365.706ON118894825850.0
KLTH0E00968g5.706ON114896525710.0
Suva_11.3335.706ON118795425640.0
YKR096W5.706ON119595525640.0
CAGL0G02541g5.706ON129594324950.0
CAGL0H06611g5.706ON1282101824150.0
Skud_9.175.706ON111895423980.0
Smik_9.185.706ON111895823880.0
YIL151C5.706ON111895423830.0
Suva_9.375.706ON111795623830.0
AFR290W5.706ON121797323790.0
Ecym_40155.706ON125796523460.0
KLLA0A00528g5.706ON122996722850.0
NDAI0E050705.706ON155637812561e-148
TBLA0E017105.706ON152640911191e-129
TPHA0D046405.706ON9629343992e-38
Skud_1.67.9ON88088791.6
NCAS0G016102.48ON840112754.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1043.73
         (1260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  2366   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...  1255   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1097   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1094   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1067   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1065   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1028   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1012   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  1009   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1001   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1000   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   994   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   992   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   992   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   965   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   934   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   928   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   924   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   922   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   922   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   920   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   908   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   884   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   488   e-148
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   435   e-129
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   158   2e-38
Skud_1.6 Chr1 (15260..17902) [2643 bp, 880 aa] {ON} YAL056W (REAL)     35   1.6  
NCAS0G01610 Chr7 complement(285839..288361) [2523 bp, 840 aa] {O...    33   4.3  

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 2366 bits (6132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1161/1260 (92%), Positives = 1161/1260 (92%)

Query: 1    MSIPLPNLNLRRDEGQDLSASQSNEQISLNIRNERLRKNNIQDLRDQTKQMNLQSTNQNT 60
            MSIPLPNLNLRRDEGQDLSASQSNEQISLNIRNERLRKNNIQDLRDQTKQMNLQSTNQNT
Sbjct: 1    MSIPLPNLNLRRDEGQDLSASQSNEQISLNIRNERLRKNNIQDLRDQTKQMNLQSTNQNT 60

Query: 61   KNLGQKRHGSSSYYITPNYIKKRVAKNSYNSATGNFLXXXXXXXXXXXXQTSLQNTPLAS 120
            KNLGQKRHGSSSYYITPNYIKKRVAKNSYNSATGNFL            QTSLQNTPLAS
Sbjct: 61   KNLGQKRHGSSSYYITPNYIKKRVAKNSYNSATGNFLDSGSNGGGDISNQTSLQNTPLAS 120

Query: 121  PKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLNSNLPSNLDIVSNENLEDSIRKDQDFS 180
            PKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLNSNLPSNLDIVSNENLEDSIRKDQDFS
Sbjct: 121  PKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLNSNLPSNLDIVSNENLEDSIRKDQDFS 180

Query: 181  QINQAIKDKMMRPLSVRNDSFVYQVSNFPSPENTEPHLHTFEKNTSIQNYSSNDNIVPDN 240
            QINQAIKDKMMRPLSVRNDSFVYQVSNFPSPENTEPHLHTFEKNTSIQNYSSNDNIVPDN
Sbjct: 181  QINQAIKDKMMRPLSVRNDSFVYQVSNFPSPENTEPHLHTFEKNTSIQNYSSNDNIVPDN 240

Query: 241  DMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTVEDFNDMSHXXXXXXXXXXXXXXXXX 300
            DM                              GTVEDFNDMSH                 
Sbjct: 241  DMDIGNENANNESNDSNNNNNNNDFNGESGNNGTVEDFNDMSHNVGGNGDEDKDNKDNGD 300

Query: 301  XXXXXXXXXXXXXXXQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKL 360
                           QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKL
Sbjct: 301  NNDVPSVSVPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKL 360

Query: 361  NADLINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFM 420
            NADLINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFM
Sbjct: 361  NADLINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFM 420

Query: 421  DPEVCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERW 480
            DPEVCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERW
Sbjct: 421  DPEVCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERW 480

Query: 481  YMAAMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRA 540
            YMAAMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRA
Sbjct: 481  YMAAMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRA 540

Query: 541  FADRNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKM 600
            FADRNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKM
Sbjct: 541  FADRNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKM 600

Query: 601  FQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXX 660
            FQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYL        
Sbjct: 601  FQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKE 660

Query: 661  XXXXXNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISL 720
                 NQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISL
Sbjct: 661  KRKPKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISL 720

Query: 721  WNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEF 780
            WNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEF
Sbjct: 721  WNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEF 780

Query: 781  WYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDL 840
            WYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDL
Sbjct: 781  WYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDL 840

Query: 841  PEVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKR 900
            PEVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKR
Sbjct: 841  PEVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKR 900

Query: 901  SVRVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDM 960
            SVRVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDM
Sbjct: 901  SVRVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDM 960

Query: 961  LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTW 1020
            LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTW
Sbjct: 961  LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTW 1020

Query: 1021 SINQDTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRK 1080
            SINQDTGVNGGPL            DPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRK
Sbjct: 1021 SINQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRK 1080

Query: 1081 FGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEA 1140
            FGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEA
Sbjct: 1081 FGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEA 1140

Query: 1141 ATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK 1200
            ATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK
Sbjct: 1141 ATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK 1200

Query: 1201 RKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYLRTIDESKRQLAIN 1260
            RKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYLRTIDESKRQLAIN
Sbjct: 1201 RKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYLRTIDESKRQLAIN 1260

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score = 1255 bits (3248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/985 (61%), Positives = 750/985 (76%), Gaps = 45/985 (4%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            Q LVQKLQDIYK I+KQE+ELQERC +LTNSQTTE+KNLW IY++N++L++NY+TFITTA
Sbjct: 382  QVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITTA 441

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            + P+Q +SD  IG+EI++IYKIERRLWVYGTITFLD+LKNFSNFMDPEVCCQFI HVFIS
Sbjct: 442  IHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFIS 501

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML DIPQKY + W QKLGDLSRMA+AL+PS FIDWKLSAERWYMAAME++YG+GKLY
Sbjct: 502  ISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKLY 561

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKS+FC+NTFVPSQQYLQLVI NIYQRA+AD N+S+N RN QL
Sbjct: 562  YHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRNDQL 621

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            LVDY+KH EV LLPNF ES +LQQVVL+YF++KFG+DYNN++  MF  R+MF+QNNDQ K
Sbjct: 622  LVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNNDQFK 681

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
             ++R++ AFAE+QILQ+VGYGN K+PF+LLF LPKYL               ++ +    
Sbjct: 682  CFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKITQP 741

Query: 676  TTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKC 735
              +    G         NVFL +E+FF NID +   +FMPNS+ +WN SL+Y N  + KC
Sbjct: 742  RLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKC 801

Query: 736  SMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMV 795
            SMIV +KFL+ P M+ALPH LPW YF+ISI LQ++K+++ AM EFW  F++RIFPWNS+V
Sbjct: 802  SMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIV 861

Query: 796  RFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDII 855
            +FLNVLLAYM+DNCW+ S LNELC  Y S++L+ELL  FN NE+LPEVWKCRGSLWFD I
Sbjct: 862  KFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFDTI 921

Query: 856  DEKRNSQ-------------NCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSV 902
             EK N               N + Y   G+KDY+F DFP+DG +FDE+DEIG +FWKR+ 
Sbjct: 922  MEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAA 981

Query: 903  RVIFLFRGIVERFNGFGNLAISYNAPVINRRG--LGVNS---HLVGYSFKLMAKSDDIMF 957
            RVIFLF+ + E + G G L +SY APV NRR     VN+    L+ +SFKL A SD +M 
Sbjct: 982  RVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNASSDGVML 1041

Query: 958  DDMLVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFY 1017
            DD++ S FE  D  N D +  P+LSM+ G++IF+YVGYKR+  ++YSFDKNGD ISTSF+
Sbjct: 1042 DDIIES-FETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDFISTSFF 1100

Query: 1018 NTWSINQ--------------DTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYD 1063
            N+WSI                D  ++ G              DPMNE  +FN+CFDP+Y 
Sbjct: 1101 NSWSIKNLTNELSRNTCSSITDDAISSG--SGNDSAAASTNNDPMNELLVFNECFDPKYK 1158

Query: 1064 SVDEFWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTF 1123
            +++EFW++EIY D   +  + L   TYFILDATSWLRHFAH+YKIAT+ ILKF+ICLTTF
Sbjct: 1159 TLEEFWSQEIYPD--SQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAICLTTF 1216

Query: 1124 QELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWR 1183
            QELR+LRKSKD NVVEAATRAIITLRQL+ E  LLPLRFTGNVATHIEEHLEFEEQITWR
Sbjct: 1217 QELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWR 1276

Query: 1184 SHVDEFVIEAVIKAETKRKEQ--------EMHNMKGFQIVLVTDDSNMKNKALEKGSKTF 1235
            SHVDEFVIEAV+KAE KR ++        +      F I+LVTDD  MKNKA+++  KTF
Sbjct: 1277 SHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAMDRKIKTF 1336

Query: 1236 STRFVFAISNYLRTIDESKRQLAIN 1260
            STRF+F+++NY+RT++E   +LAIN
Sbjct: 1337 STRFIFSMANYIRTMEEGHNKLAIN 1361

 Score = 59.7 bits (143), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 95/216 (43%), Gaps = 35/216 (16%)

Query: 49  KQMNLQSTNQNTKNLGQKRHGSSSY-YITPNYIKKRVAKNS-----YNSATGNFLXXXXX 102
           K M   +T+    N+GQKRHGS+SY Y+ P  +K+R+A N+        ++ NF      
Sbjct: 31  KAMMQNNTSVEHDNVGQKRHGSNSYKYLQPGIVKRRLAGNNNGDIHIQESSSNFDPKYSS 90

Query: 103 XXXXXXXQTSL---------------QNTPLASPKPSIAKNNIINTSTTPQPTYITQDSM 147
                    +L               +NTP+ASPK +  K +  N + TPQ + +  D  
Sbjct: 91  FAYSRKDPINLTTVDAPFIDLRPYVTENTPIASPKRNAIKKHQNNIAVTPQQSLVGNDIA 150

Query: 148 TSPFVLNSNLPSNLDIVSNENLEDSIRKDQDFSQINQ-AIKDKMMRPLSVR------NDS 200
           T        L  +  ++SN  +  +     D S IN  ++K+ + R  S+        D 
Sbjct: 151 TL-------LSMDQKVLSNPEILKATEPIIDDSMINNISLKNSLSRERSLNPGVNNIEDI 203

Query: 201 FVYQVSNFPSPENTEPHLHTFEKNTSIQNYSSNDNI 236
           F    SNFPSPEN    ++    N++ +N  + + I
Sbjct: 204 FKIAASNFPSPENETMIMNNININSTTKNGMAQNKI 239

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1097 bits (2837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/967 (57%), Positives = 692/967 (71%), Gaps = 57/967 (5%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QALVQKLQDIYK+I+KQE+ELQERCSQLT SQTTE+KNLW IYK+N+DLINNYVTF+TTA
Sbjct: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L PSQ++ D+LIGEEIV+IY+IERRLWVYGTITFLD+ KNFSNFMDPEVCCQFITHVFIS
Sbjct: 475  LLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML DIP KY IPWLQ+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+++Y +GKLY
Sbjct: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKSVFCQ+TF+PSQQY+QLVIDNIYQRAF +RN + N RN Q 
Sbjct: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERN-NGNHRNTQ- 652

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            L++YLKHSEVMLLP+F+ES DLQQVVL+YF  KFG D  +NNV +F  R+MF QN D L+
Sbjct: 653  LIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCD--SNNVNIFDTRKMFCQNPDYLR 710

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
            ++FRHA AFAE+ ILQLVG+G+PKNPFALLF LP++L             +       + 
Sbjct: 711  YFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKST------TV 764

Query: 676  TTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKC 735
            T  SS   ++ + + +++     E FF NI+ L     +P+++ +WN+SL Y N T+ KC
Sbjct: 765  TETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKC 824

Query: 736  SMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMV 795
            SM+VLQKFL GPL+VALPH +PW YF+IS+A +I+     +  +FW  F+ RIFPWN++V
Sbjct: 825  SMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIV 884

Query: 796  RFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDII 855
             FLNVL+AYM+DN W +S ++ LC QY S+ LE+LL  FN NE LPEVWKC G+LWFD I
Sbjct: 885  SFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTI 944

Query: 856  DEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERF 915
              K  S   +     GIK++ FLD P+DGI FD NDE G  FWKR+ R+IFLF+G+ E F
Sbjct: 945  CNKEQSH-VEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENF 1003

