Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1043.715.703ON58558528500.0
Skud_9.185.703ON57157713770.0
YIL150C (MCM10)5.703ON57156913550.0
Smik_9.195.703ON57258513441e-180
NCAS0G002205.703ON59257213451e-180
Suva_9.385.703ON56957313291e-178
ZYRO0G06578g5.703ON56956213241e-177
TPHA0E002105.703ON54450413201e-177
TDEL0B021705.703ON56756513001e-173
CAGL0H06589g5.703ON58357012851e-171
NDAI0F002805.703ON61059312681e-168
KAFR0D022105.703ON58457612641e-168
TBLA0G010205.703ON59458812151e-160
KNAG0L021505.703ON61660211681e-153
KLTH0E01034g5.703ON58356411521e-151
SAKL0E14938g5.703ON57457211061e-144
Kwal_55.196915.703ON46645410811e-142
AFR287W5.703ON6115149331e-118
KLLA0A00572g5.703ON5775598461e-105
TPHA0B017404.323ON702109761.5
NDAI0H030302.380ON35058732.4
Ecym_82052.153ON11447683.1
NCAS0J018104.301ON710193706.1
NDAI0J015308.231ON158063707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1043.71
         (585 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...  1102   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   535   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   526   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   522   e-180
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   522   e-180
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   516   e-178
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   514   e-177
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   513   e-177
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   505   e-173
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   499   e-171
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   493   e-168
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   491   e-168
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   472   e-160
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   454   e-153
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   448   e-151
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   430   e-144
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   421   e-142
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   363   e-118
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   330   e-105
TPHA0B01740 Chr2 (387569..389677) [2109 bp, 702 aa] {ON} Anc_4.3...    34   1.5  
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    33   2.4  
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...    31   3.1  
NCAS0J01810 Chr10 (338250..340382) [2133 bp, 710 aa] {ON} Anc_4....    32   6.1  
NDAI0J01530 Chr10 complement(356838..361580) [4743 bp, 1580 aa] ...    32   7.4  

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score = 1102 bits (2850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/585 (92%), Positives = 541/585 (92%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNFVQ 60
           MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIER                    PNFVQ
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNFVQ 60

Query: 61  VPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEKFYNSKKD 120
           VPSSPKKSRVVELKPTSKPID            VALMTKDDSNYGTTSYFMEKFYNSKKD
Sbjct: 61  VPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEKFYNSKKD 120

Query: 121 HERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLMLLD 180
           HERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLMLLD
Sbjct: 121 HERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLMLLD 180

Query: 181 IKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQHN 240
           IKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQHN
Sbjct: 181 IKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQHN 240

Query: 241 LDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKFDCI 300
           LDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKFDCI
Sbjct: 241 LDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKFDCI 300

Query: 301 LEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYALG 360
           LEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYALG
Sbjct: 301 LEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYALG 360

Query: 361 APTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSAKAF 420
           APTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSAKAF
Sbjct: 361 APTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSAKAF 420

Query: 421 FDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESKNFKNLKNATQATLQTGI 480
           FDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESKNFKNLKNATQATLQTGI
Sbjct: 421 FDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESKNFKNLKNATQATLQTGI 480

Query: 481 LQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDTVNLKPSKDDLIK 540
           LQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDTVNLKPSKDDLIK
Sbjct: 481 LQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDTVNLKPSKDDLIK 540

Query: 541 RRIDRQRNWKKLFGKQQXXXXXXXXXXXXLKILHNSSTKDQKYQL 585
           RRIDRQRNWKKLFGKQQ            LKILHNSSTKDQKYQL
Sbjct: 541 RRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKILHNSSTKDQKYQL 585

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/577 (48%), Positives = 375/577 (64%), Gaps = 47/577 (8%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           M+DPRE    D Y+N++SDE ++  I+++L+ +ER                    PNF  
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 59  VQVPSSPKKSRVV---------ELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSY 109
           ++VP SP K+R +         +++P +  I+              L  K +    TT Y
Sbjct: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQ--------LQQKQELPSNTTGY 112

Query: 110 FMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYI 169
           FM+KF N+K++ E++   Y +MM++RVHTF GT  KKE++ T  +EL+++SN+W++ RYI
Sbjct: 113 FMQKFQNAKRNEEKQRAKYENMMNARVHTF-GT-DKKEYRATIANELEEFSNIWVKKRYI 170

Query: 170 PVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKY 229
           P D+L   L +IKILRL KLFAK+RPPKF EP Y+NW V G+I+ K D+K+TSS KP K+
Sbjct: 171 PEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKF 230

Query: 230 FKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSF 289
           F FTI+DFQH LDV+IFG K VE+YYNLR+GDV+AILNPE+LPWRPS    G G+ IKSF
Sbjct: 231 FMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPS----GQGNFIKSF 286

Query: 290 NLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSN 349
           NLRISH F CILEIG+SRDLGWCPI N  KN  C +PIN +    C YHRE+QFR T++ 
Sbjct: 287 NLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAK 346

Query: 350 RVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMH 409
           R+EL+G YALGAPTKVDA+P LY+ +G +N + V+     +S+   + +K+S       H
Sbjct: 347 RIELNGGYALGAPTKVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNS-------H 399

Query: 410 HFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSK------------MERNLVKALKNT 457
           +F   NSAKAFFDE FQNPD+L NLDSKRRKI DSK            M R     L++ 
Sbjct: 400 NFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDK 459

Query: 458 VDKESKNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEA 517
            D+E    + +K  T++ LQTG+LQRLGFDPT GK+S V+++S    E  NK    KK  
Sbjct: 460 CDEEK---QKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTV 516

Query: 518 LDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFG 554
           +DDL+ ++K+ V L PSK++  K+R  R+  W+K FG
Sbjct: 517 IDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFG 553

