Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1043.705.702ON1321132156890.0
Smik_11.3585.702ON18783445032e-50
TDEL0B021905.702ON18106324989e-50
NDAI0E050405.702ON19735804934e-49
NCAS0A032005.702ON17884544818e-48
Suva_11.3315.702ON18983454792e-47
ZYRO0G06600g5.702ON18204594755e-47
YKR095W (MLP1)5.702ON18754704747e-47
SAKL0E14916g5.702ON17796814721e-46
KLTH0E01056g5.702ON17714944702e-46
AFR286W5.702ON17584764692e-46
Skud_11.3345.702ON18853384649e-46
Kwal_55.196975.702ON17604874362e-42
CAGL0G02497g5.702ON17804584326e-42
KLLA0A00594g5.702ON17483154316e-42
Ecym_40185.702ON17693574263e-41
KAFR0D022205.702ON16745423932e-37
KNAG0L021405.702ON16085403871e-36
NDAI0F002905.702ON15544653815e-36
TBLA0E017305.702ON18204663208e-29
KNAG0C065905.702ON16513192975e-26
Suva_9.395.702ON16824622868e-25
KAFR0H002105.702ON14543452813e-24
TPHA0E002305.702ON12844792804e-24
Skud_9.195.702ON16803772804e-24
YIL149C (MLP2)5.702ON16795142553e-21
Smik_9.205.702ON16823352554e-21
NCAS0G002305.702ON17353112474e-20
TPHA0D046105.702ON11832222035e-15
TPHA0K019904.46ON910100820.66
SAKL0H17754g8.238ON2176158820.67
Kpol_541.408.126ON1521157791.6
NCAS0A094401.274ON1147121763.2
NDAI0G030303.177ON111985763.2
KLLA0D09042g3.393ON345185744.4
KLTH0B08316g2.16ON95081754.5
KAFR0G020908.604ON732396745.9
Smik_4.1764.238ON1795252747.0
YDR356W (SPC110)5.414ON944218738.4
TPHA0B039401.450ON57554729.7
NOTE: 1 genes in the same pillar as Kpol_1043.70 were not hit in these BLAST results
LIST: Kpol_2001.75

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1043.70
         (1321 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...  2196   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   198   2e-50
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   196   9e-50
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   194   4e-49
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   189   8e-48
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   189   2e-47
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   187   5e-47
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   187   7e-47
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   186   1e-46
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   185   2e-46
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   185   2e-46
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   183   9e-46
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   172   2e-42
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   171   6e-42
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   170   6e-42
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   168   3e-41
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   155   2e-37
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   153   1e-36
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   151   5e-36
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   127   8e-29
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   119   5e-26
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   114   8e-25
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   112   3e-24
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   112   4e-24
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   112   4e-24
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   102   3e-21
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   102   4e-21
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   100   4e-20
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    83   5e-15
TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {...    36   0.66 
SAKL0H17754g Chr8 (1569016..1575546) [6531 bp, 2176 aa] {ON} sim...    36   0.67 
Kpol_541.40 s541 (134533..139098) [4566 bp, 1521 aa] {ON} (13453...    35   1.6  
NCAS0A09440 Chr1 complement(1873689..1877132) [3444 bp, 1147 aa]...    34   3.2  
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              34   3.2  
KLLA0D09042g Chr4 (760795..761832) [1038 bp, 345 aa] {ON} some s...    33   4.4  
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    33   4.5  
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    33   5.9  
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    33   7.0  
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    33   8.4  
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    32   9.7  

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score = 2196 bits (5689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1171/1321 (88%), Positives = 1171/1321 (88%)

Query: 1    MLDNTLLQDLSLRYHIPIDQLNLLNETSIDQLLNYNENSDTESFKDKFKIDNLNLQIQHI 60
            MLDNTLLQDLSLRYHIPIDQLNLLNETSIDQLLNYNENSDTESFKDKFKIDNLNLQIQHI
Sbjct: 1    MLDNTLLQDLSLRYHIPIDQLNLLNETSIDQLLNYNENSDTESFKDKFKIDNLNLQIQHI 60

Query: 61   NNDNLKLSNQLKNIIEKFNLSKIDQNKTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
            NNDNLKLSNQLKNIIEKFNLSKIDQNKTI                               
Sbjct: 61   NNDNLKLSNQLKNIIEKFNLSKIDQNKTIENLKLKLFKLENENKTLNSTNLNLTDKNDTL 120

Query: 121  XXXXXXXXXXXXXXXXXITELELKRNNDIQLKDKLIQQLNSKIENLLKLGKSPKFKNEVE 180
                             ITELELKRNNDIQLKDKLIQQLNSKIENLLKLGKSPKFKNEVE
Sbjct: 121  NNNLNLKLIELKNLNDNITELELKRNNDIQLKDKLIQQLNSKIENLLKLGKSPKFKNEVE 180

Query: 181  IINDSKTINDDIENSKATIPPSPAKALSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIE 240
            IINDSKTINDDIENSKATIPPSPAKALSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIE
Sbjct: 181  IINDSKTINDDIENSKATIPPSPAKALSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIE 240

Query: 241  NLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLI 300
            NLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLI
Sbjct: 241  NLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLI 300

Query: 301  HSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELT 360
            HSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELT
Sbjct: 301  HSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELT 360

Query: 361  KSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLEIGTLQSKISEL 420
            KSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLEIGTLQSKISEL
Sbjct: 361  KSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLEIGTLQSKISEL 420