Query: 916  NGFGNLAISYNAPVINRRGLGVNSHLV-GYSFKLMAKSDD--------------IMFDDM 960
                 + +S  APV  RR      H++  +SFKL   SD               I  D +
Sbjct: 1004 P--IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHL 1061

Query: 961  --LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYN 1018
               +  FEE    N   + IP+LS+I GE+IF+Y GY+R+H DY+S+DKNG+ +S S Y 
Sbjct: 1062 KNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYT 1121

Query: 1019 TWSINQDTGVNGG-PLXXXXXXXXXXXXDPMNEKELFNKCFDPEYD---SVDEFWNKEIY 1074
            +W  N +T   G  P               + E  +FN+  +P Y    + D F    +Y
Sbjct: 1122 SWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALY 1181

Query: 1075 DDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKD 1134
                          TYF+LD T+WLRHF H+YK+A++ +LKF+ICLTTF ELRFLRK KD
Sbjct: 1182 QTAHSS-------TTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKD 1234

Query: 1135 ENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAV 1194
            ENVVEAATRAIIT+RQL+SEGKLLPLRFTGNVATHIEEHLEFEE+ITWRSHVDEFVIEAV
Sbjct: 1235 ENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAV 1294

Query: 1195 IKAETKRKE---------------QEMHNMKGFQ-IVLVTDDSNMKNKALEKGSKTFSTR 1238
             KA++K +E               +   +  G + +VLVTDDSNM+ KA ++  +TFST+
Sbjct: 1295 YKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTK 1354

Query: 1239 FVFAISN 1245
            FVF++ N
Sbjct: 1355 FVFSLCN 1361

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/935 (59%), Positives = 682/935 (72%), Gaps = 41/935 (4%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QALVQKLQDIYK+I+KQE+ELQERCSQLTNSQTTE+K LWVIYK+N+DLINNYVTFITTA
Sbjct: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L P QS  DL IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVFIS
Sbjct: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML DIP +YAIPW Q+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+Y YG+GKLY
Sbjct: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQY+QLVIDNIYQRAF +RN + N RN Q 
Sbjct: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERN-NGNHRNSQ- 475

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            L++YLKHSEVMLLP+F+ES DLQQVVL+YF +KFG+D N NN+  F  RQMF QN DQLK
Sbjct: 476  LIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNI--FDTRQMFDQNPDQLK 533

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
            ++FRHA AFAE+ ILQLVG+G+PKNPFALLF LP+ L             + +  E  S+
Sbjct: 534  YFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSSA 593

Query: 676  TTFSSVSGMEYMVNMETNVFLGS--EDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTAT 733
                ++   EY   ++++  LG+  + FF+NID L      P S+ +WN SLKY N T+ 
Sbjct: 594  M---AIDEEEY---IDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSL 647

Query: 734  KCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNS 793
             CSMIVL+KFL GP++VALPH+LPW YF+I++  +++   D A  EFW   + RIFPWN+
Sbjct: 648  HCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNT 707

Query: 794  MVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFD 853
            +V FLNVL+AY +DN   + P++ LC++  ++ L++L+ +FN NEDLPEVWKC G LWFD
Sbjct: 708  IVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFD 767

Query: 854  IIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVE 913
             I +K   Q  DSY   GIKD+ FLD P+DGI FD +DE GIKFWKR+ RVIFLF+ I E
Sbjct: 768  AICDKDKVQ-MDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAE 826

Query: 914  RFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKL---MAKSDDIMFDDMLVSNFEEIDS 970
             F     L +S  A V  RR   +N  L  + FKL      S+ ++ + + V  FEE   
Sbjct: 827  NFQ--TRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSVLQNTIEV--FEEGSD 882

Query: 971  NNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNG 1030
             N D    P LS++  E+IF YVGYKR+ +D   +D+ G+ +STS Y +W    +T  N 
Sbjct: 883  ANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWG--NETSKNE 940

Query: 1031 GPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRKFGMELYEDTY 1090
             P                NE +LF +  +    S+ EF       +I         +DT+
Sbjct: 941  IP------QSEPTQQQTANEADLFIEGIN---TSLTEF-------NIDFPECKMNGKDTF 984

Query: 1091 FILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQ 1150
            F+LDATSWLRHFAHVYK+A+N +L+F+ICLTTFQELRFLRKSKDENVVEAATRA+IT+RQ
Sbjct: 985  FVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQ 1044

Query: 1151 LFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKEQEMHNMK 1210
            L++E ++LPLRFTGNVATHIEEHLEFEEQITWRSHVDEFV EA+ KA+ +  ++   N  
Sbjct: 1045 LYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE---NRD 1101

Query: 1211 GFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISN 1245
               +VLVTDD+NM+ KA +    T STRFVFA  N
Sbjct: 1102 FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCN 1136

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1067 bits (2760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/1003 (55%), Positives = 699/1003 (69%), Gaps = 90/1003 (8%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QALVQKLQDIYK+I+KQE+ELQERCSQLT SQTTE+KNLW IYK+N DLINNY TFITTA
Sbjct: 289  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTA 348

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L PSQ   D+LIGEEIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVFIS
Sbjct: 349  LLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFIS 408

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            +S++L DIP K+AIPWLQ+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+++Y +GKLY
Sbjct: 409  LSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 468

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQY+QLVIDNIYQR F DRN+  N RN   
Sbjct: 469  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPD- 527

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            L+DYLKHSEVMLLP+F+ S DLQQVVL YF ++FGIDY+ NN+  F  + MF Q    L+
Sbjct: 528  LIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNI--FDTQDMFFQPPSCLR 585

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
            F+FRHA AFAE+ ILQLVG+GNPKNPFALLF LPKYL             +     D SS
Sbjct: 586  FFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTA-DVSS 644

Query: 676  TTFSSVSGMEY-MVNMETN------VFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYH 728
            T   +V       VN  TN        L   ++ +NI+ L      P+ I  W  SL + 
Sbjct: 645  TAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPD-ICTWIKSLDFI 703

Query: 729  NFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRI 788
            N T+ KCSMIVL+KFL+GPL++ALPH LPW  F+I+  +++ + ++    +FW   +KRI
Sbjct: 704  NMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRI 763

Query: 789  FPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRG 848
            FPW+++  FLNVLLAY++DN  + + + ELC QY  ++L+++L +FN +EDLPEVWKC G
Sbjct: 764  FPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWG 823

Query: 849  SLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLF 908
            +LW+D I  K NS + D++   GI D+ FLDFP+DGIEFD  DE G KFWKR++RVIFLF
Sbjct: 824  TLWYDAICNK-NSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLF 882

Query: 909  RGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDMLVSNF--- 965
            +GI ++F+ FG L IS+ A V  R     +S L  ++FKL +      +D+   S F   
Sbjct: 883  KGISKKFD-FG-LKISHEAGVYCRNEKAADSPLRRFTFKLES------YDEPTSSKFNEF 934

Query: 966  ----EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWS 1021
                EE+ + N+D  A P LS++ GENIFEY+GY+ +  D  SFDKNG+++S+S Y +W 
Sbjct: 935  IPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWM 994

Query: 1022 INQ---------------------DTGVNGGPLXXXXXXXXXXXX-------DP-MNEKE 1052
            I+                      D   NG P+                   DP +NE +
Sbjct: 995  IDTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNEND 1054

Query: 1053 LFNKCFDPEYDSVDEFWNKEIYDDI--GRKFGME-LYED---------TYFILDATSWLR 1100
            LF K     + S+ +  ++ +Y ++  G+ + ++ L+E          T+FI DATSWLR
Sbjct: 1055 LFKK-----FMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLR 1109

Query: 1101 HFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPL 1160
            HFAH+YKIATN +LKF +CLTTFQELRFLRKSKDENVVEAA RAIIT+RQL+ E +LLPL
Sbjct: 1110 HFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPL 1169

Query: 1161 RFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKA--------ETKRKEQE------- 1205
            RFTGNVA  IEEHLEFEEQITWRSHVDEFVIEAV+KA        ETK+ E+E       
Sbjct: 1170 RFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRV 1229

Query: 1206 -MHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
             +   +   + LVT+D NMK KA ++G KTFST FVF++ + L
Sbjct: 1230 PLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKL 1272

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1065 bits (2753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/974 (56%), Positives = 693/974 (71%), Gaps = 57/974 (5%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            + L++KLQ+IYKII+KQE+ELQ+RCSQLT SQTTE+KNLW IYKLN DLINNY+TFITTA
Sbjct: 282  RVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTA 341

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L PSQS  D+ IGEEIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVC QFITHVFIS
Sbjct: 342  LLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFIS 401

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            +S+ML D+P K++IPWLQ+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+++Y +GKLY
Sbjct: 402  LSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 461

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQY+QLVIDNIYQR F DRN + N RN   
Sbjct: 462  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSD- 520

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            L+DYLKHSEVMLLP+F+E+ DLQQVVL YF ++FG+DYN+NN+  F+ + MF Q    L+
Sbjct: 521  LIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNI--FETQDMFFQVPASLR 578

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
            FYFRHA AFAE+ ILQLVG+GNPKNPFALLF LP +L             +     + S+
Sbjct: 579  FYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSST---EIST 635

Query: 676  TTFSSVSGMEYMVNMETNVFLGS--EDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTAT 733
             +  +      ++N    V  G+   ++F+NID L +    PN I +W  SL++ N T+ 
Sbjct: 636  MSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPN-ILVWLKSLEHLNMTSL 694

Query: 734  KCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNS 793
            KCS+IVL+KFL GPL++ALPH+LPW YF+I+  L+ +  ++T+ ++FW   ++RI PWN+
Sbjct: 695  KCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNT 754

Query: 794  MVRFLNVLLAYMIDNCWDNSPLNELCDQYGSL-NLEELLRNFNANEDLPEVWKCRGSLWF 852
            +  FLNVLLAY++DN +    + +LC+ Y +  N  ELL  FN NE+LPE+WKC G+LWF
Sbjct: 755  LTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWF 814

Query: 853  DIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIV 912
            D+I  KR + N D++   GI+D+ FLDFP+DGI FDE DE G  FW R++R++FLF+GI 
Sbjct: 815  DVISNKR-ALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIA 873

Query: 913  ERFNGFGNLAISYNAPVINRR-GLGVNSHLVGYSFKLMAKSDDIMFD-------DMLVSN 964
            E       L +S  APV  RR  +  N  L  +SFK M   D+  +        + L+  
Sbjct: 874  ENLQ--TGLRVSRTAPVHCRRDDIDPNHILKSFSFK-MEGFDESSYSGQPFSTINKLLPL 930

Query: 965  FEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQ 1024
            FE ID  N DF+A P+LS++ GENIFEYVGYK++  + +SFD+NG+L+S+S Y  W I+ 
Sbjct: 931  FENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDN 990

Query: 1025 DTGVNGGPLXXXXXXXXXXXXD----PMNEKELFNKCFDPEYDSVDEFWNKEIY------ 1074
            D  +N                     P  ++    + F    D+ D+F N E+Y      
Sbjct: 991  DNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDF-NFELYMNPEKL 1049

Query: 1075 --------------DDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICL 1120
                          D+I R         TYF+ DATSWLRHFAH+YK++TN++L F++CL
Sbjct: 1050 NKNMDQASIWTTANDEINRNI-------TYFVFDATSWLRHFAHIYKLSTNNVLNFAVCL 1102

Query: 1121 TTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQI 1180
            TTFQELRFLRKSKDENVV AA RAIIT+RQL+SEGKLLPLRFTGNVAT IEEHLEFEEQI
Sbjct: 1103 TTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQI 1162

Query: 1181 TWRSHVDEFVIEAVIKAETK--RKEQEMHNMKGF-QIVLVTDDSNMKNKALEKGSKTFST 1237
            TWRSHVDEFVIEAV+KA+ K     + +   KGF  +VLVTDD NMK KA E+G KTF+T
Sbjct: 1163 TWRSHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTT 1222

Query: 1238 RFVFAISNYLRTID 1251
             F+F++   L   D
Sbjct: 1223 HFIFSVCRKLGIQD 1236

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 7/102 (6%)

Query: 63  LGQKRHGSSSYYITPNYIKKRVAKNSYNSATGNFLXXXXXXXXXXXXQTSLQNTPLASPK 122
           L QKRHGS+SY I  N  +KR+A+        N +            + +     + S +
Sbjct: 44  LRQKRHGSNSY-IYKN--QKRIARPDDKILNAN-ININYIDHNSIVNENATPVKSVLSRR 99

Query: 123 PSIAKNNIINTSTTPQPTYITQDSMTSPFVLNSNLPSNLDIV 164
           PS++K +    + TPQP+++  +   SPF + +   +N+D+ 
Sbjct: 100 PSLSKKS---NNVTPQPSFLVTEPPKSPFYVTNQSYTNIDVA 138