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/569 (46%), Positives = 373/569 (65%), Gaps = 25/569 (4%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           MNDPRE    D Y+N++SDE ++  I+ +L+ +ER                    PNF  
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 59  VQVPSSPKKSRV-VELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEKFYNS 117
           ++VP SP K+RV V     ++                 L  +      TT+YFMEKF N+
Sbjct: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 118 KKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLM 177
           KK+ ++++  + SMM++RVHTFS    +K++ P   +EL+ +SNLW++ RYIP D+L   
Sbjct: 121 KKNEDKQIAKFESMMNARVHTFST--DEKKYVPIITNELESFSNLWVKKRYIPEDDLKRA 178

Query: 178 LLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDF 237
           L +IKILRL KLFAK+RPPKF EP+Y+NW   G+I+ K DIK+TSS KP K+F FTI+DF
Sbjct: 179 LHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238

Query: 238 QHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKF 297
           QH LDV+IFG KGVE+YYNLR+GDV+AILNPE+LPWRPS    G G+ IKSFNLRISH F
Sbjct: 239 QHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS----GRGNFIKSFNLRISHDF 294

Query: 298 DCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTY 357
            CILEIG+SRDLGWCPI N   +  C +PIN S    C YHRE+QFR T++ R+EL+G Y
Sbjct: 295 KCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGY 354

Query: 358 ALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSA 417
           ALGAPTKVD++P+LY+ +G       +  +N++  +  +  ++  +L+   H+F+  NSA
Sbjct: 355 ALGAPTKVDSQPSLYKAKG-------ENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSA 407

Query: 418 KAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALK-----NTVDKESKNFKNL 468
           KAFFDE FQNPD+L NLD+KRRKI ++K    + R L K ++        DK     + +
Sbjct: 408 KAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKM 467

Query: 469 KNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDT 528
           K  T++ LQTG++QRLGFDPT GK+S V+++S S +E  N    +KK  ++DL+ ++K+ 
Sbjct: 468 KRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEK 527

Query: 529 VNLKPSKDDLIKRRIDRQRNWKKLFGKQQ 557
           V L PSK++  K+R  R+  W+K FG ++
Sbjct: 528 VILAPSKNEWFKKRSHREEVWQKHFGSKE 556

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  522 bits (1344), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 267/585 (45%), Positives = 374/585 (63%), Gaps = 25/585 (4%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           M+DPRE    D Y++++SDE ++  I+++L+ +ER                    PNF  
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 59  VQVPSSPKKSRVVELKPTS-KPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEKFYNS 117
           ++VP SP KSRV      + K +               +  + +    TT+YFM+KF N+
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 118 KKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLM 177
           KKD +R++  + SMM +RVHTF GT +KK +KP   +EL+ +SNLW++ RYIP D+L   
Sbjct: 121 KKDEDRQIAKFESMMDARVHTF-GTDNKK-YKPIIANELEGFSNLWVKKRYIPEDDLKRS 178

Query: 178 LLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDF 237
           L +IKILRL KLFAKVRPPKF  P+Y+NW   G+I+ K DIK+TSS KP K+F FTI+DF
Sbjct: 179 LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238

Query: 238 QHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKF 297
           QH LDV+IFG KGVE+YYNLR+GD++AILNPE+LPWRPS    G G+ IKSFNLRISH F
Sbjct: 239 QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS----GRGNFIKSFNLRISHDF 294

Query: 298 DCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTY 357
            CILEIG+SRDLGWCPI N   +  C +PIN S    C YHRE+QFR T++ R+EL+G Y
Sbjct: 295 KCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGY 354

Query: 358 ALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSA 417
           ALGAPTKV+++P+LY+ +G       +  +N++ D+     ++  +++   H+F+  NSA
Sbjct: 355 ALGAPTKVNSQPSLYKAKG-------ENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSA 407

Query: 418 KAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALK-----NTVDKESKNFKNL 468
           KAFFDE FQNPD+L NLD+KRRKI D+K    + R L K ++        DK     + +
Sbjct: 408 KAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKM 467

Query: 469 KNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDT 528
           K  T+  LQTG++QRLGFDPT G++S V+++S    E  N     KK  ++DL+ ++K+ 
Sbjct: 468 KQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK 527

Query: 529 VNLKPSKDDLIKRRIDRQRNWKKLFGKQQXXXXXXXXXXXXLKIL 573
           V L PSK++  K+R  R+  W++ FG +             L+I+
Sbjct: 528 VILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  522 bits (1345), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 283/572 (49%), Positives = 377/572 (65%), Gaps = 22/572 (3%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           MNDPRE    D Y N+SSDE +++ I   L+ +ER                    PNF  
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 59  VQVPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDS-NYGTTSYFMEKFYNS 117
           +QVP SP K     +    K               + +  K       TT+YFMEKF  S
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120

Query: 118 KKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLM 177
           KK+ E K+    +MM++RVHTF   G K+EFKP  V+E+++YSN+WL+ RYIP  EL  M
Sbjct: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180

Query: 178 LLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDF 237
           L +IKILRL KLFAKVRPPKF+EPQYSNW   GII++K D K+T++ KP KY KFT++DF
Sbjct: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240

Query: 238 QHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKF 297
           QH LDV+IFG  GVE+YYNLRVGDV+AILNPE+ PWRPS    G G  IKSFNLRI+H F
Sbjct: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPS----GKGQFIKSFNLRINHDF 296

Query: 298 DCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTY 357
            CILEIG+S+DLG+C +  +   TLC TPIN SKED+C YH+EI+FR   S R+EL+G++
Sbjct: 297 KCILEIGSSKDLGFCKV-TSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSF 355

Query: 358 ALGAPTKVDARPALYQNR-GTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNS 416
           ALGAPTKV+  P LY+ + G + +SR  +    VS S     KD  + + R  HFS  NS
Sbjct: 356 ALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKD--QFDLRNRHFSNNNS 413

Query: 417 AKAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALKNTV-----DKESKNFKN 467
           AKAFFDE FQNPD+LNNL+SKRRKI+D K    +++ L KA+ N       ++ +   K 
Sbjct: 414 AKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQ 473