Query: 421  QSSIPNSKESEKQHFNYHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILIN 480
            QSSIPNSKESEKQHFNYHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILIN
Sbjct: 421  QSSIPNSKESEKQHFNYHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILIN 480

Query: 481  LEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKC 540
            LEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSM             SVLNDYIKC
Sbjct: 481  LEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKC 540

Query: 541  KXXXXXXXXXXXXXXXXXXXXXXXXXXXKQEIKSNYEQIKDLDSKSKHLEQSLENEISKY 600
            K                           KQEIKSNYEQIKDLDSKSKHLEQSLENEISKY
Sbjct: 541  KTNLLDFTNRLTLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKY 600

Query: 601  TDKVKELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTL 660
            TDKVKELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTL
Sbjct: 601  TDKVKELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTL 660

Query: 661  ESRLPADTQNSKALVEDKALEXXXXXXXXXXXXXCNEITIRIFGDSNKTKKIYPIEEEKN 720
            ESRLPADTQNSKALVEDKALE             CNEITIRIFGDSNKTKKIYPIEEEKN
Sbjct: 661  ESRLPADTQNSKALVEDKALEDSRDASPVSSSASCNEITIRIFGDSNKTKKIYPIEEEKN 720

Query: 721  LELITKELEDTKVRVQNLATQNRLLLEKLERSANLEVDDIFVSLRYERDTLSDQVVNYEK 780
            LELITKELEDTKVRVQNLATQNRLLLEKLERSANLEVDDIFVSLRYERDTLSDQVVNYEK
Sbjct: 721  LELITKELEDTKVRVQNLATQNRLLLEKLERSANLEVDDIFVSLRYERDTLSDQVVNYEK 780

Query: 781  DMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERN 840
            DMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERN
Sbjct: 781  DMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERN 840

Query: 841  MELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWK 900
            MELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWK
Sbjct: 841  MELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWK 900

Query: 901  TRFNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNL 960
            TRFNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNL
Sbjct: 901  TRFNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNL 960

Query: 961  TEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDKSKKFE 1020
            TEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDKSKKFE
Sbjct: 961  TEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDKSKKFE 1020

Query: 1021 EELIKTVSESESLVSDLKNXXXXXXXXXXXXXXXVGLQESEIENAKKILIAELEEKLNKT 1080
            EELIKTVSESESLVSDLKN               VGLQESEIENAKKILIAELEEKLNKT
Sbjct: 1021 EELIKTVSESESLVSDLKNEIESLNEKLKSKESSVGLQESEIENAKKILIAELEEKLNKT 1080

Query: 1081 KSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEED 1140
            KSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEED
Sbjct: 1081 KSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEED 1140

Query: 1141 YKKKLETVSAESTDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQ 1200
            YKKKLETVSAESTDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQ
Sbjct: 1141 YKKKLETVSAESTDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQ 1200

Query: 1201 NNESDVTDKEAEVKTTDNEKSNPELDKQEAKXXXXXXXXXXXXXXXXXQDTDSPVSVFGI 1260
            NNESDVTDKEAEVKTTDNEKSNPELDKQEAK                 QDTDSPVSVFGI
Sbjct: 1201 NNESDVTDKEAEVKTTDNEKSNPELDKQEAKPSFTFSPPPNSNPFTTTQDTDSPVSVFGI 1260

Query: 1261 KPTFSLGANPFKISPVAPSFQTARAXXXXXXXXXXXXXXXXXPKRHSEDENEQDLKKFKP 1320
            KPTFSLGANPFKISPVAPSFQTARA                 PKRHSEDENEQDLKKFKP
Sbjct: 1261 KPTFSLGANPFKISPVAPSFQTARADSSQESKSDDSNSNSESPKRHSEDENEQDLKKFKP 1320

Query: 1321 N 1321
            N
Sbjct: 1321 N 1321

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
           (REAL)
          Length = 1878

 Score =  198 bits (503), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 201/344 (58%), Gaps = 23/344 (6%)

Query: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273
           L++ I++++ ELE ++P+I +FK   + L++ LN   L++E   N+K   ++ + +  + 
Sbjct: 399 LQNQIESFILELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEK 458

Query: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLS- 332
           + +  + I+ L  QR DL  Q+QYLLI +S+  D+ GPL K EI+F+QN++  D    + 
Sbjct: 459 LKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATE 518

Query: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392
           +D Q ++++RL++F+ I+ LQEKN EL K +RNLA  LES E+E K S +  +++TINEA
Sbjct: 519 TDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEA 578

Query: 393 KETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKE----SEKQHFN--------YHSN 440
           KE IL+       LK E   L+SK+ EL+    NSK      E  H N           N
Sbjct: 579 KEAILT-------LKAEKEQLESKVEELEKECENSKALLSNEETSHLNSTIQQLNETKRN 631

Query: 441 L---VKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTL 497
           L   ++DL+S +S+++  S   +  LNK+IQ+LY+ ++DI I L KEKSS ILA E+  L
Sbjct: 632 LECQIQDLQSNISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKL 691

Query: 498 LQNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCK 541
           L N+ DL   EN++L  +                  LN+YI CK
Sbjct: 692 LSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLNEYISCK 735

 Score =  157 bits (398), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 166/581 (28%), Positives = 294/581 (50%), Gaps = 119/581 (20%)