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1028 bits (2658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/957 (55%), Positives = 669/957 (69%), Gaps = 66/957 (6%)

Query: 317  ALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTAL 376
            AL+QKLQ++Y++I+KQE+ELQERCSQLTNSQTTE+K+LW IYK+N +L+NNYVTFITTAL
Sbjct: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 377  FPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISI 436
             PSQ   DL+IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS+
Sbjct: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 437  SSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLYY 496
            S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y+Y +GKLYY
Sbjct: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 497  HMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQLL 556
            HMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N RN  LL
Sbjct: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLRN-SLL 492

Query: 557  VDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLKF 616
            ++YLKHSE MLLP+F+ESPDLQ VVL YF+EKFGID N  N+  F    MFIQN D  K+
Sbjct: 493  IEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNI--FNCEDMFIQNPDFFKY 550

Query: 617  YFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSST 676
            +FRH  +FA++ ILQ+VG+G PKNPFA+LF LPKYL             N       SST
Sbjct: 551  FFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESST 610

Query: 677  TFSSVSGMEYMVNMETNVFLGSED----FFNNIDKLAINNFMPNSIS--LWNDSLKYHNF 730
              S     +    M +   +   D    FFN+ID L     +P+ ++   W ++LK+ N 
Sbjct: 611  GNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLR-RPILPSMLTNEAWLETLKFLNM 669

Query: 731  TATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFP 790
            T+ KC MIVL+KFL+GPL VALPH+LPW+YF+ISI L+  +  D    EFW   IKR+FP
Sbjct: 670  TSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFP 729

Query: 791  WNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSL 850
            W++MV F+NVL+AY++DN   NS + +LC++Y  LNL ELL +FN NEDLPE+W C G+L
Sbjct: 730  WDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTL 789

Query: 851  WFDIIDEKRNS--QNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLF 908
            WFD I +K      + D++ E GI+DY  LD P DGI FD+ DE G KFWKR+ R+IFLF
Sbjct: 790  WFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLF 849

Query: 909  RGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDMLVSNFEEI 968
            R +   F   G   I  + P++N   L  N+ L    +KL   + +I     ++S  E I
Sbjct: 850  REVSRSF-PLG--VIVRHDPLVNCSSLQSNNILRDLVYKLEPLT-NIRSSVPVLSTLESI 905

Query: 969  -------DSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWS 1021
                      N+D +A+P LS+I G+NIF YVGYK++  DY  FDKNG+ +S S Y +W 
Sbjct: 906  FDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWY 965

Query: 1022 I-----NQDTGVNGGPLXXXXXXXXXXXXDPMNEKE---LFNKCFDPEYDSVDEFWNKEI 1073
            +     N +T ++                   NE+E   LF +C    +  +        
Sbjct: 966  VPNCNNNLETNISYA-----------------NERENEALFLECMKSVHPEI-------A 1001

Query: 1074 YDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSK 1133
            Y +I        ++ TYF+ DATSWLRH A ++K+A N +L+F+ICLTTFQELRFLRKSK
Sbjct: 1002 YPEID-------FKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSK 1054

Query: 1134 DENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEA 1193
            DENV+EAATR IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+HVDEFVIE+
Sbjct: 1055 DENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES 1114

Query: 1194 VIKAETKRKEQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
            ++KA+ K +  +  N+   +   +VL++DD  MK KA EK  +T STRFVF++   L
Sbjct: 1115 IMKAQEKLENAKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKL 1171

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/975 (54%), Positives = 690/975 (70%), Gaps = 74/975 (7%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QALVQKLQDIY+ I+KQE+ELQERCSQLTNSQTT++KNLWVIYK+NA+LINNY++FITTA
Sbjct: 244  QALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTA 303

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L PSQ + DLLIG+EIV+IY++ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+HVF+S
Sbjct: 304  LLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMS 363

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML D+P +Y+IPWL++LGDLSRMA+AL+PSGFIDWKLSAE WY  A+ Y+YG+GKLY
Sbjct: 364  ISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLY 423

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKSVFCQ+TF+PSQQY+QLVIDNIYQRAFA+R S  +SRN   
Sbjct: 424  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAER-SGGSSRNFP- 481

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            +V+YLKHSEVMLLP+F+ESP+LQ+VVL +F ++FG+    NNV  F  +Q+FIQ+ ++L+
Sbjct: 482  IVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGV--WPNNVDFFDHKQIFIQDGEKLR 539

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQ----IVGE 671
            ++F HA AFAE+ ILQLVG+G+P+NPFA+LF LPK+L             +        +
Sbjct: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLD 599

Query: 672  DGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFT 731
            DG+ ++  SV                 + +F NID   +    P  I +W  SL Y N T
Sbjct: 600  DGNGSSSISV-----------------DHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLT 642

Query: 732  ATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPW 791
            + +CSM VL+KFL+ PL+ ALPH+LPW +FL+S+A++I      A+ +FW  F++RIFPW
Sbjct: 643  SMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPW 702

Query: 792  NSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLW 851
            NS+V FLN L+A+++DN  + S + +LC++Y  ++L  L+ +F  +E+LPEVWKC G+LW
Sbjct: 703  NSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLW 762

Query: 852  FDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGI 911
            FD I  K +     S    GI+D+ FLD P+DGI FD++DE G+KFWKR+ RVIF+F+G+
Sbjct: 763  FDTISNK-SELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGM 821

Query: 912  VERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFK---LMAKSDDIMF--DDMLVSNFE 966
             + F+ +G + +S + P+  RR +     L  +SFK   L  + D+ +F   D  +  FE
Sbjct: 822  AKEFH-YG-IRVS-DTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFE 878

Query: 967  EIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDT 1026
             I   NS+F A+P LSMI GE+IFE+ GY+R++ DYY F+KNGDLI+ S Y T  + +  
Sbjct: 879  PISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLY-TSGLLERV 937

Query: 1027 GVNGGP-------------LXXXXXXXXXXXXDPMN-----EKELFNKCFDPEY-DSVDE 1067
             + GG              L             P       E++  N C DP + +S+ +
Sbjct: 938  AIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRD 997

Query: 1068 FWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELR 1127
              ++  + D+       +   TYF+LDATSWLRHFAHVYK+ATN++LKF+ICLTTFQELR
Sbjct: 998  --SRFPHGDLACNADSNV---TYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELR 1052

Query: 1128 FLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVD 1187
            FLRKSKDE+VVEAATRA+IT RQL+ E KLLPLRFTGN+ATH+EEHLEFEEQITWRSHVD
Sbjct: 1053 FLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVD 1112

Query: 1188 EFVIEAVIKAETKRKEQEMHNMKGFQ---------------IVLVTDDSNMKNKALEKGS 1232
            EFVIEAV K++ K K   +      Q               +VLVTDD NM+ KA     
Sbjct: 1113 EFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDI 1172

Query: 1233 KTFSTRFVFAISNYL 1247
              FS+RF+FA  N L
Sbjct: 1173 HIFSSRFMFAFCNQL 1187

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1030 (53%), Positives = 690/1030 (66%), Gaps = 104/1030 (10%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            +ALV+KLQDIYK+I+KQE+ELQERCSQLT SQTT++KNLW IYK+N DLINNYVTFITTA
Sbjct: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L  SQS+ DL IGEEI++IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS
Sbjct: 358  LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            +S+ML DIP KY+IPWLQ+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+++Y +GKLY
Sbjct: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKSVFCQ TF PSQQY+QLVIDNIYQRAF +RN + N+RN Q 
Sbjct: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNNRNLQ- 535

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGI---------------DYNNN--NV 598
            L++YLKHSEVMLLP F+E+ +LQQVVLLYF EKFGI                 NNN   +
Sbjct: 536  LIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTI 595

Query: 599  KMFQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXX 658
             MF+ R MFIQN +QLK++FRHA AFAE+ ILQLVG+G+PKNPFALLF LPKYL      
Sbjct: 596  DMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERKDK 655

Query: 659  XXXXXXXNQIVGEDGSSTTFSSVSGMEYMVNME------TNVF-------LGSEDFFNNI 705
                   +     + ++ + +    M  + N E       N+F       + SE+FF NI
Sbjct: 656  KEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNI 715

Query: 706  DKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISI 765
            ++L  + F+PNS+ +W  SL + N  + KCSMIVL+KFL+GPL++ALPH+LPW YF+ISI
Sbjct: 716  EQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISI 775

Query: 766  ALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSP----------- 814
             L+ E         FW   +K IFPWN ++ FLNVLL Y +DN    +P           
Sbjct: 776  LLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDM 835

Query: 815  ---LNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDIIDEKRNSQNCDSYTECG 871
               + +LC++Y ++   +LL++FN NEDLPEVWKC G+LWFD I  K N  + DS+   G
Sbjct: 836  NVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNK-NGMDADSFENLG 894

Query: 872  IKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERFNGFGNLAISYNAPVIN 931
            IKD+ FLDFP+DGI +   DE G  FWKR++R+IFLF+GI E F+  G L +SYNA    
Sbjct: 895  IKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLG-LKVSYNAGTEY 953

Query: 932  R-RGLGVNSHLVGYSFKLMAKSDDIM---FDDML----------VSNF----EEIDSNNS 973
            R   + +++ L  +SFK    + D +     D L          ++ F    E I   N 
Sbjct: 954  RNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNL 1013

Query: 974  DFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGPL 1033
            +F   PL SMI  E+IF+Y GYK++  +  SFDKNG+  S S Y  W ++ D  +     
Sbjct: 1014 NFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLI----- 1068

Query: 1034 XXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDD--IGRKFGMELYE--DT 1089
                        D M   +LF      +  S  +    E  D   +      E +    T
Sbjct: 1069 LAQNNNNNTNATDEMT--DLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKT 1126

Query: 1090 YFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLR 1149
            YF+ DATSWLRHFAH+YK+A+N +LKF++CLTTFQELRFLRKSKD NVVEA+TRAIIT+R
Sbjct: 1127 YFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMR 1186

Query: 1150 QLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK-RKEQEMHN 1208
            QL+S+G LLPLRFTGNVAT IEEHLEFEEQITWRSHVDEFVIEAV+KA+ K  K + + N
Sbjct: 1187 QLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVEN 1246

Query: 1209 MKGFQ-------------------------IVLVTDDSNMKNKALEKGSKTFSTRFVFAI 1243
            M+G                           +VL+TDD +M+ KA  KG  TF T+ VF++
Sbjct: 1247 MEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSV 1306

Query: 1244 SNYLRTIDES 1253
             + +  IDE 
Sbjct: 1307 CSMM-GIDEG 1315

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/958 (53%), Positives = 683/958 (71%), Gaps = 56/958 (5%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QALVQKLQDIY+ I+KQEVELQERC+QLT SQTT++KNLW+IYK+N +LINNYV FITTA
Sbjct: 242  QALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTA 301

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L PSQ + DLLIG+EIV+IY+IERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFIS
Sbjct: 302  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 361

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML D+PQK++ PW ++LGDLSRMA+AL+PSGFIDWKLSAE WY  A+ + +G+GKLY
Sbjct: 362  ISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLY 421

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKSVFC++TF+PS QY+QLVIDNIYQRAFA+RN   N RN  L
Sbjct: 422  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERN-GGNHRN-SL 479

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            +V+YLKHSEVMLL +F+ESP+LQ+VVL +F  KFG+  + +N   F PR MF+Q+ +++K
Sbjct: 480  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGV--STSNTDFFNPRDMFLQDGERVK 537

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
            ++FRHA AFAE+ ILQ VG+G+PKNPFALLF LPK+L                     SS
Sbjct: 538  YFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSK--------SS 589

Query: 676  TTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKC 735
             +F+S+         ET   L   ++  N+D        P  +++W +SL + N T+ +C
Sbjct: 590  HSFTSI---------ETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARC 640

Query: 736  SMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMV 795
            S IV QKFL GPL+VA+ H+LPW YFL+S+AL+I+      +  FW   +++IFPWNS+V
Sbjct: 641  SSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIV 700

Query: 796  RFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDII 855
             FLN+L+A+++DN W  SP++ LC+Q  S++   L+ +F+ +EDLPE+W+C G+LWFD+I
Sbjct: 701  DFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVI 760

Query: 856  DEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERF 915
             +K N ++ D     G KD+ F D P DGI FDE+DE+G KFWKR+ R+IF+F+GI + F
Sbjct: 761  ADKSNGEDGD-VINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF 819

Query: 916  NGFGNLAISYNAPVINRRGLGVNSHLVGYSF---KLMAKSDDIMFDDMLVSNFEEIDSNN 972
            +    L +S  AP  +RR +     L  +SF   ++ A+S    F    +  FEEI + N
Sbjct: 820  S--LGLTLSAFAPQ-SRRPMTAGHPLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGN 876