Query: 468 LKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEV-TNKYQME-KKEALDDLMTFR 525
           +K AT+ TLQ+G++QRLGFDPT GK+++V+R ++S+ E  T   QM  KK+ ++DL+ FR
Sbjct: 474 MKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFR 533

Query: 526 KDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQ 557
           K  V L P++++LI+RR  R+R W++ FG+++
Sbjct: 534 KSHVILAPTRNELIERRDRRERIWQENFGQKR 565

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  516 bits (1329), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 265/573 (46%), Positives = 372/573 (64%), Gaps = 35/573 (6%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           M+DPRE    D Y+N++SDE ++  I+++L+ +ER                    PNF  
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 59  VQVPSSPKKSRVVE-----LKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEK 113
           V+VP SP K  +V+     LK   +P+             +      +S   TT+YFM+K
Sbjct: 61  VEVPQSPAKKSIVKKSQDALKQAIRPV------ASNINESMLSQQSQESPSNTTTYFMQK 114

Query: 114 FYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDE 173
           F ++K++ ++++  Y  MM++RVHTF GT +K E+KP   +EL+ +SNLW++ RYIP ++
Sbjct: 115 FQDAKRNEDKQIAKYEGMMNARVHTF-GTDNK-EYKPIITNELESFSNLWVKKRYIPEED 172

Query: 174 LNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFT 233
           L   L +IKILRL KLFAK+RPPKF EP Y+NW   G+I+ K DIK+TSS KP K+F FT
Sbjct: 173 LKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFT 232

Query: 234 ISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRI 293
           I+DFQH+LDV+IFG KGVE+YYNLR+GDV+AILNPE+LPWRPS    G G+ IKSFNLRI
Sbjct: 233 ITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS----GRGNFIKSFNLRI 288

Query: 294 SHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVEL 353
           SH F CILEIG+SRDLGWCPI N   +  C +PIN +    C YHRE+QFR T + R+EL
Sbjct: 289 SHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIEL 348

Query: 354 SGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFST 413
           +G YALGAPTKVD++P+LY+ +G       +  +N+V  +     ++  +++   H+F+ 
Sbjct: 349 NGGYALGAPTKVDSQPSLYRAKG-------ENQFNIVRSTRKGLSEEEERVKRNSHNFTN 401

Query: 414 MNSAKAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALK-----NTVDKESKN 464
            NSAKAFFDE FQNPD+L NLDSKRRKI D+K    + R L K ++        DK    
Sbjct: 402 SNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGE 461

Query: 465 FKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTF 524
            + +K  T++ LQTG++QRLGFDPT GK+S V+++S    E        KK  ++DL+ +
Sbjct: 462 KQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQY 521

Query: 525 RKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQ 557
           +K+ V L PSK++  K+R  R+  W++ FG ++
Sbjct: 522 KKEKVILAPSKNEWFKKRSHREEVWQRHFGSKE 554

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  514 bits (1324), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 264/562 (46%), Positives = 377/562 (67%), Gaps = 18/562 (3%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           M DPRE    DLY  L+S+  E++EI  Q+  IER                    PN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 59  VQVPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEKFYNSK 118
           +QV SSPKK     L PT +  +            +   +++     TTS+F+EK+  SK
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSK 120

Query: 119 KDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLML 178
           +  + +V A   ++S+RVHTF G   + E+KP   +EL+++SNLW+  RYIP +E   + 
Sbjct: 121 RKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIF 180

Query: 179 LDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQ 238
            +IKILRL KLFAKV+PPKF EP YSNW V G+I++K ++K+TS++ P KYFKFT+++FQ
Sbjct: 181 ANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQ 240

Query: 239 HNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKFD 298
           +++D +IFG +GVE+YYNLRVGD++AILNP++LPWRPS    G+ + IKSFNLRISHKF+
Sbjct: 241 YSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPS----GTKAHIKSFNLRISHKFE 296

Query: 299 CILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYA 358
           CILEIGASRDLGWCP+ N SKN +C+ PINK KED C+YHRE++FR T + RVELSGTYA
Sbjct: 297 CILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYA 356

Query: 359 LGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSD-SHYQKRKDSNKLETRMHHFSTMNSA 417
           LGAPT++DA+PALY  RG S+   +  +YN++++ +     K+ N L+    HFS  N+A
Sbjct: 357 LGAPTRIDAQPALY--RGGSSQKNL--NYNIITNGADGGSNKEINPLDINARHFSNRNAA 412

Query: 418 KAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVD-----KESKNFKNLKNAT 472
           KAFFDE FQNP+ L NL++KRRK++D++    L + LK   +     K ++    +K  T
Sbjct: 413 KAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKKNSELDIKHKSAEEIDEIKRTT 472

Query: 473 QATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDTVNLK 532
           ++T+ +G+++ LGFDPT GK++SV ++  S+++   K   EK  ++  L++F+KD V LK
Sbjct: 473 ESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSD--KKPLTEKDSSVASLLSFKKDNVKLK 530

Query: 533 PSKDDLIKRRIDRQRNWKKLFG 554
           PSK+ LIK++  R+R WK+ FG
Sbjct: 531 PSKEILIKQKRRRERVWKEHFG 552

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  513 bits (1320), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 251/504 (49%), Positives = 353/504 (70%), Gaps = 17/504 (3%)

Query: 56  PNF--VQVPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEK 113
           PNF  +Q+  SP+K +      T  PI               +++  +    TTSYFM+ 
Sbjct: 16  PNFTDIQIQRSPEKKKS-NPNTTVNPIPLKRLVEDVNPNEAKVVSNANLPANTTSYFMQN 74

Query: 114 FYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDE 173
           F  +KK+  ++V  Y   MSSRVH+F+G    K+++   V+EL++YS   +  RY+P +E
Sbjct: 75  FLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEEYSRFNISKRYLPKEE 134

Query: 174 LNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFT 233
           ++  L +IKILRL KLFAK+RPPKF+EP Y+NW VTGII SK+DIK TSS  P K+FKFT
Sbjct: 135 VSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDIKLTSSKTPVKFFKFT 194

Query: 234 ISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRI 293
           I++FQH LD+FIFG  GVEKYYNLRVGD++ ILNPE+LPWRP       G++IKSFNLRI
Sbjct: 195 ITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE----FKGNSIKSFNLRI 250

Query: 294 SHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVEL 353
           SHKFDCILEI  S+D+ WC   N      C TPINKSK+D C YH+E+QFR   + RVEL
Sbjct: 251 SHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKEMQFRSANAKRVEL 310

Query: 354 SGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFST 413
           SGTYALGAPT++D+RPALY+++ TS N +   ++N+V+D  Y K+K+++ + ++ HHFS+
Sbjct: 311 SGTYALGAPTQIDSRPALYRSKNTS-NLKPGNNFNIVADRRYMKKKENDPINSKRHHFSS 369

Query: 414 MNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTV--------DKESKNF 465
            NSAKAFFDEDFQNPD+L NL++KRRKIKD K +  L +AL+ +V        DK ++  
Sbjct: 370 SNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVGNSKLLLKDKSNQEI 429

Query: 466 KNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFR 525
           ++++N T ATLQ G +Q+LGFDPTGG++  V+  S ++    +K Q +K  A+++L+TF+
Sbjct: 430 QSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKS-ADKSTQSKLQKQKSNAMENLVTFK 488

Query: 526 KDTVNLKPSKDDLIKRRIDRQRNW 549
           K +VNLKPS++ L+++   R++++
Sbjct: 489 KSSVNLKPSREVLLEKLHHREQSF 512

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  505 bits (1300), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 265/565 (46%), Positives = 365/565 (64%), Gaps = 26/565 (4%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           MNDPRE  + D +  L+SDE +Q E+ +Q+  IER                    PNF  
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSKD-PNFDA 59

Query: 59  VQVPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEKFYNSK 118
           +QV SSP K     +K                   V   ++  +N  TTSYF++ F NSK
Sbjct: 60  IQVESSPVKKPAESIKVEPSRTKRVLDIENLNEKKVESRSQIPAN--TTSYFIDNFRNSK 117

Query: 119 KDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLML 178
           K+ ++       ++S RVHTF G     +FK   V+E+++YS+LW++ RYI  D+L  +L
Sbjct: 118 KEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKVL 177

Query: 179 LDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQ 238
            ++KILRL KLFAK++PPKF EPQYSNW   GII++K  +K++SS KP KYFKFT++DFQ
Sbjct: 178 HEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDFQ 237

Query: 239 HNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKFD 298
           +NLDV++FG KGVE+YYNLRVGD+VAILNPE+LPWRPSE     G+ IKSFNLRISH F 
Sbjct: 238 YNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSE----KGNFIKSFNLRISHDFP 293

Query: 299 CILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYA 358
           CILEIG SRD+ WC   N S+N  C TPINK+KE  C +HREIQFR   + R+EL+G++A
Sbjct: 294 CILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFA 353

Query: 359 LGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSAK 418
           LGAPTKVD+ PALY+ +    +   +     V  +HYQK    N  + R  HFS  N+AK
Sbjct: 354 LGAPTKVDSGPALYREKSAGAHRNFK-----VLPNHYQKSVGKNS-DLRGIHFSNGNAAK 407

Query: 419 AFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNT--------VDKESKNFKNLKN 470
           AFF+++FQNPDILNNLDSKRRK +D K    L + LK          ++K SK ++ +  
Sbjct: 408 AFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIEKGSKKYEEICE 467

Query: 471 ATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKE-ALDDLMTFRKDTV 529
            T+ATLQ+G++Q LGFDPT G++ +V++ +  +   +N  Q+ KK+  +  L+ F+K+ V
Sbjct: 468 TTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDK--SNNGQLNKKQKEVSSLLKFKKEHV 525

Query: 530 NLKPSKDDLIKRRIDRQRNWKKLFG 554
            LKP+K+ L++R+ DR+R W++ FG
Sbjct: 526 ELKPAKEVLLQRKRDRERAWQENFG 550

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  499 bits (1285), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 267/570 (46%), Positives = 365/570 (64%), Gaps = 24/570 (4%)

Query: 2   NDPREHAKEDLYSNLSSDEGEQD-EISEQLKAIERXXXXXXXXXXXXXXXXXXXX--PNF 58
           NDPRE    D Y++LS D+ EQ+ +I  +L+ IER                      PN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 59  --------VQVPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVA-----LMTKDDSNYG 105
                   V+VP SPK+  +   +     +                    ++ K+     
Sbjct: 67  KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELDVVA 126

Query: 106 TTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLR 165
           TTSYF  KF NSK D  R V AY  MMS+R HTF+G+ S  + K    DEL+ YSN  ++
Sbjct: 127 TTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHIK 186

Query: 166 SRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSK 225
            RYIP DE++ +L  IKILRL KLFAKVRPP F+EPQYSNWV  G I+SK+D+K T+++K
Sbjct: 187 KRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAAK 246

Query: 226 PTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGST 285
           P KYFKFT++DF+HNLDV++FG K VE+YYNLRVGD++A+LNPEILPWRPS    G  + 
Sbjct: 247 PVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPS----GCVNG 302

Query: 286 IKSFNLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRK 345
           IKSFNLRI H F+CILEIGASRDLGWC + N  ++ +C +PIN   +  C++HRE+Q R 
Sbjct: 303 IKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRS 362

Query: 346 TTSNRVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHY--QKRKDSNK 403
           T S R+ELSG+YALGAPTKV  +P++Y++   S N+   K + M S + +  +K ++  K
Sbjct: 363 TASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAK-HKMFSITGHGSKKEQEKEK 421

Query: 404 LETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESK 463
            E   HHFS   +AKAFFD+ FQ+P +L NL+SKRRKIK SKM+RNL+KAL      +SK
Sbjct: 422 HEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALNGEDASQSK 481