Query: 724  ITKELEDTKVRVQNLATQNRLLLEKLE--RSANLEVDD---------IFVSLRYERDTLS 772
            + ++LE +  R+++L +QN+LL +++E   +A+  V D         I +SLR ERD L 
Sbjct: 1095 LIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILLSLRRERDILD 1154

Query: 773  DQVVNYEKDMQVILADLESVQSELNAANSQI----LNFENQRAMVQDHKKGNVNEETLIE 828
             +V   E+D +++   +  +  EL  A +++    L  E +  ++Q H       E ++E
Sbjct: 1155 TKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQH-------EDIME 1207

Query: 829  KLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNI 888
            KL +L+ L+E N+ L  E+   NE    L+ +L++  + + P+E++++ L   +++K+  
Sbjct: 1208 KLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQE 1267

Query: 889  INVSNEKAENWKTRFNELTLSAKNNDNEDLINLQKQVE-------EKSKENEELSDRFNR 941
            + ++ E+   WK R  ++    +   + D   L+ +++       EK+++  E  +RFNR
Sbjct: 1268 LRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNR 1327

Query: 942  LKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQ-ELG 1000
            L++QA ERL  SK++ + LTEQ N+LK     LE++L +   + +ELEN+ + +D  +L 
Sbjct: 1328 LRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLD 1387

Query: 1001 SIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXXXXXXVGLQES 1060
            +I  L++   N+   SK+F+ +L +  +  +S +  L                     +S
Sbjct: 1388 AIKRLQQDAENS---SKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRIQQQLQS 1444

Query: 1061 E-----------IENAKKIL------------------IAELEEKLNKTKSELDLKHKEE 1091
            E           +E+ KK                    I E +E+LN+  S +++   +E
Sbjct: 1445 EPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQP-SNINI---DE 1500

Query: 1092 LKV-LKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLE---- 1146
            LK+  K E+E ++  R+ EAEEALK++IRLP+EEKI+ IIE K  DLE+++ +K+E    
Sbjct: 1501 LKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIK 1560

Query: 1147 ------------------------------------------TVSAESTD-----IE-KI 1158
                                                      ++S +  D     IE K+
Sbjct: 1561 LLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKM 1620

Query: 1159 KQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQL 1199
            ++E ++ L + KKK+FEEGKQQA MKT  LE K+AK+ESQL
Sbjct: 1621 RKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQL 1661

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  196 bits (498), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 183/632 (28%), Positives = 319/632 (50%), Gaps = 88/632 (13%)

Query: 728  LEDTKVRVQNLATQNRLLLEKLERSANLEVD----------DIFVSLRYERDTLSDQVVN 777
            ++D K +V N+++QN+LL  ++E  +  E +          ++ +SLR ERD L  ++  
Sbjct: 1110 IDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSSELLISLRRERDILETKLTV 1169

Query: 778  YEKDMQVILADLESVQSELNAANSQILNFE----NQRAMVQDHKKGNVNEETLIEKLTEL 833
             +++ +++     +++ EL  A  ++   +    N   + + H       E ++E+L ++
Sbjct: 1170 SKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQH-------EDIMEQLNQM 1222

Query: 834  DELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSN 893
            + L+E N+ L   ++A  E N  L+ +L     ++ PL +++SE    IE+KD  I +  
Sbjct: 1223 NLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLI 1282

Query: 894  EKAENWKTRFNELTLSAKNND-------NEDLINLQKQVEEKSKENEELSDRFNRLKKQA 946
            ++A+ WK R +++    +  D        E++ NL+K++E KSKEN +L+DRF RLKKQA
Sbjct: 1283 DEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQA 1342

Query: 947  NERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLK 1006
            +E+L+ASK+AQ NL+ + NEL+   T +E  L E   +   LE  ++ +D E  +  DL+
Sbjct: 1343 HEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLR 1402

Query: 1007 EQLANALDKSKKFEEELIKTVSESESLVSDLK---NXXXXXXXXXXXXXXXVGLQESE-- 1061
             +L +AL++ K+ E +L +TV  SE L S L    N                 L+ S+  
Sbjct: 1403 HELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGL 1462

Query: 1062 ---IENAKKILIAELEEKLNKTKSELDLKHKEELKVLKTE-------------------- 1098
               +E+ KK    E  + + +   E + K +EE   L +E                    
Sbjct: 1463 SNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQW 1522

Query: 1099 ---YEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKK-----LETVSA 1150
               YE   Q+R+ EAEE LK++IR+P+EE+I  +++ +  +LEE+++++     L+    
Sbjct: 1523 EEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGG 1582

Query: 1151 ESTDIEKIKQEFEDN--------LVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNN 1202
            ++ + E++K++ E          L + KKKAFEEGKQQA+MK+  LE KI+KLESQL ++
Sbjct: 1583 DAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSS 1642

Query: 1203 ESDVTDKEA-----------EVKTTDNEKSNPELDKQEAKXXXXXXXXXXXXXXXXXQDT 1251
             +   +K A           E +T +     P   ++  K                   +
Sbjct: 1643 NNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTS 1702

Query: 1252 DSPV--SVFGIKPTFSLGANPFKISPVA-PSF 1280
              P   +VFG+KPTFS    P    P + P+F
Sbjct: 1703 ALPGNNNVFGMKPTFSF--TPGSSQPESRPTF 1732

 Score =  165 bits (418), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 113/343 (32%), Positives = 198/343 (57%), Gaps = 14/343 (4%)

Query: 210 QNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS 269
           Q   L+  I++++ ELE ++P+I + K     L+  L+   L++E   ++K+   + ++S
Sbjct: 403 QKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELES 462