Query: 973  SDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGP 1032
             D N  P  SM+ GE+IF++ GY++++ADY  F+K+G LIS S Y +  + +     G  
Sbjct: 877  LDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDD 936

Query: 1033 LXXXXXXXXXXXXDPMN---------EKELFNKCFDPEYDSVDEFWNKEI-YDDIGRKFG 1082
                          P N         E++  + C +PE+  +++ +  +  + D+     
Sbjct: 937  FNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEF--IEQAYEMKFPFGDLSCNCD 994

Query: 1083 MELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAAT 1142
              +   +YF+LDATSWLRHFAHV+K+ATN++L+F ICLTTFQELRFLRKSKDE+VVEAAT
Sbjct: 995  SGV---SYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAAT 1051

Query: 1143 RAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK-- 1200
            RA+IT+RQL+S+ KLLPLRFTGNVATH+EEHLEFEEQITWRSHVDEFVIEAV KA+ K  
Sbjct: 1052 RAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFE 1111

Query: 1201 ----RKEQEMHNM------KGFQIV-LVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
                + ++  H+       + F  V LV+DD+NM+ KA  +  +TFSTRF+FA+ N +
Sbjct: 1112 AINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQI 1169

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/948 (54%), Positives = 654/948 (68%), Gaps = 53/948 (5%)

Query: 317  ALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTAL 376
            AL+QKLQ++YK+I+KQE+ELQERCSQLTNSQTTE+K+LW IY++N +LINNYVTFITTAL
Sbjct: 268  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTAL 327

Query: 377  FPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISI 436
             PSQ   DLLIG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF+S+
Sbjct: 328  LPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 387

Query: 437  SSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLYY 496
            S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y Y +GKLYY
Sbjct: 388  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 447

Query: 497  HMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQLL 556
            HMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N RN  LL
Sbjct: 448  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLRN-SLL 505

Query: 557  VDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLKF 616
            ++YLKHSE MLLP+F+ESPDLQ VV+ YF+EKFGID N  N+  F P  MFIQN D  K+
Sbjct: 506  IEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNI--FNPEDMFIQNPDFFKY 563

Query: 617  YFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSST 676
            +FRHA +FA++ ILQ+VG+G PKNPFA+LF LPKYL             N       SST
Sbjct: 564  FFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESST 623

Query: 677  TFSSVSGMEYMVNMETNVFLGSED----FFNNIDKLAINNFMPNSIS--LWNDSLKYHNF 730
              S     +    M +   +   D    FFN+ID L     +P+ ++   W ++LK+ N 
Sbjct: 624  GNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLR-RPILPSMLTSEAWLETLKFLNM 682

Query: 731  TATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFP 790
            T+ KC MIVL+KFL+GPL +ALPHILPW+YF+I+  L+  +  D    +FW   +KR+FP
Sbjct: 683  TSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFP 742

Query: 791  WNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSL 850
            W+++V F+NVL+AY++DN   N  + ELC +YG+LNL  LL +FN +E+LPE+W C G+L
Sbjct: 743  WDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTL 802

Query: 851  WFDIIDEK--RNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLF 908
            WFD I +K   +  + D++ E GIKDY  LD P DGI FD+ DE G KFWKR+ R+IFLF
Sbjct: 803  WFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLF 862

Query: 909  RGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDMLVSNFEEI 968
            R +   F   G   I  N P+I       +  L    +KL   S+      +L +    +
Sbjct: 863  RELSRTF-PIG--VIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENSV 919

Query: 969  D------SNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSI 1022
            D       NN D  A+P LS+  G+NIF Y GYK++  DY  FD+NG+ +S S Y  W +
Sbjct: 920  DISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWYL 979

Query: 1023 NQDTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRKFG 1082
                  NG  +            D    ++LF +C  P+   +D                
Sbjct: 980  -----PNGNNISEALVNSDIEKGD----EDLFLECMKPDCPGID---------------- 1014

Query: 1083 MELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAAT 1142
               +E TYF+ DATSWLRH A ++K+A N +LKF+ICLTTFQELRFLRKSKDENV+EAAT
Sbjct: 1015 ---FETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAAT 1071

Query: 1143 RAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRK 1202
            R IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+HVDEFVIE++ KA+ K +
Sbjct: 1072 RGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLE 1131

Query: 1203 EQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
                 ++       +VL++DD  MK KA EK  KT ST+FVF++   L
Sbjct: 1132 NAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKL 1179

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/965 (53%), Positives = 680/965 (70%), Gaps = 70/965 (7%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QALVQKLQDIY+ I+KQEVELQERCSQLT+SQTT++KNLW+IYK+N +LINNYV FITTA
Sbjct: 212  QALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTA 271

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L PSQ + DLLIG+EIV+IY+IERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFIS
Sbjct: 272  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 331

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML D+PQK+A PWL++LGDLSRMA+AL+PSGFIDWKLSAE WY  A+ + +G+GKLY
Sbjct: 332  ISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLY 391

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTLEAFVNLGKSVFC++TF+PSQQY+QLVIDNIYQRAFA+RN   N RN  L
Sbjct: 392  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-GGNQRN-SL 449

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            +V+YLKHSEVMLL +F+ESP+LQ+VVL +F  KFGI  ++NN   F  + +F+Q+ ++ K
Sbjct: 450  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI--SSNNTDYFSHQAIFLQDGERTK 507

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYL--XXXXXXXXXXXXXNQIVGEDG 673
            ++FRHA AFAE+ ILQ+VG+GNPKNPFALLF LPK+L               N     + 
Sbjct: 508  YFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEA 567

Query: 674  SSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTAT 733
             S T    S +EY+ ++++  F+                  P  +++W  SL + N T+ 
Sbjct: 568  PSPT----SPIEYLESVDSPRFVYE---------------FPTDLAIWQQSLSHINTTSI 608

Query: 734  KCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNS 793
            KCS +VLQKFL+GPL+ A  H+LPW YFL+S+A++I++     + +FW A  +++FPWNS
Sbjct: 609  KCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNS 668

Query: 794  MVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFD 853
            +V FLN+++A+ +DN W  S ++ LC+Q+ S+++  L+ +F+ NEDLPEVWKC G+LWFD
Sbjct: 669  IVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFD 728

Query: 854  IIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVE 913
            +I +K +  + +  T   ++D+ F D PVDGI FDE+DE G +FWKR+ R++F+F+GI +
Sbjct: 729  VISDKSDVVD-EGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQ 787

Query: 914  RFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKL---MAKSDDIMFDDMLVSNFEEIDS 970
             FN    LA   + P+ +RR L     L  + FK       S+        +  FE I  
Sbjct: 788  EFNMGLTLA---SVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFENISE 844

Query: 971  NNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNG 1030
             N D NA P  SM+ G+++FE  GY+++HAD+  F+K G LI+ S Y + S+ +   ++G
Sbjct: 845  RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP-IHG 903

Query: 1031 GPLXXXXXXXXXXXXDPMNEKELFNKCFDP---EYDSVDEFW-----NKEIYD---DIGR 1079
            G              +  +  +  NK  +P   E D ++  W     N E  +   D+  
Sbjct: 904  G---------DDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKF 954

Query: 1080 KFG-MELYED---TYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDE 1135
             FG +    D   +YF+ DATSWLRHFAHVYK+ATN +L+F+ICLTTFQELRFLRKSKDE
Sbjct: 955  PFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDE 1014

Query: 1136 NVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVI 1195
            +VVEAATRA+IT+RQL+SE +LLPLRFTGNVATH+EEHLEFEEQITWRSHVDEFVIEAV 
Sbjct: 1015 SVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVY 1074

Query: 1196 KAETKRKEQEMHNMKGFQ-------------IVLVTDDSNMKNKALEKGSKTFSTRFVFA 1242
            KA+ K +       +G               I LV+DD+NM+ KA  +  +TFS+RF+FA
Sbjct: 1075 KAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFA 1134

Query: 1243 ISNYL 1247
            + N +
Sbjct: 1135 VCNQI 1139

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/954 (54%), Positives = 655/954 (68%), Gaps = 65/954 (6%)

Query: 317  ALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTAL 376
            AL+QKLQ++YK+I+KQE+ELQERCSQLTNSQTTE+K+LW IY++N +L+NNYVTFITTAL
Sbjct: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326

Query: 377  FPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISI 436
             PSQ + DL+IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF+S+
Sbjct: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386

Query: 437  SSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLYY 496
            S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y Y +GKLYY
Sbjct: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446

Query: 497  HMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQLL 556
            HMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N RN  LL
Sbjct: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLRN-SLL 504

Query: 557  VDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLKF 616
            ++YLKHSE MLLP+F+ESPDLQ VVL YF+EKFGID N  N+  F P  MFIQN D  K+
Sbjct: 505  IEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNI--FNPEDMFIQNPDFFKY 562

Query: 617  YFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSST 676
            +FRHA +FA++ ILQ+VG+G PKNPFA+LF LPK+L             N       SST
Sbjct: 563  FFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESST 622

Query: 677  TFSSVSGMEYMVNMETNVFLGSED----FFNNIDKLA---INNFMPNSISLWNDSLKYHN 729
            + S     +    M +   +   D    FFN+ID L    +++ + N    W +SLK+ N
Sbjct: 623  SNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEA--WLESLKFLN 680

Query: 730  FTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIF 789
             T+ KC MIVL+KFL+GPL +ALPH LPW+YF+ISI L+  +  D    EFW   +KRIF
Sbjct: 681  MTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIF 740

Query: 790  PWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGS 849
            PW++MV F+N+L+A ++DN   +  +  LCD+Y  LNL ELL  F   E+LPE+W C G+
Sbjct: 741  PWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGT 800

Query: 850  LWFDIIDEKRNS--QNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFL 907
            LWFD I +K  +   + D + E GIKDY  LD P+DGI FD NDE G KFWKR+ R IFL
Sbjct: 801  LWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFL 860

Query: 908  FRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSD------DIMFDDML 961
            FR +   F   G   I  N   INR  L  N+ L   S+KL   S        +   + +
Sbjct: 861  FRELSRSFQ-IG--VIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGI 917

Query: 962  VSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWS 1021
            +  FE    NN D +A+P LS+I G +IF Y GYK++  +Y  FDKNG+ +S S Y +W 
Sbjct: 918  IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWY 977

Query: 1022 I-----NQDTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDD 1076
            +     N +T +N                +  NE + F +C   +   +D          
Sbjct: 978  VPNGSNNPETNINSN-------------CEKENEGQ-FLECLKSDDREID---------- 1013

Query: 1077 IGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDEN 1136
                        TYF+ DATSWLRH A ++K+A N +LKF+ICLTTFQELRFLRKSKDEN
Sbjct: 1014 ---------LNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064

Query: 1137 VVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIK 1196
            V+EAATR IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+HVDEFVIE+++K
Sbjct: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124

Query: 1197 AETKRKEQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
            A+ K +      +   +   ++L++DD  MK KA EK  KT STRFVF++   L
Sbjct: 1125 AQEKLENANQLPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKL 1178

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/955 (55%), Positives = 654/955 (68%), Gaps = 66/955 (6%)

Query: 317  ALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTAL 376
            AL+QKLQ++YK+I+KQE+ELQERCSQLTNSQTTE+K+LW IYK+N DL+NNYVTFITTAL
Sbjct: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 377  FPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISI 436
             PSQ   DL+IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF+S+
Sbjct: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 437  SSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLYY 496
            S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y Y +GKLYY
Sbjct: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 497  HMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQLL 556
            HMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N RN  LL
Sbjct: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLRN-SLL 511

Query: 557  VDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLKF 616
            ++YLKHSE MLLP+F+ESPDLQ VVL YF+EKFGID N  N+  F    MF+QN D  K+
Sbjct: 512  IEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNI--FNAEDMFVQNPDFFKY 569

Query: 617  YFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSST 676
            +FRH  +FA++ ILQ+VG+G PKNPFA+LF LPKYL             N       SST
Sbjct: 570  FFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESST 629

Query: 677  TFSSVSGMEYMVNMETNVFLGSED----FFNNIDKLAINNFMPNSIS--LWNDSLKYHNF 730
              S     +    M +   +   D    FFN+ID L     +P+ ++   W ++LK+ N 
Sbjct: 630  GNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLR-RPILPSMLTNEAWLETLKFLNM 688

Query: 731  TATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFP 790
            T+ KC +IVL+KFL+GPL +ALPHILPW+YF+ISI L+  +  D    EFW   +KR FP
Sbjct: 689  TSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFP 748