Query: 464 NFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMT 523
           N + +K  T+ TLQTG++QRLGFDP+GG+++ V+  S   T+  +    +K   ++DL+ 
Sbjct: 482 NKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRG-TKTDDPTISKKMGLINDLIH 540

Query: 524 FRKDTVNLKPSKDDLIKRRIDRQRNWKKLF 553
           F+KD + LKPS++  +++R  R+  WKK F
Sbjct: 541 FKKDKIKLKPSREIQLEKRHRREAIWKKHF 570

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  493 bits (1268), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 267/593 (45%), Positives = 373/593 (62%), Gaps = 46/593 (7%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           MNDPRE + ED +++LS  E  +D + E+L+ ++R                    PNF  
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 59  VQVPSSPKKSRV------------VELKPTSKPIDXXXXXXXXXXXXVALMTKDDS---- 102
           VQ+P +P++                + K      +            + +  ++++    
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 103 NYGTTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGS-----KKEFKPTDVDELD 157
              TTSYFMEKF + KK  E + V    M+ +RVH F G        K E++P   +E++
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 158 QYSNLWLRSRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDD 217
           +YS L ++ RYIP  ELN +  +IKILRL KLFAKVRPPKF EPQYSNWV  GIIT K  
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 218 IKYTSSSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSE 277
           IK+TSS KP KYFKFTISDF++N+D+FIF    VE+YYNLR+GD++AILNPE+LPWRPS 
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 278 NSGGSGSTIKSFNLRISHKFDCILEIGASRDLGWCPIPN-ASKNTLCKTPINKSKEDKCQ 336
           N  G+G  IKSFNLRI+H + CI+E+G S+DLG+CPIPN  +++  C TPI+ SKED+C 
Sbjct: 301 NKNGTG--IKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCS 358

Query: 337 YHREIQFRKTTSNRVELSGTYALGAPTKVDARPALYQN-----RGTSNNSRVQKSYNMVS 391
           YH+EI+FR   S R+EL+G++ALGAP KV A+P LY+N     RG  + +R    +N+V 
Sbjct: 359 YHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNR----FNVVK 414

Query: 392 DSHYQKRKDSNKLETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSK----ME 447
            S  +K +     E R  +FS+ NSAKAFFDE FQNPD+L NLD+KRRKI D K    ++
Sbjct: 415 GSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLD 474

Query: 448 RNLVKALKN------TVDKESKNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSN 501
           + L KA++N      + +K  K +  +K+AT+ TLQTG++QRLGFDPT GK++ V++ + 
Sbjct: 475 QELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQ-TG 533

Query: 502 SETEVTNKYQMEKKEALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFG 554
            ++   N +   K E + DL+ F+K  V L P+K++LIKR+  R+  W+K FG
Sbjct: 534 KDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFG 586

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  491 bits (1264), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 262/576 (45%), Positives = 363/576 (63%), Gaps = 29/576 (5%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           M+DPRE A  DLY N++ D+ +   I  +L+ IE                     PNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 59  VQVPSSPKKS---RVVELKPTSKPIDXXXXXXXXXXXXVALMTK--------DDSNYGTT 107
           VQVP+SP K    ++VE K                   + L  +        +DSN  +T
Sbjct: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSN-AST 119

Query: 108 SYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSR 167
            YFMEKF ++K+  +  +  + SMM SRVHTF+G   K E++   VDEL+QYSNLW+  R
Sbjct: 120 EYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKR 179

Query: 168 YIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPT 227
           Y PV  L  ML ++KILRL KLFAKVRPPKF EPQYSNWVV GI++ K DIK+T+S+KP 
Sbjct: 180 YTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQ 239

Query: 228 KYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIK 287
           KY KFT++DF+H +D +IFG +GVE+YYNLR+GD++A+LNPEILPWRPS    G  + IK
Sbjct: 240 KYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPS----GKQNYIK 295

Query: 288 SFNLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTT 347
           SFNLRISH + CILEIG SRDL  CPI   S +  C  PINK  +  C+YHRE++ RK  
Sbjct: 296 SFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGP 355

Query: 348 SNRVELSGTYALGAPTKVDARPALYQNRG-TSNNSRVQKSYNMVSDSHYQKRKDSNKLET 406
           S R++LSG YALGAPTK++++PALY  RG T+ N ++Q ++ +            +K   
Sbjct: 356 SKRLDLSGQYALGAPTKLESQPALY--RGHTAQNVKIQ-NFKLTPSYSQNNPHLIDKYGE 412

Query: 407 RMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALKNTVDKES 462
           +   FS  N+AKAFFD++FQNPD+++NLD+KRRKI + +    + R L + L+   D E 
Sbjct: 413 KSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQDLEG 472

Query: 463 K---NFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALD 519
           K     + +K  TQ TLQ+G+ Q++GFDPTGGK+S +++N     +   K+  +K   +D
Sbjct: 473 KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVD 532

Query: 520 DLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGK 555
           DLM F+K+ + L PSK DL+ ++  R++ W++ FG+
Sbjct: 533 DLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQ 568

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  472 bits (1215), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 252/588 (42%), Positives = 359/588 (61%), Gaps = 46/588 (7%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNFV- 59
           MNDPRE  + DL+ N+S DE E+ E+ +Q++ IER                    PNF+ 
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 60  -------------QVPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSN--- 103
                        QVP SP+K +    +  + P+             + L  + +     
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120

Query: 104 YGTTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSG-TGSKKEFKPTDVDELDQYSNL 162
            G+T+YFM  F +SKK   +K+  Y ++MS+RVH+F   T  +KE +  +V+E ++YS L
Sbjct: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180

Query: 163 WLRSRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTS 222
           W+  RY+  + ++ +L DIKILRL KLFAK+RPPKF  PQYSNWV  G+IT K   K TS
Sbjct: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240

Query: 223 SSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGS 282
           S+ P KYFKFTI DFQ N+ +F+F  + + KYYNLRVGD++ ILNP I PWRPSE +G  
Sbjct: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENG-- 298