Query: 270 MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQ 329
               I +   +   L  QR+DLA Q+Q+LL + ++QND+ GPL+  E+ F++ +I  +  
Sbjct: 463 ATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENP 522

Query: 330 RLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSR---ENYDN 386
              SD QS+I++RL++FKDI +LQE+N EL K+ R LA  LE +E   KNS    ++ + 
Sbjct: 523 SNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEE---KNSNIRIDSLER 579

Query: 387 DTINEAKETILSLQEYNNVLKLEIGTLQSK-------ISELQSSIPNSKESEK-QHFNYH 438
            TI+EAKE I++LQE N+ ++ ++ T++ +       +S+   S  N  ++++ +    +
Sbjct: 580 KTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQEN 639

Query: 439 SNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLL 498
             L+K LE KLS L+  +    E LN++I+NLY  +T + I+ EKE+SS  LA ++L LL
Sbjct: 640 QELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLL 699

Query: 499 QNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCK 541
           Q++ ++   EN EL  ++                 +N YI C+
Sbjct: 700 QSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQ 742

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  194 bits (493), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 187/580 (32%), Positives = 299/580 (51%), Gaps = 93/580 (16%)

Query: 726  KELEDTKVRVQNLATQNRLLLE--KLERSAN------------LEVDD-IFVSLRYERDT 770
            K++E  K R++  + QN++L E  KL   AN            +E D+ + +SLR ERD 
Sbjct: 1112 KQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDL 1171

Query: 771  LSDQVVNYEKDMQVILADLESVQSELNAANSQILNF----ENQRAMVQDHKKGNVNEETL 826
            L +++   E + +++   L S++ +  A + ++        N   +++ HK       T+
Sbjct: 1172 LQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHK-------TV 1224

Query: 827  IEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKD 886
            + +LT+LD L+E N+ L  E   L   N  L+ ++E   ++L PLET++  L  LIE+KD
Sbjct: 1225 MSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKD 1284

Query: 887  NIINVSNEKAENWKTR-------FNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRF 939
              +++ +E++E WK R       +  +      N  E+   LQ Q+EEKSKENEEL +RF
Sbjct: 1285 KQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRF 1344

Query: 940  NRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQEL 999
             +LKKQA+E+L+ASK++QN+LT Q N+L+A+  +L   L  + E    LE  + +  +  
Sbjct: 1345 EKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNS 1404

Query: 1000 GSIGDLKEQLANALDKSKKFEEELIKTVSES----ESLVSDLKN-XXXXXXXXXXXXXXX 1054
              I  ++ QL  AL KSK FE + I +V  S    E+L S++K                 
Sbjct: 1405 HDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIKKLQEESSKLQEELAHEK 1464

Query: 1055 VGLQESEIENAKKILI----------------------------AELEEKL----NKTKS 1082
            +    +EI N  +  +                             E ++KL    NK K+
Sbjct: 1465 LTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKIKFIEEQTTEFKKKLQAEINKLKA 1524

Query: 1083 ELDLKHKEELKV--------LKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKV 1134
            E + K  E + +        ++ EYE    +R+ EAEE LKR+IRLP+EEKIN +I+ + 
Sbjct: 1525 EYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRR 1584

Query: 1135 ADLEEDYKKKLETVSAE--STD-----IEKIKQE--------FEDNLVNAKKKAFEEGKQ 1179
              LE +++ K+E  + E  + D      +++K+E        +E+ L   KKKAF+EG+Q
Sbjct: 1585 TQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQ 1644

Query: 1180 QASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNE 1219
            Q  MKT FLE KI KLES LQN +S+    +  + +TDNE
Sbjct: 1645 QVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDNE 1684

 Score =  156 bits (395), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 181/317 (57%), Gaps = 12/317 (3%)

Query: 210 QNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS 269
           Q    + +++ ++++LE +LP +E ++      ++ L +  L++E    +K      ++ 
Sbjct: 405 QRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQ 464

Query: 270 MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQ 329
            +  I      I+ +  QR+DLA+QLQ+ L+H+S+ ND+ GPL+  E+ F++N+I +D +
Sbjct: 465 AQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDE 524

Query: 330 RLS--SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNS-RENYDN 386
                +D Q VIS+RL KFKDI+ LQ+KNMEL K+ R LA  LE +E +IK + +   + 
Sbjct: 525 MHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLE-EEDKIKQAEKSRIEE 583

Query: 387 DTINEAKETILSLQEYNNVLKLEIGTLQSKISELQ-------SSIPNSKESEKQHFNY-H 438
           +TI EAKE IL+LQ YN+ L  +I  L  ++   +       SS P   + +++     H
Sbjct: 584 ETIAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEH 643

Query: 439 SNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLL 498
           + LVK+LE++++ +   S+     LN  I  L  +   I I L +EKS+  LA E+L LL
Sbjct: 644 TQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLL 703

Query: 499 QNSYDLLTLENEELSSK 515
           Q S D+   ENE L  +
Sbjct: 704 QKSMDMTITENERLQKR 720

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1788

 Score =  189 bits (481), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 145/454 (31%), Positives = 247/454 (54%), Gaps = 21/454 (4%)

Query: 210 QNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS 269
           Q   L++ ++ ++ ELE+++P I +FK   + L+  L    L++E+L+ +K +    +D+
Sbjct: 384 QKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDA 443