Query: 791  WNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSL 850
            W++MV F+NVL+ Y++DN   NS + +LCD Y  L+L ELL  FN  E+LPE+  C G+L
Sbjct: 749  WDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTL 808

Query: 851  WFDIIDEKRNS--QNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLF 908
            WFD I EK      + D++ E GIKDY  LD P DGI FDE DE G KFWKR+ R IFLF
Sbjct: 809  WFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLF 868

Query: 909  RGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDMLVSNFEEI 968
            R +   F   G   I  N P+I R      + L    FKL     +I  +  ++   E I
Sbjct: 869  RELSRSF-PIG--VIIRNDPLIYRSSFQNTNILGSLVFKLEPLC-NIHNNIPVLGALESI 924

Query: 969  -------DSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWS 1021
                     NN+D +A+P LS+  G+NIF YVGYK++ ADY  FDKNG+ +S S Y TW 
Sbjct: 925  IDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWY 984

Query: 1022 INQDTGVNGGPLXXXXXXXXXXXXDPMN---EKE---LFNKCFDPEYDSVDEFWNKEIYD 1075
            +      N                D +N   EKE   LF +C   +Y  +D         
Sbjct: 985  VPNSNNTN--------------IEDNINYNSEKENEGLFLECIKSDYPEID--------- 1021

Query: 1076 DIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDE 1135
                      ++ TYF+ DATSWLRH A ++K+A N +L+F+ICLTTFQELRFLRKSKDE
Sbjct: 1022 ----------FKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDE 1071

Query: 1136 NVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVI 1195
            NV+EAATR IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+HVDEFVIE+V+
Sbjct: 1072 NVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVM 1131

Query: 1196 KAETK---RKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
            KA+ K     E  +   +   +VL++DD  MK KA EK  KT STRFVF++   L
Sbjct: 1132 KAQEKLESASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKL 1186

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/943 (54%), Positives = 670/943 (71%), Gaps = 43/943 (4%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QALVQKLQDIYK I++QEVELQE+C+QLT+SQTT++ ++W IY++N +L+ NYVTFI+TA
Sbjct: 368  QALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTA 427

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L  SQS+ DL+IG+EIV+ Y+I RRLWVYGTITFLDVLKNFS+FMDPEVC QFITHVFIS
Sbjct: 428  LLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFIS 487

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML DIP KY+IPW+Q+LGDLSRMA+AL+PSGFIDWKLS+E WY  A++Y+YGYGKLY
Sbjct: 488  ISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLY 547

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMST+QQNTLEAFVNLGKSVFCQ+TF+PS QY+QLVIDNIYQRAF +R  S+N+RN Q 
Sbjct: 548  YHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIER-GSNNTRNSQ- 605

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            L++YLKHSEVMLLPNF+ + +LQ+VV+ YF  KFG D ++ N+  FQPR +F+QN + LK
Sbjct: 606  LIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNI--FQPRDIFLQNPENLK 663

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
            ++FRHA AFAE+ ILQ VG+G+ KNPFALLF LPK+L             +      G  
Sbjct: 664  YFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSS-----GEP 718

Query: 676  TTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKC 735
            T+  SV  ++   N+ T+  + S+ +F+N++ +      P    +W  SL Y N TA +C
Sbjct: 719  TSNESVMSLD---NISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQC 775

Query: 736  SMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMV 795
             +IVL+KFL+GP +VALPH++ W YF+IS+ L+ E   D     FW +F++R+ P NS+V
Sbjct: 776  GVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIV 835

Query: 796  RFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDII 855
             FLNVL+AY +DN + ++ ++ + ++  S++L+ELL  FN NE+LPEVWKC G+LWFD I
Sbjct: 836  SFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAI 895

Query: 856  DEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERF 915
             +K N+ + +SY + G+ D+ F D P+DGI FD  DE G KFWKR++R+IFLF+ I E F
Sbjct: 896  TDKSNT-DTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF 954

Query: 916  NGFGNLAISYNAPVINRRGLGVNSHLVG-YSFK-----LMAKSDDIMFDDMLVSNFEEID 969
            +    + +S+ APV  RR     +H++G +SFK     L   +  +  ++ L +  E  +
Sbjct: 955  D--IGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTE 1012

Query: 970  SNNS---DFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDT 1026
              N      +A P +S+   ENIFEY GYKRI  +  +FDKNG+L S + Y +W   Q+ 
Sbjct: 1013 MPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEI 1072

Query: 1027 GVNGGPLXXXXXXXXXXXXDPMNEKELFNKCF---DPEYDSVDEFWNKEIYDDIGRKFGM 1083
                 P              P        + F   D E +    F N+E  +      G+
Sbjct: 1073 ----VPKSAASPENSVAGSSP-------GRSFQSQDVEENIFSVFTNEE-ENSTSLLDGL 1120

Query: 1084 ELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATR 1143
             L E T F+LDATSWLRH AH+YK+A+NS L FSICLTTFQELRFLRKSKDENV+EAA R
Sbjct: 1121 NL-ETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAAR 1179

Query: 1144 AIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKE 1203
            AII +RQL+S+GK++PLRFTGN+ATHIEEHLEFEEQITWRSHVDEFVIE++ KA+ K  +
Sbjct: 1180 AIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQ 1239

Query: 1204 QEMHNM---KGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAI 1243
              + N         VLV+DD NMK KA EK  +TF+TRFVFA+
Sbjct: 1240 PFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFAL 1282

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1018 (49%), Positives = 652/1018 (64%), Gaps = 104/1018 (10%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QAL+ KLQDIYK IL QEVELQ  CS +T+SQTT++K +W +YK+N +L+NNYV FITTA
Sbjct: 274  QALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTA 333

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L PSQS++DLLIG+EI+D+YKIERRLWVYGTITFLDVLK+FSNFMDPE+CCQFI HVFIS
Sbjct: 334  LLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFIS 393

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            I++M D IP+K++IPW  +LGDLSRMA AL+P G  DWKLSAE WY  AM+Y+YG GKLY
Sbjct: 394  IANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLY 453

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHM+TVQQN+L AF+NLGKSVFC++ FVP+QQYLQLVIDNIYQRA+  R   S+S N Q+
Sbjct: 454  YHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSS-NVQI 512

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            L DYLKH+E+M+LPNFME+ +LQ++  +YF EKFG D+  NN   F  R MF+QN + +K
Sbjct: 513  L-DYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNN--FFDTRSMFVQNLESVK 569

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
            FYFRH+  FA+A ILQ+VGYGN  N FALL+ LPK++             N+I  +   S
Sbjct: 570  FYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFI-----------KDNEISRQRKKS 618

Query: 676  TTFS---SVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTA 732
             T     S+  + + V+   N      ++FN+++ +     +P ++ +W  SL+Y N T 
Sbjct: 619  KTGVDNMSIDTLSFQVS--GNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTG 676

Query: 733  TKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWN 792
              C M+VLQKFL GP + ALPH+LPWVYFLIS+A +IE  +DT    FW  FI+RIFPWN
Sbjct: 677  IFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWN 736

Query: 793  SMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWF 852
            +++ FLNVL+A++ DN    S +N+LC+ Y  L+L+E+L NF+ NE+LPEVW C GSLWF
Sbjct: 737  TIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWF 796

Query: 853  DIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIV 912
            D I  K  +      T  GIKD  FLD P DGI FDE D+ G KFWKR+ R++FLF+G  
Sbjct: 797  DTIKNKSETSYSGLKT-AGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYA 855

Query: 913  ERFNGFGNLA--ISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDM---------- 960
            E+F+    L    S N+   N          + + FK     D +  D+           
Sbjct: 856  EKFDQGLRLTNINSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSL 915

Query: 961  ---LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFY 1017
                +  FE I  NN   +A+P LS+I GE+IF+YVGYK++   YY +DKNG++   + Y
Sbjct: 916  FTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIY 975

Query: 1018 NTWSINQDTGVNGGPLXXXXXXXXXXXXD-----PMNEKELFNK---CFDPEYDS----- 1064
            + W      G    P             D      + EK LF K   C + +  S     
Sbjct: 976  SNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAE 1035

Query: 1065 -------------------VDEFW-NKEIYDDIGR--KFGMEL---YEDTYFILDATSWL 1099
                               VD+++ N+   D I +  K   E+   Y  TYFI DAT+WL
Sbjct: 1036 VEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWL 1095

Query: 1100 RHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLP 1159
            RHFAH+YKIA + +L F ICLTTFQELRFLR+S+DENV+EAATRA+I +R L+   K++P
Sbjct: 1096 RHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIP 1155

Query: 1160 LRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKEQEMHNMKG-------- 1211
            LRF G +A+HIEEHLEFEEQITWRSHV+EFVIEAV K++      E+HN           
Sbjct: 1156 LRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAEN 1215

Query: 1212 ----------------------FQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
                                     VLVTDD NM +KA E+G +T STRF+F+I + L
Sbjct: 1216 MDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQL 1273

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/954 (50%), Positives = 649/954 (68%), Gaps = 75/954 (7%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            Q  ++KLQ+IY+II+ QE ELQ+RC  LT SQTTE+K+LW IY+LN +LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L  +Q  +DL++G+EI+DIY+IE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            +SSML+DIP KY+I W Q+LGDLSRMA++L+PSGFIDW+LSAE WY  +M+Y YG GKLY
Sbjct: 325  VSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNS----- 550
            YH++TVQQN+LEAFVNLGKSVFCQ+ F PSQQ LQL+I+NIYQ AF DR+S+  +     
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETA 444

Query: 551  -RNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQ 609
             RN Q L+DYLKH+EVMLLP+F+E+ DLQ VVL+YF +KFG D+N N++  F  + MF Q
Sbjct: 445  HRNSQ-LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDI--FDTKDMFCQ 501

Query: 610  NNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIV 669
            N + L++YFRHA AFAE+Q+LQL+G+GNPKNPFALLF LPKYL              ++ 
Sbjct: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYL--------------KLK 547

Query: 670  GEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAIN-NFMPNSISLWNDSLKYH 728
                      +    +Y    +  +   SE +F NID L  N + +P ++++W DSL + 
Sbjct: 548  RHKREKKKSGATEVPQYRDPFDDQI--SSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHI 605

Query: 729  NFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRI 788
            N T+ +CS+ VL KFL+ PL+VALPH L W++F+++I  ++E     A+  FW  F++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRT 665

Query: 789  FPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRG 848
             PWNSMV   NVL+ YM+DN   +  L    +++ SL L++L+  FN NE+LPE+WKC G
Sbjct: 666  MPWNSMVNLANVLVCYMLDNI--HPFLERELERFYSLELDDLIEYFNENENLPEIWKCWG 723

Query: 849  SLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLF 908
            SLWFD I      + CD     G++D+ F D P+DGI FDE DEIG +FW RS+R I + 
Sbjct: 724  SLWFDAI------KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILIL 777

Query: 909  RGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSD---------DIMFD 958
            +G+ ++F   G L +++ APV  RR  +  +  L  ++FKL    +         D ++D
Sbjct: 778  KGVAKKFPDLG-LKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYD 836

Query: 959  DMLVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYN 1018
             + ++  E+I+  N D  A P LS++ GENIFEY GY R+  DY+ FDKNG   S   Y+
Sbjct: 837  TIEIN--EKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYS 894

Query: 1019 TWSINQDTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDI- 1077
             WS   + G NG  L            D  +E       +D   +++   W K  +D I 
Sbjct: 895  QWS---NVG-NGMVL------------DVSSE-----SMYDAANNNLSPHWEKIFFDRIT 933

Query: 1078 --GRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDE 1135
              G           YF++DATSWLRHFAH++K+A N+ILKF+ICLTTFQELR+LR SKD+
Sbjct: 934  TAGHNGDKNGNCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDD 993

Query: 1136 NVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVI 1195
            NVVEAATR++IT+RQL+ E K++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ 
Sbjct: 994  NVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIA 1053

Query: 1196 KA----ETKRKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISN 1245
            K     +T+R   +  N      VLVTDD NM  KA +K  KT +T+++F++ +
Sbjct: 1054 KLNQNFQTERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGS 1107

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 18/132 (13%)

Query: 63  LGQKRHGSSSYYITP--NYIKKRVAKNSYNSATGNFLXXXXXXXXXXXXQTSLQNTPLA- 119
           L QKRH SSS+  TP  +++K+RV         G               Q S+QNTP   
Sbjct: 40  LHQKRHSSSSHNDTPESSFVKRRVPGVVEPVGKG-------FIDGIASGQVSVQNTPSKT 92

Query: 120 ---SPKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLN-SNLPSNLDIVSN----ENLED 171
              S +PSI++  +  T      +  T D   SP+ +N S +  N+++VS     EN   
Sbjct: 93  DDISRRPSISRKAMETTPKVNTASISTIDVPKSPYYMNKSAITRNMEVVSRGNYAENTTS 152