Query: 283 GSTIKSFNLRISHKFDCILEIGASRDLGWCPIPNASKNTL-CKTPINKSKEDKCQYHREI 341
              IKSFNL I  K+DCI+EIG SRDLGWC +P  SK    C TPINK+K+  C++HRE 
Sbjct: 299 --YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRET 356

Query: 342 QFRKTTSNRVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDS 401
           +FR   + R+EL+G++ALGAPTK D  P+LY+ +  +NN   +  +N+V   + +K  DS
Sbjct: 357 EFRNAAAKRIELNGSFALGAPTKADTNPSLYKKK--TNNIYSKNQFNVVRRRNARKEGDS 414

Query: 402 NKLETRMH--HFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVD 459
                ++H  +F + N AKAFF+++FQNPDI++NLDSKRRK+KD+K +  L+K L  T+ 
Sbjct: 415 -----KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLT 469

Query: 460 KE---SKNF--------KNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTN 508
           KE   SKN         K ++N T+  +Q G+L+ +G+DPT GK+  +++ SN +     
Sbjct: 470 KEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDP--- 526

Query: 509 KYQMEKKEALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQ 556
            Y   +  A++DL+ F+KD VNLKP K DL+ ++  R   W + FG Q
Sbjct: 527 SYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQ 574

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  454 bits (1168), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 250/602 (41%), Positives = 352/602 (58%), Gaps = 57/602 (9%)

Query: 3   DPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF---V 59
           DPR+    D Y N++SDE E+ +I  +L+ +ER                     N    V
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 60  QVPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNY--------------- 104
           QVPSSP+K R V     ++               +AL T    N                
Sbjct: 64  QVPSSPQK-RSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQ 122

Query: 105 ---GTTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSN 161
               TTSYF+EKF  SKK  + ++ A  +M+S+RVHTF G    KEF+   V+EL+Q+S+
Sbjct: 123 SVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNELEQFSD 180

Query: 162 LWLRSRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYT 221
           LW+  RYIP   L   L D+K+LRL KLFAKVRPPKF EPQYSNW V  II+ K ++K+T
Sbjct: 181 LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT 240

Query: 222 SSSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGG 281
           +S  P K+ +FT+++FQ  LD+F+FG  GV++YYNLR GD+VA+LNPEILPWRP   SGG
Sbjct: 241 TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRP---SGG 297

Query: 282 SGST--IKSFNLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHR 339
           S  T  IKSFNL+I+HKF CILEIG SRDLG+CP+     N  C + IN +++  C+YHR
Sbjct: 298 SQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHR 357

Query: 340 EIQFRKTTSNRVELSGTYALGAPTKVDARPALYQN-------------RGTSNNSRVQKS 386
           E+Q R+ +S R++L+G +ALGAPTKV  +P L++              R        + S
Sbjct: 358 ELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPS 417

Query: 387 YNMVSDSHYQKRKDSNKLETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKM 446
           +N     H Q          +   F++ N+AKAFFD++FQNPD+L+NLD+KRRK++DSK 
Sbjct: 418 WN---SRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKK 474

Query: 447 ERNLVKALKN---------TVDKESKNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVI 497
            R L + LK          T+DK +     LK  T+  L TG++QRLGFDPT G+ +SV+
Sbjct: 475 SRQLDRKLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVM 534

Query: 498 RNSNSE--TEVTNKYQMEKKE-ALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFG 554
           +  +SE  +       + +KE  +++L+ +++D  NL PS+  L  R+  R+  W++ FG
Sbjct: 535 KKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFG 594

Query: 555 KQ 556
           K+
Sbjct: 595 KK 596

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  448 bits (1152), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/564 (42%), Positives = 344/564 (60%), Gaps = 25/564 (4%)

Query: 3   DPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF--VQ 60
           DPRE  + D++  ++SDE E  +I +QL  +ER                     +   V+
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 61  VPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEKFYNSKKD 120
           VP+SPK+ R  +  P S+                  +   +    TTSYF+E F N++K 
Sbjct: 66  VPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARKV 125

Query: 121 HERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLMLLD 180
            E+K+   SS++S RVHTF G  S K  +P +VDE + YS   +  RY+   EL+ ++ +
Sbjct: 126 EEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMRE 185

Query: 181 IKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQHN 240
           IK+LRLPKLF+KVRPPKFTEP Y+NWV  GII+ K ++K TSSSKP+KYFK T++DF HN
Sbjct: 186 IKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHN 245

Query: 241 LDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSE--NSGGSGSTIKSFNLRISHKFD 298
           LD++IF  K VEKYYNLRVGD++AILNP+ILPWRPS+  N   SG  +KSFNL I H FD
Sbjct: 246 LDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFD 305

Query: 299 CILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTYA 358
           C+LEIG S+DLG+C IPN +    C  PIN++  D+C+YH++++FR   + RVEL+G+ +
Sbjct: 306 CVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTS 365

Query: 359 LGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSAK 418
           L +P K   + ALY   GTS    V++   ++ D H  + +D     T    FS  N AK
Sbjct: 366 LRSPVKNGKKQALY---GTSG---VKRKLQLLPDKHAPQAQDGESQNTLF--FSNPNYAK 417

Query: 419 AFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTV---------DKESKNFKNLK 469
           AFFD+ +QNPD+LNNL++KRRK+KDS+ ER L   L + +         +K  +  K +K
Sbjct: 418 AFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMK 477

Query: 470 NATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDTV 529
           +AT+  L +G+L+ +GFDP  GK+  V++   +     N    + KE    +M+F+K  V
Sbjct: 478 DATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQVKE----IMSFKKSNV 533

Query: 530 NLKPSKDDLIKRRIDRQRNWKKLF 553
           +L PSK +  KR + R++ W++ F
Sbjct: 534 SLAPSKAEQKKRLLRREQVWREHF 557

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  430 bits (1106), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 230/572 (40%), Positives = 351/572 (61%), Gaps = 31/572 (5%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           M DPRE  + D++  LS DE   D++ ++L  +ER                    PNF  
Sbjct: 1   MEDPREPREIDIFDELSCDE--DDDLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 59  VQVPSSPKKSRVVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGT--TSYFMEKFYN 116
           V+VP SP KS+ V +K TS+  D              L  +  ++  +  T YF + F +
Sbjct: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSS 118