Query: 270 MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQ 329
           +++         ++L  QR DLAHQLQY+LIH+S+QND+NGPLS  E+ F+Q++++ +  
Sbjct: 444 LRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESN 503

Query: 330 RLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTI 389
             SSD Q VIS+RL+ F++IV LQ+KN++L KS+R LA  LE +E   +++ +  +   I
Sbjct: 504 EESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAI 563

Query: 390 NEAKETILSLQEYNNVLKLEIGTLQSKISELQS-SIPNSK-ESEKQHFN-YHSNLVKDLE 446
           +EAKE I+SLQ YN  L+ +I TL  ++   +S   P++K E+E    N  +++L+K+LE
Sbjct: 564 DEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKPDTKVETEHLRLNEENTDLIKELE 623

Query: 447 SKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLT 506
           ++L+     S  T  +LN +I ++    +  +   + E++S  LA ++L L+QNS  L  
Sbjct: 624 TRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSK 683

Query: 507 LENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXXXXXXXXXXXX 566
           +ENE+L  +  +               L +Y+ CK                         
Sbjct: 684 VENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEK 743

Query: 567 XXKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQKLI--LER- 623
             K +I    ++  +L      L QSL+ E        +E   N +KL+ Q  +  +ER 
Sbjct: 744 SLKDDITIVSKERNELKELVSQL-QSLQTE--------REQIFNSTKLDSQTRLDTVERE 794

Query: 624 ------KLQNKNIEIDDLNSSNYDQISWYQKKLD 651
                 KL+NK+ EI +L S+   +I WYQ K+D
Sbjct: 795 LYDISEKLKNKDREIKELESNRLSEIEWYQNKID 828

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 91/328 (27%), Positives = 171/328 (52%), Gaps = 29/328 (8%)

Query: 732  KVRVQNLATQNRLLLEKL-----------ERSANLEVDDIFVSLRYERDTLSDQVVNYEK 780
            K R+++L++QN+LL +++           ++S+    +D+ +SLR +RD L  ++   E+
Sbjct: 1090 KKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEE 1149

Query: 781  DMQVILADLESVQSELNAANSQIL----NFENQRAMVQDHKKGNVNEETLIEKLTELDEL 836
            + + +   L SV +EL    +++      +EN +  V++H       + ++ +L +L+ L
Sbjct: 1150 EGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEH-------DNIMNQLNQLNLL 1202

Query: 837  KERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKA 896
            +E N+ L  E +   E    L+  LE   E++ PLE + + L  +I++ +  +N   E+ 
Sbjct: 1203 RESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEEC 1262

Query: 897  ENWKTRFNELTLSAKNND-------NEDLINLQKQVEEKSKENEELSDRFNRLKKQANER 949
              WK R  ++    K  D         ++  L++ + +K KENEEL+DRFNR+KKQA+ER
Sbjct: 1263 NRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHER 1322

Query: 950  LHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQL 1009
            L++SK  Q  L +Q  +L+  N  ++  L  +    +  E      +++   +  L+ QL
Sbjct: 1323 LNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQL 1382

Query: 1010 ANALDKSKKFEEELIKTVSESESLVSDL 1037
              AL  SK+FE +   +V  S+ + S L
Sbjct: 1383 EEALLSSKEFENKFNASVKSSDEISSHL 1410

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
           (REAL)
          Length = 1898

 Score =  189 bits (479), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/345 (35%), Positives = 199/345 (57%), Gaps = 25/345 (7%)

Query: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273
           L++ I++++ ELE ++P+I +FK   + L++ LN   L++E   N+K   +K +    + 
Sbjct: 403 LQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEK 462

Query: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLI-NKDKQRLS 332
           + E    I  L  QR DL  Q+QYLL+ +S+ ND+ GPL K EI F+QN++ N D     
Sbjct: 463 LAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTE 522

Query: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392
           SD Q ++++RL++F+DI+ LQEKN EL +  RNLA  LES E++ KN  +N +N+TINEA
Sbjct: 523 SDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEA 582

Query: 393 KETILSLQEYNNVLKLEIGTLQSKISEL------QSSIPNS----------KESEKQHFN 436
           KE IL+LQ     L+ +I  L+ +  +       Q + PN+          +E E Q   
Sbjct: 583 KEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQ--- 639

Query: 437 YHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496
                 +DL++++S+++  S   +  LNK++Q+LY+ ++ + I L +EKSS ILA E+  
Sbjct: 640 -----TQDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFK 694

Query: 497 LLQNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCK 541
           LL N+ DL   EN++L  ++                 LNDY+ CK
Sbjct: 695 LLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCK 739

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 42/54 (77%)

Query: 1093 KVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLE 1146
            K  + E+  ++ K++ EAEEALK++IRLP+EEKI+ IIE K  DLE+++ +K+E
Sbjct: 1514 KQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVE 1567

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  187 bits (475), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 142/459 (30%), Positives = 239/459 (52%), Gaps = 23/459 (5%)

Query: 210 QNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS 269
           Q   L+  +++++ ELE ++P+I +FK     L+  LN   L+++   N+K++  +  ++
Sbjct: 413 QKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEA 472

Query: 270 MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQ 329
           + K + +  SSI  L  QRTDLAHQ+Q+LL++ S+Q D+ G LS  E+ F++ ++N D  
Sbjct: 473 LSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDP 532

Query: 330 RLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTI 389
              SD Q VIS+RL++F +I +LQEKNMEL K++R LA  LES+E ++    + ++NDTI
Sbjct: 533 NSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTI 592