Query: 172 SIRKDQDFSQIN 183
            +R D+  +  N
Sbjct: 153 QMRTDESMATSN 164

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/958 (50%), Positives = 643/958 (67%), Gaps = 79/958 (8%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            Q  ++KLQ+IYKII+ QE ELQ+RC  LT SQTTE+K+LW IY+LN +LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L  +Q  +DL++G+EI+DIY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            +S+ML+DIP KY+I W Q+LGDLSRMA++L+PSGFIDW+LSAE WY  +M+Y YG GKLY
Sbjct: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNS----- 550
            YH++TVQQN+LEAFVNLGKSVFCQ+ F PSQQ LQL+I+NIYQ AF DR SS  +     
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETA 444

Query: 551  -RNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQ 609
             +N Q L+DYLKH+EVMLLP+F+E+ DLQ VVL+YF  KFG D+N N+V  F  + MF Q
Sbjct: 445  HKNSQ-LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDV--FDTKDMFCQ 501

Query: 610  NNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIV 669
            N + L++YFRHA AFAE+Q+LQL+G+GNPKNPFALLF LPKYL                 
Sbjct: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRS----- 556

Query: 670  GEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAIN-NFMPNSISLWNDSLKYH 728
                     S+    +Y            E +F NID L+ N + +P ++++W +SL + 
Sbjct: 557  ---------SATETPQYRDPFHDKK--SPESYFQNIDALSSNFDDIPTNLNIWLESLNHI 605

Query: 729  NFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRI 788
            N T+ +CS+ VL KFL+ P ++ALPH L W+YFL++I  ++E      ++ FW  F++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRT 665

Query: 789  FPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRG 848
             PWNSMV   NVL+ YM+DN   +  L +  + + S  L++L+ +FN NE+LPE+WKC G
Sbjct: 666  MPWNSMVSLANVLVCYMLDNL--HPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWG 723

Query: 849  SLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLF 908
            SLWFD I      + CD     G++D+ F D P+DGI FDE DEIG +FW RSVR I L 
Sbjct: 724  SLWFDAI------KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLL 777

Query: 909  RGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSDDIMFDDMLVSNF-- 965
            +GI ++F   G L +++ APV  RR  +  +  L  ++FKL A  +    D+  +     
Sbjct: 778  KGIAKKFPDLG-LKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYE 836

Query: 966  -----EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTW 1020
                 E+ID+ N D  A P LS+++GE+IFEY GY R+  DY+ FDKNG   S   Y+ W
Sbjct: 837  TIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW 896

Query: 1021 SINQDTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDE----FWNKEIYDD 1076
            S   + G NG P+            D  NE         P YD  D      W K  +D 
Sbjct: 897  S---NVG-NGVPI------------DVSNE---------PIYDVTDNDLSLHWEKIFFDR 931

Query: 1077 IGRKFGMELYED---TYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSK 1133
            I   +      D    YF++DATSWLRHFAH++K+A NSIL F+ICLTTFQELR+LR SK
Sbjct: 932  IAAAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSK 991

Query: 1134 DENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEA 1193
            D+NVVEAATR++IT+RQL+ E K++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A
Sbjct: 992  DDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDA 1051

Query: 1194 VIKA----ETKRKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
            + K     +T+R   E  N      VLVTDD NM  KA +K  KT +T+++F++ + L
Sbjct: 1052 IAKLNQNFQTERMIAENKNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKL 1109

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 60  TKNLGQKRHGSSSYYITP--NYIKKRVAKNSYNSATGNFLXXXXXXXXXXXXQTSLQNTP 117
           T  L QKRH SSS+  TP  ++ K+RV         G               Q S QNTP
Sbjct: 37  TAFLHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKG-------FIDGVTNGQISAQNTP 89

Query: 118 L----ASPKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLN-SNLPSNLDIVSNENLED 171
                 S +PSI++  + +T      +  T D   SP+ +N + +  N+++VS E+ ++
Sbjct: 90  SKVDDVSRRPSISRKVMESTPQAKTASISTMDVPKSPYYVNRTAVARNMEVVSKESYDE 148

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/954 (50%), Positives = 649/954 (68%), Gaps = 71/954 (7%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            Q  ++KLQ+IYKII+ QE ELQ+RC  LT SQTTE+K+LW IY+LN +LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L  +Q  +DL++G+EI+DIY+IE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            +S+ML+DIP KY+I W Q+LGDLSRMA++L+PSGFIDW+LSAE WY  +M+Y YG GKLY
Sbjct: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNS----- 550
            YH++TVQQN+LEAFVNLGKSVFCQ+ F PSQQ LQL+I+NIYQ AF DR+S S +     
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIA 444

Query: 551  -RNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQ 609
             RN Q L+DYLKH+EVMLLP+F+E+ DLQ VVL+YF +KFG D+N N+V  F  + MF Q
Sbjct: 445  HRNSQ-LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDV--FDTKDMFCQ 501

Query: 610  NNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIV 669
            N + L++YFRHA AFAE+Q+LQL+G+GNPKNPFALLF LPKY               +  
Sbjct: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKY------LKLKKDKREKKR 555

Query: 670  GEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAIN-NFMPNSISLWNDSLKYH 728
             E   +++++             +V + SE +F NID L  + N +P ++++W DSL + 
Sbjct: 556  SEATETSSYTD----------PFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHI 605

Query: 729  NFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRI 788
            N T+ +CS+ VL KFL+ PL+VALPH L W++F+++I  ++E      ++ FW  F++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRT 665

Query: 789  FPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRG 848
             PWNS+V   NVL+ YM+DN   +  L +  +++ SL L++L+  +N NE+LPE+WKC G
Sbjct: 666  MPWNSIVTLGNVLVCYMLDNL--HPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWG 723

Query: 849  SLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLF 908
            +LWFD I      + CD     G++D+ F D P+DGI FDE DE+G KFW RSVR + L 
Sbjct: 724  TLWFDAI------KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLL 777

Query: 909  RGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSDDIMFDDMLVSNF-- 965
            +GI ++F   G L +S+ A V  RR  +  +  L   +FKL A  +D   D+  + +   
Sbjct: 778  KGIAKKFPDLG-LKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYD 836

Query: 966  -----EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTW 1020
                 EEI++ N D  A P LS++ GE+IFEY GY R+  DY+ FDKNG   S   Y+ W
Sbjct: 837  TIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW 896

Query: 1021 SINQDTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDI--G 1078
            S N   GV                 D   E       +D   +++   W K  +D I   
Sbjct: 897  S-NVGNGVT---------------LDVSGE-----SIYDVANNNLSLHWEKIFFDKIAAA 935

Query: 1079 RKFGMELYEDT-YFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENV 1137
             K   E Y  T YF++DATSWLRHFAH++K+A N+ LKF+ICLTTFQELR+LR SKD+ V
Sbjct: 936  SKGSDENYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTV 995

Query: 1138 VEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKA 1197
            VEAATR++IT+RQL+ E K++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K 
Sbjct: 996  VEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKL 1055

Query: 1198 ----ETKRKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
                + +R   E  N      VLVTDD NM  KA ++  KT +T+++F++ + L
Sbjct: 1056 NQRFQAERLTDENKNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKL 1109

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 54/116 (46%), Gaps = 14/116 (12%)

Query: 63  LGQKRHGSSSYYITP--NYIKKRVAKNSYNSATGNFLXXXXXXXXXXXXQTSLQNTPL-- 118
           L QKRH SSS+  TP  ++ K+RV     +     F+            Q S QNTP   
Sbjct: 40  LHQKRHSSSSHNDTPESSFAKRRVP-GIVDPVGKGFIDGITNS------QISAQNTPSKT 92

Query: 119 --ASPKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLNSN-LPSNLDIVSNENLED 171
             AS +PSI++  + +T      +  T D   SP+ +N   L  N+ +VS +  ED
Sbjct: 93  DDASRRPSISRKVMESTPQVKTSSIPTMDVPKSPYYVNRTMLARNMKVVSRDTYED 148

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/956 (50%), Positives = 641/956 (67%), Gaps = 75/956 (7%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            Q  ++KLQ+IYKII+ QE ELQ+RC  LT SQTTE+K+LW IYKLN +LI NY+ FI TA
Sbjct: 204  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITA 263

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L  +Q  +DL++G+EI+DIY+IE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFIT+ FI 
Sbjct: 264  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFIC 323

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML+DIP KY+I W Q+LGDLSRMA++L+PSGFIDW+LSAE WY  +M+Y YG GKLY
Sbjct: 324  ISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 383

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNS----- 550
            YH++T+QQN+LEAFVNLGKSVFCQ+ F PSQQ LQL+I+NIYQ AF DR+S + +     
Sbjct: 384  YHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETA 443

Query: 551  -RNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQ 609
             RN Q L+DYLKH+EVMLLP+F+E+ DLQ VVLLYF +KFG D+N N+V  F  + MF Q
Sbjct: 444  HRNSQ-LIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDV--FSTKDMFCQ 500

Query: 610  NNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIV 669
            N + L++YFRHA AFAE+QILQL+G+GNPKNPFALLF LPK+L                 
Sbjct: 501  NPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFK-------------- 546

Query: 670  GEDGSSTTFSSVSGMEYMVNMET--NVFLGSEDFFNNIDKLAIN-NFMPNSISLWNDSLK 726
                        SG   + +     +    SE +F NID L  + N  P +I +W DSL 
Sbjct: 547  ----KDKREKKKSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLN 602

Query: 727  YHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIK 786
            Y N T+ +CS+ VL KFL+ PL VALPH L W++F+I++  ++E      +  FW  F++
Sbjct: 603  YINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLR 662

Query: 787  RIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKC 846
            R  PWNSMV F NVL+ YM+DN   +  L +  +++ SL L++L+  FN NE+LPEVWKC
Sbjct: 663  RTMPWNSMVTFSNVLVCYMLDNL--HPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKC 720

Query: 847  RGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIF 906
             GSLWFD +      + CD     G++D+ F D P+DGI FD+ DEIG KFW RSVR I 
Sbjct: 721  WGSLWFDAV------KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTIL 774

Query: 907  LFRGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSDDIMFDDMLVSNF 965
              +GI ++F   G L +++ A V  RR  +  +  L   +FKL    +D   D+  +   
Sbjct: 775  TLKGIAKKFPDLG-LKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDEL 833

Query: 966  -------EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYN 1018
                   E I++ N D  A P LS++ GE+IFEY GY R+  DY+ FDKNG   S   Y 
Sbjct: 834  YDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYT 893

Query: 1019 TWSINQDTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDD-- 1076
             WS N   GV                 D  +E       +D   + +   W K ++D   
Sbjct: 894  QWS-NVGNGVT---------------LDVSSE-----SLYDSTTNDLSLHWAKILFDKVF 932

Query: 1077 -IGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDE 1135
             IG+    +     YF++DATSWLRHFAH++K+A N+ILKF+ICLTTFQELR+LR SKD+
Sbjct: 933  TIGKNTDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDD 992

Query: 1136 NVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVI 1195
            NVVEAATR++IT+RQL+ E K++P+RFTGN+ATHIEE+LEFEEQITW++HVDEFVI+A+ 
Sbjct: 993  NVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIA 1052

Query: 1196 KA-ETKRKEQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247
            K  +  + E+ +   KG      VLVTDD NM  KA +K  KT +T+++F++ + L
Sbjct: 1053 KLNQNFQTERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKL 1108

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 20/119 (16%)

Query: 63  LGQKRHGSSSYYITP--NYIKKRVAKNSYNSATGNFLXXXXXXXXXXXXQTSLQNTPLA- 119
           L QKRH SSS+  TP  ++ K+RV         G               Q S+QN P   
Sbjct: 40  LHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKG-------FIDGITTSQISMQNIPFKA 92

Query: 120 ---SPKPSIAKNNIINTSTTPQPTYITQDSM---TSPFVLN-SNLPSNLDIVSNENLED 171
              S +PSI++  +    TTPQ    +  +M    SP+ +N + +  N+++VS E+ ++
Sbjct: 93  EDISRRPSISRKAM---ETTPQLHTSSNSAMDIPKSPYYVNRTAITRNMEVVSKESHDE 148

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/973 (50%), Positives = 653/973 (67%), Gaps = 88/973 (9%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            QAL++KLQ+IY+ I++QE ELQ+RCSQLT SQTT++KNLW+IYK+NA+LI+NY  FITTA
Sbjct: 283  QALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITTA 342

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L P+Q ++DLLIG+EI+++Y+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFIS
Sbjct: 343  LLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFIS 402