Query: 117 SKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNL 176
           SKK  E +      M++ RVHTF G    +E+ P  V+E +++S  W+  RYI  ++   
Sbjct: 119 SKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARK 178

Query: 177 MLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISD 236
           +L + K+LRLPKLFAKVRPP FTEPQYSNWV  GII++K  +K T+ +KP++YF  T++D
Sbjct: 179 ILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTD 238

Query: 237 FQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPS--ENSGGSGSTIKSFNLRIS 294
           F+H +++++FG K VEKYYNL+VGD++A+LNPEI PWRPS  E+   S + IKSFNL I 
Sbjct: 239 FKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIK 298

Query: 295 HKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELS 354
           H F+ ILEIG SRD G+C I N  +   C TPINKS ED+C YH+E+QFR+  + R+EL+
Sbjct: 299 HNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELN 358

Query: 355 GTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTM 414
           G  +L +PTK   +  LY   G + + +    Y+++ D +  + +  +K    + +FS  
Sbjct: 359 GNKSLRSPTKNGVKHILY---GKNKSGK----YDLLPDRYAPQTQ--SKDSQNVLYFSNP 409

Query: 415 NSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESKN-FKN------ 467
           N+A+AFFD+D+QNPD LNNLDSKRRK++  K E+ L K L+  + K + N FKN      
Sbjct: 410 NAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQ 469

Query: 468 --LKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFR 525
             ++ AT+  L++G+++++GFDPT G++SSV++N++   +     +  K  A+++++  +
Sbjct: 470 DEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLK-----EQAKNSAVEEILQIK 524

Query: 526 KDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQ 557
           K+ + LKPSK+ L ++   R+  W   F K++
Sbjct: 525 KEKIELKPSKEALRQKFKKREEVWNHHFKKEE 556

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  421 bits (1081), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 296/454 (65%), Gaps = 23/454 (5%)

Query: 111 MEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIP 170
           ME F NS+K  E ++     M+ SRVHTF G  + K  KP  V+E +  S LW+  RYI 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 171 VDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYF 230
            DEL  +L DIKILRLPKLF+KVRPPKFTEP Y+NWV  GI+  K  +K TSSSKPTKYF
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 231 KFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSE--NSGGSGSTIKS 288
           K TI+DF H+LDV++F    VEKYYNLRVGD++AILN +ILPWRPS+  N   SG+++KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 289 FNLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTS 348
           FNL I   +DC+LEIG SRDLG+C I N +K  +C  PIN++  D+C YH+EI+FR+  +
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 349 NRVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRM 408
            RVEL+G+ +L +P K   + ALY + G      V++  N++ D H  +++D     T  
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALYGSSG------VKRKLNLLPDKHAPQQQDRESQNT-- 292

Query: 409 HHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESKNF--- 465
            +FS  N AKAFFD+ +QNPD+L NLDSKRRK++D++ ER L   L   + K+ +     
Sbjct: 293 LYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSE 352

Query: 466 ------KNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALD 519
                 K +K AT+ T+ +G+L+ +GFDPT GK+  V++   +    T+   ++ +E ++
Sbjct: 353 KTKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIE 412

Query: 520 DLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLF 553
                RK  V+L PSK D  KR + R++ WK+ F
Sbjct: 413 T----RKTNVSLAPSKADQKKRLLRREQVWKEHF 442

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  363 bits (933), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/514 (39%), Positives = 301/514 (58%), Gaps = 34/514 (6%)

Query: 59  VQVPSSPKKSRVVELKP---TSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEKFY 115
           V+VP SP K++ VE +P   TS                  L     +N  TTSYF EKF 
Sbjct: 88  VEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENERYLL----SANTPTTSYFAEKFA 143

Query: 116 NSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELN 175
            ++      +     ++  RV+TFS   +  E+    VDE++ YSN+ +  RY+P ++L 
Sbjct: 144 RARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVETYSNMRINKRYVPEEDLK 203

Query: 176 LMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTIS 235
            +L DIK+LRLPKLFAKVRPPKF+EP Y+NWV  G I+ K D+K TS  KP KYF   I+
Sbjct: 204 RILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEKPAKYFTIRIT 263

Query: 236 DFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGG--SGSTIKSFNLRI 293
           DF +++ + +FG K VEKYY LRVGDV+AILNPEI PW+ S  + G  + +T +SF L I
Sbjct: 264 DFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETARTTGRSFGLSI 323

Query: 294 SHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVEL 353
            H  +CILEIG S++LG+CP  N +K   C  PINK KE  C YH+E   R   + RVEL
Sbjct: 324 KHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHLRSVNAKRVEL 383

Query: 354 SGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFST 413
           +G  +L APT+   + A Y  R  S+ +++     ++ D  Y  R    + + R  HF++
Sbjct: 384 NGNISLRAPTRDGIQQAGYMTRN-SHGTKI----GLLPDV-YAPRAPGAEQKFR-EHFAS 436

Query: 414 MNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKAL-----------KNTVDKES 462
            N+ +A+FD D+ NPD+L NL+SKRRKI+ SK ++ + K L           K+ V +ES
Sbjct: 437 ANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLVLGKNHTQVKDRVSEES 496

Query: 463 KNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLM 522
              +  + AT+  ++TGIL+ +GFDPTGG++++V+   +     T      ++ ++ +++
Sbjct: 497 --LQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADT-----VREPSISEIL 549

Query: 523 TFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQ 556
             +K  ++LKPSK+   KR   R   +  +F ++
Sbjct: 550 ANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEE 583

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  330 bits (846), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 204/559 (36%), Positives = 305/559 (54%), Gaps = 27/559 (4%)