Query: 390 NEAKETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEKQHFNYHSNL-------- 441
            EAKE I+SLQ+YN  L+ ++  L  +    ++    S+    Q+ +  +N         
Sbjct: 593 KEAKEAIVSLQDYNANLESKVEILTKECDAFKAIC--SRNGSDQNGSLSANGTQGNRNGS 650

Query: 442 -----VKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496
                ++ LE++L+ L+  S    + LN +I  LY  +T I I LEKE+SS  L  E+L 
Sbjct: 651 SDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLK 710

Query: 497 LLQNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXX 556
           L+Q++ +L   EN++L  ++                 +N+ I C                
Sbjct: 711 LIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLET 770

Query: 557 XXXXXXXXXXXXKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELEL----NIS 612
                       ++      E+   L      L Q+L++E  K+   +KE++     N+ 
Sbjct: 771 EKELLQSSERTSRENYLKLSEERNSLRIMVSQL-QTLQSEREKF---LKEIQTTYKENLD 826

Query: 613 KLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLD 651
            L ++K     +L  K  E +D+ +S   QI WYQ KLD
Sbjct: 827 SLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLD 865

 Score =  133 bits (335), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 100/329 (30%), Positives = 186/329 (56%), Gaps = 20/329 (6%)

Query: 726  KELEDTKVRVQNLATQNRLLLEKLE----------RSANLEVDDIFVSLRYERDTLSDQV 775
            ++LE ++  +++L+TQN LL +++E               EV +I  +LR ERD L  ++
Sbjct: 1121 RQLETSRQHLEDLSTQNSLLYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKL 1180

Query: 776  VNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDE 835
               +++ Q +   L SV++EL+    Q+  F+ +   +  H +     E +IE+L +L+ 
Sbjct: 1181 TVSQREEQTLRGSLASVENELDTTKRQLSQFQKE---ITTHSELIGQHEKIIEQLNQLNL 1237

Query: 836  LKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEK 895
            L+E N+ L       N+ N  L+ +L +  ER+ PLE++++ L+  + +KD  +N+  E+
Sbjct: 1238 LRESNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEE 1297

Query: 896  AENWKTRFNELTLSAKNNDNEDLINLQKQV-------EEKSKENEELSDRFNRLKKQANE 948
            A  WK R  E+       D ED   L+++V       +E +KEN+EL DRFNRLKKQA+E
Sbjct: 1298 ANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHE 1357

Query: 949  RLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQ 1008
            +L++SK+AQ  L+ Q NEL+   ++LE     +  +  EL+  ++    +  ++  ++++
Sbjct: 1358 KLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKE 1417

Query: 1009 LANALDKSKKFEEELIKTVSESESLVSDL 1037
            L++AL+ S++ E+ L  T+ ++E +   L
Sbjct: 1418 LSDALEHSRELEQNLSATLQQNEEITKKL 1446

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
           MLP1Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved with Tel1p in telomere length
           control; involved with Pml1p and Pml39p in nuclear
           retention of unspliced mRNAs
          Length = 1875

 Score =  187 bits (474), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 158/470 (33%), Positives = 255/470 (54%), Gaps = 27/470 (5%)

Query: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273
           L++ I+ ++ ELE ++P+I +FK   + L++ LN   L++E   N+K   +K +++  + 
Sbjct: 403 LQNQIETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQK 462

Query: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLS- 332
           + E  + ++ L  QR DL  Q+QYLLI +S+ ND+ GPL K EI F+QN++ +D   ++ 
Sbjct: 463 LVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITE 522

Query: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392
           SD Q V+++RL++FK+I+ LQEKN EL K +RNLA  LESKE + K S +  +++T+NEA
Sbjct: 523 SDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEA 582

Query: 393 KETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESE-----KQHFNYHSNL---VKD 444
           KE I++L+     L+  I  LQ ++ EL++S+PN   S      KQ      +L   V+D
Sbjct: 583 KEAIITLKSEKMDLESRIEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQD 642

Query: 445 LESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDL 504
           L++++S+++  S   +  LNK+IQ+LY+ ++DI I L KEKSS ILA E+  LL N+ DL
Sbjct: 643 LQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDL 702

Query: 505 LTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXXXXXXXXXX 564
              EN++L  +                  LN+Y+ CK                       
Sbjct: 703 TKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHL 762

Query: 565 XXXXKQEI-KSNYEQ------IKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQ 617
               KQE+ K + E+      +  L +  K  E  LE        K+ ELE  +S+    
Sbjct: 763 EKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSE---- 818

Query: 618 KLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQ----YEKTIKTLESR 663
              L+++   K+  I  L   N   I WYQ K++     YE  I +++S+
Sbjct: 819 ---LKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSK 865

 Score =  145 bits (367), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 158/574 (27%), Positives = 291/574 (50%), Gaps = 121/574 (21%)

Query: 734  RVQNLATQNRLLLEKLE--RSANLEVDD---------IFVSLRYERDTLSDQVVNYEKDM 782
            R+++L++QN+LL ++++   +A+ EV++         I ++LR ERD L  +V   E+D 
Sbjct: 1109 RIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDA 1168

Query: 783  QVILADLESVQSELNAANSQILNF----ENQRAMVQDHKKGNVNEETLIEKLTELDELKE 838
            +++   +  +  EL  A +++ N     EN  +++Q H       + ++EKL +L+ L+E
Sbjct: 1169 KMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQH-------DDIMEKLNQLNLLRE 1221