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS+ML DIP K++I WL++LGDLSRMA+AL+PSGFIDWKLSAE WY  A++Y++G+GKLY
Sbjct: 403  ISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKLY 462

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTL AFVNLGKSVFC++TF+PSQQY+QLVIDNIYQRAFA+RN S + RN   
Sbjct: 463  YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-SGHHRNAH- 520

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            LV+YLKH+EVMLLP+F+ES +LQ VVL +F +KFG+    +NV  F PR +F+Q++++LK
Sbjct: 521  LVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV---TSNVDFFDPRLVFVQDSERLK 577

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
             +FRHA+ +AE+ +LQLVG+G+P+NPFALLF LPK+L                       
Sbjct: 578  HFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKS----------- 626

Query: 676  TTFSSVSGMEYMVNMETN-VFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATK 734
                S +  +Y  +++ +  F    +FF  ID        P+ I++W +SL Y N TA K
Sbjct: 627  ---KSSTSTQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMK 683

Query: 735  CSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSM 794
            CSMIVL+KFL+GPL+ ALPH+LPW YFL +   ++       +  FW A ++++FP+N++
Sbjct: 684  CSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTI 743

Query: 795  VRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDI 854
            + FLNVLL YM +    N P +E  +Q+  ++L +L+  F  NE+LPEVW+C G+LWFD 
Sbjct: 744  ITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDA 803

Query: 855  IDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVER 914
            ++ K  + N       G+KD+ F+D P+DGI FD NDE G KFWKR  RVI LFR     
Sbjct: 804  LNTKHIT-NLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFR----- 857

Query: 915  FNGFGNLAISYNAPVINRR-GLGVNSHLVGYSFKLMAKSDDIMFDD---MLVSNFEEIDS 970
                   A++   PV  R    G N   + + F+        M+ +   ++   FE+I  
Sbjct: 858  -------ALALECPVGLREISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTFEQISP 910

Query: 971  NNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNG 1030
             N D  A P   M    +I    GY+ +  DYY F++NGD+I+ S Y   ++ + +G++G
Sbjct: 911  VNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTL-ESSGIHG 969

Query: 1031 GPLXXXXXXXXXXXXDPMNEKEL-------------FNKCFDPEYDSV-DEFW------N 1070
            G              D  N K L             +N   D E   + DEF       N
Sbjct: 970  G--------------DDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKN 1015

Query: 1071 KEIYDDIGRKFGMELYED---TYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELR 1127
               ++ +  +  +  + D   TYF+LDAT+WLRHF HVYK+A N+ILKF+ICLTTFQELR
Sbjct: 1016 DVRWEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELR 1075

Query: 1128 FLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVD 1187
            FLRKSKDE+V+EAATRA+IT+RQL+ E KLLPLRFTGNVA H+EEHLE EEQ+TWRSHVD
Sbjct: 1076 FLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVD 1135

Query: 1188 EFVIEAVIKAE---------TKRKEQEMHNMKGFQ----IVLVTDDSNMKNKALEKGSKT 1234
            EFVIEA+ KA+          K   ++       Q    I LVTDD NM+NKA  +  K 
Sbjct: 1136 EFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKA 1195

Query: 1235 FSTRFVFAISNYL 1247
            FSTRF+F++ N L
Sbjct: 1196 FSTRFMFSVCNEL 1208

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/965 (50%), Positives = 643/965 (66%), Gaps = 74/965 (7%)

Query: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
            Q LV+KLQ+IYK I+KQE ELQERCSQLT SQTT++KNLWVIYKLNA+LI+NY TFITTA
Sbjct: 321  QTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTA 380

Query: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
            L P+Q K+DLLIG+EI+++Y+IERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI +VFIS
Sbjct: 381  LLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFIS 440

Query: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
            IS++L +IP  +++ WL++LGDLSRMA+AL+PSGFIDWKLSAE WY  A++Y++G+GKLY
Sbjct: 441  ISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLY 500

Query: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
            YHMSTVQQNTL AFVNLGKSVFC++TF+PSQQY+QLVIDNIYQRAFA+RNS  +  +   
Sbjct: 501  YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYS--H 558

Query: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615
            +V+YLKH+EVMLLP+F+E+ + Q VVL +F +KFG   + N    F P  +F+Q+ ++LK
Sbjct: 559  IVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN---FFDPSLIFVQDCERLK 615

Query: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSS 675
             +FRHA+ +AE+ ILQLVG+G+P+NPFALLF LPK +                     S 
Sbjct: 616  HFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRK----------SK 665

Query: 676  TTFSSVSGMEYMVNMETNVFLGSE-DFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATK 734
            +T S+ S M        + FLG    FF  ++           +++W +SL Y N T+ +
Sbjct: 666  STASNQSDMSI-----DDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMR 720

Query: 735  CSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSM 794
            CSM+VL+KFLN  L+ ALPH+LPW YFL+++ L+++  ++     FW  FI++IFPW S+
Sbjct: 721  CSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESI 780

Query: 795  VRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDI 854
              FLNVLL Y+ D      P++E    Y ++ L ELL  F  NEDLPEVW C G+LWFD+
Sbjct: 781  TNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV 840

Query: 855  IDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIV-- 912
            I+ K  S   D ++  G+KD+ FLD PVDGI FD +DE G KFWKR VRVI LFRGI   
Sbjct: 841  INSKHVSNLVDIHS-TGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQ 899

Query: 913  -----ERFNG---FGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDMLVSN 964
                   FNG   + +L   +N P    +   + S    Y                    
Sbjct: 900  FPFGFTEFNGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEY------------------GE 941

Query: 965  FEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQ 1024
            FE I   N+D  + P   M+ G +I    GYK++  DY  F+KNGDLI+ S Y +     
Sbjct: 942  FESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEG 1001

Query: 1025 DTGV-NGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDS-VDEF--W----NKEIYDD 1076
             +GV N                   +E+  +N   D E    +DEF  W        ++ 
Sbjct: 1002 GSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQ 1061

Query: 1077 IGRKFGMELYED---TYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSK 1133
               +  ++ + D   TYF+LDAT+WLRHF HVYK+AT+++LKF+ICLTTFQELRFLRKSK
Sbjct: 1062 CLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSK 1121

Query: 1134 DENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEA 1193
            DE+V+EAATRA+IT+RQL+ E KLLPLRFTGNVA H+EEHLE EEQ+TWRSHVDEFVIEA
Sbjct: 1122 DESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEA 1181

Query: 1194 VIKAETK----RKEQEMHNMKGFQ---------IVLVTDDSNMKNKALEKGSKTFSTRFV 1240
            + KA++K     K+ +    +            I LVTDD NM+NKA  +  + FST+F+
Sbjct: 1182 IDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFM 1241

Query: 1241 FAISN 1245
            FAI +
Sbjct: 1242 FAICH 1246

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/967 (49%), Positives = 642/967 (66%), Gaps = 67/967 (6%)

Query: 318  LVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTALF 377
            LV+KLQ+IYK I+KQE ELQERCS LT  QTT++KNLW+ YK+NA+LI+NY+ FITTAL 
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 378  PSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 437
            PSQS+S L IG+EIVD+Y+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 438  SMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLYYH 497
            +ML+D+P KY+IPWL++LGDLSRMA+AL+PSGF+DWKLSAE WY  ++++++G+GKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 498  MSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQLLV 557
            MSTVQQNTLEAFVNLGKSVFC++ FVPS QY+QLVIDNIYQRAFA+R+SS N  N   +V
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTN--HIV 521

Query: 558  DYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLKFY 617
            DYLKH+EVMLLP+F+ES +LQ VV+ YF  KFG+  + N    F P  +FIQ+ ++LK +
Sbjct: 522  DYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN---FFDPNLIFIQDAERLKHF 578

Query: 618  FRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSSTT 677
            FRH++ F+++ ILQL G+G+PKNPFA+LF L K+L                  +   ST+
Sbjct: 579  FRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERK--------KSTKSTS 630

Query: 678  FSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCSM 737
              S+  +E+    + +    +EDFF+ ID   +    P  + +W  SL Y N T+ KC M
Sbjct: 631  EGSLDPVEFSSQQQAS----TEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGM 686

Query: 738  IVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRF 797
            IVL++FL GP++ ALPH+LPW+ F+ISI +++++  D  + +FW  FI+RIFPW+S++ F
Sbjct: 687  IVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITF 746

Query: 798  LNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDIIDE 857
            +N L+ Y +     N  ++     Y  +N EELL +   NE+LPE W C GSLWF+ I  
Sbjct: 747  MNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTI-S 805

Query: 858  KRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIV--ERF 915
            K++  +  +    G+ D  FLD P +GI FD++DE G K+W+R  R + LF  I   E  
Sbjct: 806  KKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEAC 865

Query: 916  NGFGNLAISYNAPVINRRGL------GVNSHLVGYSFKLMAKSDDIMFDDMLVSNFEEID 969
            +G+G+     N    + + L        N  L   S +L  + +    +      FE I 
Sbjct: 866  DGYGHGCKKLNPEATSWKNLVFRFNDDTNDQL---SVELYPEEN----ESFPFEKFEIIS 918

Query: 970  S-NNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSI------ 1022
            + N SD       SMI G +I    G+K ++ DY+ F+KNGDLI+ S Y    +      
Sbjct: 919  NLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQ 978

Query: 1023 -----NQDTGVNGGPLXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDI 1077
                 N +  ++ G L            D + E+       +P++    E  N+    ++
Sbjct: 979  GGDDFNANKILDNGRLVVQDRLEYSSAIDKL-EQPWLEAFMNPDFRQ-RELLNRSFLGNL 1036

Query: 1078 GRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENV 1137
              +    +   T+F+LDAT+WLRHFAH+YK+AT+S+LKF+ICLTTFQELRFLRKSKDE+V
Sbjct: 1037 NCQADTNV---TFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV 1093

Query: 1138 VEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKA 1197
            +EAATRA+I +RQL+ E KLL LRFTGNVA H+EEHLE EEQ+TW+SHVDEFVI+A+ KA
Sbjct: 1094 LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKA 1153

Query: 1198 ETKRK----------------EQEMHNMKGFQIV-LVTDDSNMKNKALEKGSKTFSTRFV 1240
            + K                   ++  + + F  V LVTDD NM+NKA + G +TFSTRFV
Sbjct: 1154 QDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFV 1213

Query: 1241 FAISNYL 1247
            FAI   L
Sbjct: 1214 FAICREL 1220

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 54/135 (40%), Gaps = 23/135 (17%)

Query: 62  NLGQKRHGSSSY-YITPNYIKKRVAKNSYNSATGNFLXXXXXXXXXXXXQTSLQ---NTP 117
            L QKRH S+S  Y   N IK+R         TG+ +            Q   Q    + 
Sbjct: 13  GLHQKRHNSNSVDYYDSNIIKRR---------TGDGVPENVDISVAEIPQEPCQYLDTSL 63

Query: 118 LASPK--------PSIAKNNIINTSTTPQPTYI--TQDSMTSPFVLNSNLPSNLDIVSNE 167
           L SP         PSI K + +    TPQP  +  + +   SPF L +   +N +  +  
Sbjct: 64  LTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTV 123

Query: 168 NLEDSIRKDQDFSQI 182
           N   SIR+    +++
Sbjct: 124 NENSSIRRSDSVTRL 138

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  488 bits (1256), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 247/378 (65%), Positives = 296/378 (78%), Gaps = 43/378 (11%)

Query: 316 QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
           QAL+QKLQDIYK+I+KQE++LQ+RCSQLT SQTT++KNLW IYK+N DLINNY+ FIT A
Sbjct: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455

Query: 376 LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
           L P+QSK+DL IGEEI++IY+IERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI+HVFI+
Sbjct: 456 LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515

Query: 436 ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
           IS +L+DIP KY+I WLQ+LGDLSRMA+AL+PSGFIDWKLSAE WY  AM+++Y +GKLY
Sbjct: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575

Query: 496 YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555
           YHMSTVQQNTLEAFVNLGKSVFCQ TF PSQQY+QLVIDNIYQRAF +RN + N RN Q 
Sbjct: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNHRNLQ- 633

Query: 556 LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGI------------------------ 591
           L++YLKH+EVMLLP F+ES DLQ VVL+YF  KFGI                        
Sbjct: 634 LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIP 693

Query: 592 -----------------DYNNNNVKMFQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVG 634
                              +   + +F+ + MFIQN D LK++FRH+  FA++ ILQLVG
Sbjct: 694 YSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVG 753

Query: 635 YGNPKNPFALLFSLPKYL 652
           +G+PKNPFALLF LPK+L
Sbjct: 754 FGDPKNPFALLFELPKFL 771

 Score =  425 bits (1093), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 250/588 (42%), Positives = 341/588 (57%), Gaps = 81/588 (13%)