Query: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERXXXXXXXXXXXXXXXXXXXXPNF-- 58
           + DPRE    D Y  LS DE E + +  ++  I+                     PNF  
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 59  VQVPSSPKKSR-----VVELKPTSKPIDXXXXXXXXXXXXVALMTKDDSNYGTTSYFMEK 113
           + VP SPKKS      + ++K  +   D            V    K     GTTSYF EK
Sbjct: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVK---KLGTTSYFTEK 121

Query: 114 FYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDE 173
             +   +    +     +++ RV+TF+G     E++P  VDE D  S L +  RY+P+  
Sbjct: 122 LRSINTNEHEAIKRKKELLAHRVYTFNGDMFD-EYEPITVDEKDDLSGLVIDRRYVPLAV 180

Query: 174 LNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFT 233
           L     +IK+LRLPKLF+KVR PKF+EP Y NW+V GII+ K + + T+S KP K+F  T
Sbjct: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240

Query: 234 ISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRI 293
           ISDFQ  L+V  FG   VEKYY LR+GD++AILNPEI+P +  E   G+  +  +F+L++
Sbjct: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLE--AGASPSYATFSLKV 298

Query: 294 SHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVEL 353
           S   + ILE+G S++ G C     +K  LC  PINK  ++ C YH+E + R+ +S RVE+
Sbjct: 299 SKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEI 358

Query: 354 SGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFST 413
           S + A+ AP     +  + +++   NN +    Y    D  +   ++    ET    FS+
Sbjct: 359 SSSVAMRAPVVKGYQQTIVKSQ--HNNGKTSIRYQQNPDKPFV--REPAAAETNRFLFSS 414

Query: 414 MNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDK------ESKNFKN 467
            N++ AFFD+D++NPDIL NLD+KRRKI++ +  RNL K LK   DK      +  N + 
Sbjct: 415 ANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGLSDKLLSKKEDRVNQEA 474

Query: 468 LKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKD 527
            K AT +  Q G+  ++G+DPT GK S  +   ++E +     + +K+ A+ D+   +KD
Sbjct: 475 KKTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAP---KNDKQLAITDICNIKKD 531

Query: 528 TVNLKPSKDDLIKRRIDRQ 546
            V+LKPSK  L K +I+++
Sbjct: 532 NVSLKPSKKQL-KEKIEKR 549

>TPHA0B01740 Chr2 (387569..389677) [2109 bp, 702 aa] {ON} Anc_4.323
           YLR440C
          Length = 702

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 14/109 (12%)

Query: 132 MSSRVHTFSGTGSKKEFKPT--DVDELDQYSNLWLRSRYIPVDELNLMLLDIKILRLPKL 189
           +S RV T     +++  + T  ++   D   + WLR R +  DELN       +L   KL
Sbjct: 98  VSERVSTVKEYINRRLVEVTLDEITSFDDTVSSWLRKRILLCDELN----PFNVLFNKKL 153

Query: 190 FAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDFQ 238
           + +++P    +P++  W V GI+   D I  +S  +     +F I DF+
Sbjct: 154 WKEIKP---IDPEFMGW-VNGILEPLDFINNSSDIR----VQFRIIDFE 194

>NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {ON}
           Anc_2.380 YMR146C
          Length = 350

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/58 (22%), Positives = 31/58 (53%)

Query: 481 LQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDTVNLKPSKDDL 538
           ++ + F P G  +S+++ N        N Y++E+ E   +++ F ++ +    ++DDL
Sbjct: 96  VKNVSFSPCGNYISAILDNVMKHVGSINVYKVERDEVTHEILKFGEEPIFAIDTQDDL 153

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 210 GIITSKDDIKYTSSSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYN 256
            ++T K  + +T +S  T  F+F   D +  L+ F F  KG   YY+
Sbjct: 19  NVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYD 65

>NCAS0J01810 Chr10 (338250..340382) [2133 bp, 710 aa] {ON} Anc_4.301
           YLR424W
          Length = 710

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 77/193 (39%), Gaps = 15/193 (7%)

Query: 358 ALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSA 417
            +  P K + RPA +   G  +        N + +  Y+   D    E  +   S     
Sbjct: 74  GISEPIKAEQRPAGHAGLGMLSQKSYVNDANDIRELQYESSSDDEVRELGVGIVSFNKRG 133

Query: 418 KAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALK--NTVDKESKNFKNLKNATQAT 475
                   +N D++       RK++  K+E NL   +   +T++  SK   + K+A + T
Sbjct: 134 TEVLSVQEENIDLI-------RKLRTLKIENNLEIPINVTSTLNSGSKIPPSKKSALEDT 186

Query: 476 LQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKD-----TVN 530
           +   +  ++      G+L   + N  SE  +  K   E  +  +D   +RK+     T  
Sbjct: 187 VNELLELQINLQAISGRLKP-LENHLSELNIMQKSLQELSQMWEDKTQWRKNQKQIITDV 245

Query: 531 LKPSKDDLIKRRI 543
           LK  +DDL+ + +
Sbjct: 246 LKIPEDDLVDKLV 258

>NDAI0J01530 Chr10 complement(356838..361580) [4743 bp, 1580 aa]
           {ON} Anc_8.231
          Length = 1580

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 256 NLRVGDVVAILN-----PEILPWRPSENSGGSGSTIKSF----NLRISHKFDCILEIGAS 306
           N++VGD+V + N      +I+    S+N GG     K+     NL++    +C  +I +S
Sbjct: 397 NVKVGDIVRVHNNDEIPADIILLSTSDNDGGCYVETKNLDGESNLKVRQSLNCTSDIRSS 456

Query: 307 RDL 309
           RD+
Sbjct: 457 RDI 459

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,051,664
Number of extensions: 2855643
Number of successful extensions: 9226
Number of sequences better than 10.0: 184
Number of HSP's gapped: 9623
Number of HSP's successfully gapped: 191
Length of query: 585
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 470
Effective length of database: 40,294,809
Effective search space: 18938560230
Effective search space used: 18938560230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)