Query: 839  RNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAEN 898
             N+ L  E+   N     L+ +L++  + + P+E++++ L   +++K+  + ++ E+   
Sbjct: 1222 SNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHR 1281

Query: 899  WKTRFNEL-----TLSAKNNDN--EDLINLQKQVEEKSKENEELSDRFNRLKKQANERLH 951
            WK R  ++      LS+ + +    ++ NL++++E K ++  E  ++FNRL++QA ERL 
Sbjct: 1282 WKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLK 1341

Query: 952  ASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENS-ISLKDQELGSIGDLKEQLA 1010
             SK++Q++LTEQ N L+     LE +LSE   R +EL+N+ ++  + +L +I  L+E   
Sbjct: 1342 TSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGNNQLEAIRKLQEDAE 1401

Query: 1011 NALDKSKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXXXXXXVGLQESE--------- 1061
             A   S++ + +L ++ +  ES ++ L                     ++          
Sbjct: 1402 KA---SRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSANEQNDLS 1458

Query: 1062 --IENAKKIL------------------IAELEEKLNKTKSELDLKHKEELKVLKTEYEG 1101
              +E+ KK                    I E +E+LN+     ++  +E  K  ++E+E 
Sbjct: 1459 NIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPS---NINMEEIKKKWESEHEQ 1515

Query: 1102 DIQKRVAEAEEALKRKIRLPSEEKINTII------------------------------- 1130
            ++ +++ EAEEALK++IRLP+EEKIN II                               
Sbjct: 1516 EVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSGEIDVV 1575

Query: 1131 -----ESKV----ADLEEDYKKKLE------TVSAESTDIE----------KIKQEFEDN 1165
                 E+KV     +LE +Y KKL+        S+  +D E          ++++EF + 
Sbjct: 1576 LRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEFNNE 1635

Query: 1166 LVNAKKKAFEEGKQQASMKTKFLENKIAKLESQL 1199
            L   KKK+F+EGKQQA MKT  LE K+AK+ESQL
Sbjct: 1636 LQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQL 1669

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  186 bits (472), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 206/681 (30%), Positives = 331/681 (48%), Gaps = 82/681 (12%)

Query: 209  KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268
            +Q   L+  ++ ++ ELE ++P++ +FK   E L+  L+   L++E+   DK+E    + 
Sbjct: 406  RQKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELT 465

Query: 269  SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328
            S+K  I +  + I +L  QR+DLAHQ+Q+LLI  S++ND+NGPL+  E  F++ +IN  +
Sbjct: 466  SVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSE 525

Query: 329  QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDT 388
              +  D Q +IS+RL++F+ +V LQEKNMEL  SIRNLA  LE++E E K+  +  +++T
Sbjct: 526  SPVEQDAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESET 585

Query: 389  INEAKETILSLQEYNNVL--KLEIGTLQSKISELQSS-------IPNSKESEKQHFNYHS 439
            + EAKE IL+LQEYN  L  +LEI   +    ++ +S         N   SE +H     
Sbjct: 586  VKEAKEAILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAE 645

Query: 440  NLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQ 499
              +K+LE+ LS L+  S   I+ LN++I +LY  + D  +NLEKE+SS ILA ++  L+ 
Sbjct: 646  EKIKELENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLIS 705

Query: 500  NSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXXXXX 559
            N+ ++  +EN+EL  +                  +   I CK                  
Sbjct: 706  NTLEMTKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERD 765

Query: 560  XXXXXXXXXKQEIKSNYEQ-------IKDLDSKSKHLEQSLENEISKYTDKVKELELNIS 612
                     K+E +S  E+       I  L +     E  LE     +  K  +LE  +S
Sbjct: 766  LLRSIQENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELS 825

Query: 613  KLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTI----KTLESRLPADT 668
               E       KL  K+ EI D  S+   Q  WYQ+K D+  + +    + L S+L  D 
Sbjct: 826  DTLE-------KLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKL-TDI 877

Query: 669  QNSKALVE--DKALEXXXXXXXXXXXXXCNEITIRIFGDSNKTKKIYPIEEEKNLELITK 726
            Q+ +  VE  +  LE              +E  I+ F   N ++ +     E   E + +
Sbjct: 878  QHLELKVESLNNKLEE-------------SEARIQAFNALNYSESV-----ESQTETLRQ 919

Query: 727  ELEDTKVRVQNLAT---QNRLLLEKLERSAN----------LEVDDIFVSLRYERDTLSD 773
            ELE T++++ +  +   Q + + +  E SA            E  +   +L  ERD   D
Sbjct: 920  ELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKD 979

Query: 774  QVVNYEKDMQVILAD-LESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTE 832
            QV         IL D + ++ +ELN   SQ   FE+Q   + D+ +   N E L  K +E
Sbjct: 980  QV--------PILKDQISNLNNELNHQKSQ---FESQ---ISDYTR---NLEDLKAKQSE 1022

Query: 833  LDELKERNMELTQEIHALNEN 853
            LD +K    E  Q+I  + E+
Sbjct: 1023 LDNMK---AEYEQKISKIQED 1040

 Score =  174 bits (442), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 180/567 (31%), Positives = 288/567 (50%), Gaps = 100/567 (17%)

Query: 756  EVDDIFVSLRYERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQD 815
            E  ++  SLR E+D L  ++    ++ +V+   L+ ++S+L  +  ++     QRA    
Sbjct: 1156 ETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKL--QRAA--- 1210