Query: 699  EDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPW 758
            E+FF NID L     +P +I +W +SLK  N  + KCS+IVL+KFLNGP+++ALPH+L W
Sbjct: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925

Query: 759  VYFLISIALQIE-KYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNS--PL 815
            ++F+ISI L+IE    D     FWY+F+K I PWNS+V FLNVL+ Y++DN  D +   +
Sbjct: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985

Query: 816  NELCDQYGSL---NLEELLRNFNANEDLPEVWKCRGSLWFDIIDEKR------------- 859
              L ++Y S+   +L E+L+ FN NE+LPE+WKC G+LWFD+I  K              
Sbjct: 986  ISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNN 1045

Query: 860  ----------------NSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVR 903
                            N     +    GI+D+  LD P+DGI F  NDE GI F+KRS+R
Sbjct: 1046 NTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105

Query: 904  VIFLFRGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLM------------- 949
            +IFL + ++E F   G L IS+      R   +  N  L  ++FKL              
Sbjct: 1106 LIFLCKSMIETFPNLG-LKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQT 1164

Query: 950  ---------AKSDDIMFDDMLVSNF-------EEIDSNNSDFNAIPLLSMIYG-ENIFEY 992
                      ++DD+ F+  ++SN        E I+  N +    P LS++ G ENIF Y
Sbjct: 1165 EQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNY 1224

Query: 993  VGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGPLXXXXXXXXXXXXDPMNEKE 1052
            +GYKR++ +  SF +NG++IS S Y++W I  D                      M  + 
Sbjct: 1225 LGYKRLNFNIQSFHENGEIISGSIYSSWPI--DYNKFKEQQQQQQQQEHLVNDSTMKNEN 1282

Query: 1053 LFNKCFDPEYDSVDEFWNKEIYDDIG-----------RKFGMELYED-TYFILDATSWLR 1100
            +      PE  S  EF     +  +             K G+ + +  T+F+ DATSWLR
Sbjct: 1283 VTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLR 1342

Query: 1101 HFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPL 1160
            HFAH+YK++ N  LKF++CLTTFQELRFLRKSKD NVVEA+TRAIIT+RQL+ EGKLLPL
Sbjct: 1343 HFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPL 1402

Query: 1161 RFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKEQEMHN 1208
            RFTGNVAT IEEHLEFEEQITWRSHVDEFVIEA+I+++ + K + + N
Sbjct: 1403 RFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQN 1450

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  435 bits (1119), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 287/409 (70%), Gaps = 72/409 (17%)

Query: 316 QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375
           Q L+QKLQ+IYK+I+ QE+ELQ++C++L+ SQ+T++K LW IYKLN DLINNY+ FI T+
Sbjct: 267 QNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTS 326

Query: 376 LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435
           L PSQS +D LIG+EI++IYKIERRLW+YGTITFLD+LKNF+NFMDPE+  QFITHVF S
Sbjct: 327 LSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFES 386

Query: 436 ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495
           IS+M+ D+P  +  PW Q+LGDLSRMA+AL+PS FIDWKLS+E WY+ +M++++ +GKLY
Sbjct: 387 ISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLY 446

Query: 496 YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRN---------- 545
           YH+STVQQN LEAFVNLGKSVFC +TF+PSQ+Y+QLVIDNIYQRAF +RN          
Sbjct: 447 YHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSNNAG 506

Query: 546 ---------SSSNSRNCQ--LLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFG---- 590
                    +SS ++N Q   L++YLKHSEVMLLPNF+E+  L+ VVL YF   FG    
Sbjct: 507 SSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAI 566

Query: 591 ---------------------------IDYNNNN-------------------VKMFQPR 604
                                      I+  NN                    + +F  R
Sbjct: 567 QSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLFNFR 626

Query: 605 QMFIQ-NNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYL 652
            +F Q N+D LK++F+++  FAE+ ILQL+G+G+PKNPFALLF LPKYL
Sbjct: 627 NIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  305 bits (781), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 171/337 (50%), Positives = 207/337 (61%), Gaps = 59/337 (17%)

Query: 965  FEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSI-- 1022
            FE+    N+D N  P LS+I  E++FEY GYKR   D+ +FDKNG+LISTS Y +  I  
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 1023 ---------------------NQDTGVNGGPLXXXXXXXXXXXXDP----MNEKELFNKC 1057
                                 N D+    G              D     + EKE+FNK 
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 1058 FDPEYDSVDEFWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFS 1117
             DP+Y ++DE W  E++ D   +F      DTYF+LDATSWLRHFAHVYK+ATN ILKF+
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQFS-----DTYFVLDATSWLRHFAHVYKLATNGILKFA 1324

Query: 1118 ICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFE 1177
            ICLTTFQELRFLRKSKDENV+EAATRAIITLRQL+SE +LLPLRFTGN+ATHIEEHLEFE
Sbjct: 1325 ICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFE 1384

Query: 1178 EQITWRSHVDEFVIEAVIKAETKRKE---QEMHNMKG--------------------FQI 1214
            EQITWRSHVDEFVIEA+ +A+ KR++   QE  N+                         
Sbjct: 1385 EQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIF 1444

Query: 1215 VLVTDDSNMKNKALEKGSK----TFSTRFVFAISNYL 1247
            VLVTDD +M  K  E+ S     TFST+FVF++ N L
Sbjct: 1445 VLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  286 bits (731), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 137/276 (49%), Positives = 191/276 (69%), Gaps = 4/276 (1%)

Query: 683  GMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQK 742
            GME    M  N  L  +DFFNN++ L ++ F+PNS+ +WN+SLKY N  +  CS+IVL+K
Sbjct: 775  GMEDEDEMLDN--LSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKK 832

Query: 743  FLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLL 802
            FLNGPL V+LPH+LPW YF+IS+AL+IE  ++     FW  FI++IFPWNS+V +LNV++
Sbjct: 833  FLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVII 892

Query: 803  AYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANE-DLPEVWKCRGSLWFDIIDEKRNS 861
            + ++DNC++NS + +L + Y + NL+ELL  FN NE +LPEVWKC GSLWFD+I E    
Sbjct: 893  SVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQI 952

Query: 862  QNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERFNGFGNL 921
             + D      +KD + L++P+DG+ FDE +E G  FWKRS R+IFLF+ ++ RFNGFG L
Sbjct: 953  YSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGL 1012

Query: 922  AISYNAPV-INRRGLGVNSHLVGYSFKLMAKSDDIM 956
             IS N  V  NR  +  N  L  ++FKL+   D+ M
Sbjct: 1013 TISSNTSVYCNRSDIPNNHILRTFAFKLLPDDDNYM 1048

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  158 bits (399), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 195/934 (20%), Positives = 392/934 (41%), Gaps = 163/934 (17%)

Query: 354  LWVIYKLNADLINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVL 413
            L  ++KL+  +++ Y  FI  AL  + ++ DL+ G+E V   ++  RL  +     L+++
Sbjct: 144  LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 414  KNFSNFM----------DPEVCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAV 463
            +N+ N M          + +   +FI    I I+ ML++IP K+   W   +GDL+R+ +
Sbjct: 204  ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 464  ALFPSGFIDWKLSAERWY-----MAAMEYSYGYGK----------LYYHMSTVQQNTLEA 508
             L       ++L++   Y     + A+ YS   GK           Y+++S VQ ++L  
Sbjct: 264  LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 509  FVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADR-NSSSNSRNCQLLVDYLKHSEVML 567
             V L K +  +NT V  +   QL ID I  +    + N   +     +L+ Y       L
Sbjct: 324  IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYF-----TL 378

Query: 568  LPNFMESPDLQQV------VLLYFMEKFGIDYNNNNVKMFQP-----RQMFIQNNDQLKF 616
            L  F  S    Q+       L YF  +F  +Y+ N   + +P     RQ  I  +    F
Sbjct: 379  LSLFFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYS---MF 435

Query: 617  YFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLXXXXXXXXXXXXXNQIVGEDGSST 676
            YF +A  F+   I++ +      NPF                                  
Sbjct: 436  YFNNAPLFSLISIVETIIMNKKLNPFFC-------------------------------- 463

Query: 677  TFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCS 736
                             V+  S+DF   I  ++++N        W   ++  + T    +
Sbjct: 464  -----------------VYKSSDDF--EIKSVSLSN--------WKILIEQMDDTLLHSN 496

Query: 737  MIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMVR 796
             ++ +KFL   + ++ P ILPW+ F IS+A ++    D  ++  W   ++ + PW+ +V 
Sbjct: 497  KLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVT 556

Query: 797  FLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDIID 856
            +LN  +  +  +  ++  L  L     S +L +LL       +  E+  C G +WFD + 
Sbjct: 557  YLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLA 616

Query: 857  EKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERFN 916
             K    +    T   +  ++  +   D + +D++D++  K W R++ +I L + ++  + 
Sbjct: 617  SKIKQASIT--TNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYP 674

Query: 917  GFGNLAISYNAPVINRRGLGV-NSHLVGYSFKLMAKSDDIMFDDMLVSNFEEIDSNNSDF 975
               +++I         RG  + NS  +        K+ D + +D L     E+++N    
Sbjct: 675  ELIDVSI---------RGQSLTNSSCI--------KNSDSLTNDYLFDWGFELNNN---- 713

Query: 976  NAIPLLSMIYGEN---IFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGP 1032
            NA+ +   ++G N    F Y+       D+  FDKNGD+       TW         G  
Sbjct: 714  NAVIIDDTLHGRNRIFKFSYI------PDFQDFDKNGDI-------TW---------GYS 751

Query: 1033 LXXXXXXXXXXXXDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRKFGMELYEDTYFI 1092
            L            +   +   F +       + +++      +D  +K+  +L E+ YF+
Sbjct: 752  LISNYDYIYSNDFNSEEDGNFFQRYSRRLLSAHNDY-----SEDKSKKYLPKL-ENNYFM 805

Query: 1093 LDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRK-SKDENVVEAATRAIITLRQL 1151
            +D  +WL+H   + +      +K  + ++   +L  L+  S+ E+V  +A+R +I +  L
Sbjct: 806  VDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYL 865

Query: 1152 FSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKEQEMHNMKG 1211
            ++  ++  L+   +  +   ++++  + + +     +F  + + K     ++  M  ++ 
Sbjct: 866  YAMNQINILKEFESPISKALKNIDGSQILNFNG---KFKNDLLTKENGPGQQLNMIELRM 922

Query: 1212 FQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISN 1245
              +V+V+DD        +KG    ST+ +F++++
Sbjct: 923  DNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

>Skud_1.6 Chr1 (15260..17902) [2643 bp, 880 aa] {ON} YAL056W (REAL)
          Length = 880

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1051 KELFNKCFDP-----EYDSVDEFWNKEIYDDIGRKFGMELY-EDTYFILDATSWLRHFAH 1104
            + L + CF+P      Y SV E + KEI+ D G       Y    Y+ L     LRH +H
Sbjct: 40   RSLGDHCFEPLPYMTNYSSVFELYGKEIFGDKGNASSRNEYLLKKYYSLKKPFVLRHNSH 99

Query: 1105 VYKIATNSILKFSICLTTFQELRFLRKS 1132
              K       +  I  T F   RFL ++
Sbjct: 100  TLKNIDMPPQRNDILQTNFMVDRFLNRT 127

>NCAS0G01610 Chr7 complement(285839..288361) [2523 bp, 840 aa] {ON}
            Anc_2.48 YNL201C
          Length = 840

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 14/112 (12%)

Query: 915  FNGFGNLAISYNAPVINRRGLG---VNSHLVGYSFKLMAKSDDIMF---------DDMLV 962
            +NG   L    N PV+  +      +N +L+G   +L+ +  DI F           +++
Sbjct: 714  YNGLNGLNDPTNDPVLGYKRTNFTMLNKYLLGRYGELIERLQDIPFIKDMIEFNKTQLML 773

Query: 963  SNFEEIDSNNSDFNAIPLLSMIYGE-NIFEY-VGYKRIHADYYSFDKNGDLI 1012
             N E+ D N  D  A+ L  +   + NI E  +G KR+H++  S + NG+LI
Sbjct: 774  ENAEKDDFNEKDDIAMNLTELRSNDTNINELRIGDKRLHSELDSSNSNGNLI 825

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,278,129
Number of extensions: 6245716
Number of successful extensions: 23734
Number of sequences better than 10.0: 122
Number of HSP's gapped: 24366
Number of HSP's successfully gapped: 151
Length of query: 1260
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1139
Effective length of database: 39,606,813
Effective search space: 45112160007
Effective search space used: 45112160007
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)