Query: 816  HKKGNV----NEETLIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPL 871
               GN     ++E ++ +L +L+ L+E N+ L  E     E +  LK +L+    +++PL
Sbjct: 1211 --SGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPL 1268

Query: 872  ETKISELNILIEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNED-------LINLQKQ 924
            E+K++ L   + +KD  I++ NE+AE WK R  ++    +  D E+       +  LQ++
Sbjct: 1269 ESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQE 1328

Query: 925  VEEKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMER 984
            ++ KS ENEEL  RF RLK+QA+E+L+A+K AQ+ LT Q N+LKA    LE +L  Q E 
Sbjct: 1329 IKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEE 1388

Query: 985  FKELENSIS-LKDQELGSIGDLKEQLANALDKSKKFEEELIKTVSES-----------ES 1032
             K LE+ I+ ++  +     DL+EQL N+  K  + E +L +  S S           ES
Sbjct: 1389 VKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIES 1448

Query: 1033 LVSDLKNXXXXXXXXXXXXXXXVGLQESE-IENAKKILI------------------AEL 1073
            L++ +K                 G Q SE +EN  KI+                   +EL
Sbjct: 1449 LMNKIK-LLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESEL 1507

Query: 1074 EEKLNKTKSE-LDLKHKEELKVLKT------------------EYEGDIQKRVAEAEEAL 1114
             E+  + K+  L+ K +E  + L T                  EYE    +R+ E+ E L
Sbjct: 1508 REQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQL 1567

Query: 1115 KRKIRLPSEEKINTIIESKVADLEEDY----KKKLETVSAEST---------------DI 1155
            K++IRLP+EEKIN I+E K  +LE ++    +KK E ++   +               D+
Sbjct: 1568 KKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQDL 1627

Query: 1156 EKIKQE----FEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQ--------NNE 1203
            E +KQE    F++++   KK+AFEEGKQQASMK+ FLE KIAKLE+Q++        N+ 
Sbjct: 1628 ENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPINDN 1687

Query: 1204 SDVTDKEAEVKTTDNEKSNPELDKQEA 1230
            S  T  E+   T D ++  P L+ Q A
Sbjct: 1688 SSATPAESGPTTQDVKQLTPILNNQAA 1714

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope, connects the nuclear pore complex with
           the nuclear interior; involved in the Tel1p pathway that
           controls telomere length; involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1771

 Score =  185 bits (470), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 151/494 (30%), Positives = 250/494 (50%), Gaps = 37/494 (7%)

Query: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKL-M 267
           +Q   L++ ++ ++ ELE ++P++ +FK   + L++ L +   ++ES+  DK E++ L +
Sbjct: 400 RQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDK-ESVALDL 458

Query: 268 DSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKD 327
              K  I++    I  L  QR+DLA Q+QYLLI +S+++D+ GPL+  EI F++ ++ + 
Sbjct: 459 RRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQG 518

Query: 328 KQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDND 387
              L  D Q VIS+RL++F+DIV LQ KN +L ++IRNLA  LES+E + K   +  +ND
Sbjct: 519 DLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVEND 578

Query: 388 TINEAKETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEK--QHF-----NYHSN 440
            I EAKE I++LQE+   L+  I  L  +    ++  P++    K  +H         S 
Sbjct: 579 AIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGKMSA 638

Query: 441 LVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQN 500
            V DLE  L      ++  ++ LN +IQ L  ++T + I +EKE++S  LA E+L + Q 
Sbjct: 639 RVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQG 698

Query: 501 SYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXXXXXX 560
           S  L   ENEEL+ +  +               L+  I+C+                   
Sbjct: 699 SLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIES 758

Query: 561 XXXXXXXXKQEIKSNYEQIKDLDSKSKHLE------QSLENEISK--------YTDKVKE 606
                       K N E I+ L ++  +L       Q+L+ E  K        Y +KV  
Sbjct: 759 LSSCQ-------KKNTESIEQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDA 811

Query: 607 LELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPA 666
           LE+  S+L  Q       L  K+ E +D   +N  +  WYQ+K+D   +T+K + S+L +
Sbjct: 812 LEVEASQLRTQ-------LSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLES 864

Query: 667 DTQNSKALVEDKAL 680
             Q ++ L   K L
Sbjct: 865 QAQTTRDLESQKKL 878

 Score =  152 bits (383), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 163/577 (28%), Positives = 274/577 (47%), Gaps = 99/577 (17%)

Query: 734  RVQNLATQNRLLLEKLERSA---NLE---------VDDIFVSLRYERDTLSDQVVNYEKD 781
            R+++L  QN LLL++L+  A   N E         V ++  SLR ERD L  ++   ++ 
Sbjct: 1113 RIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRS 1172

Query: 782  MQVILADLESVQSELNAANS-----QILNFENQRAMVQDHKKGNVNEETLIEKLTELDEL 836
              V L  LE+++ EL+ A       Q L+ +N   M  +H K       L          
Sbjct: 1173 ETVSLRKLEAIEQELSFAKEELSSLQALSSQNS-IMADEHNKLLEQLNQLNLL------- 1224

Query: 837  KERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKA 896
            +E N+ L  E+    +    L+ Q++   + L+PLE++++ L   +  KD+ I++ +E+ 
Sbjct: 1225 RESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKDSQISLISEET 1284

Query: 897  ENWKTR-------FNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANER 949
              WK R       F  +         E+L   + ++  K+ +N EL DRF RLKKQA ER
Sbjct: 1285 NRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARER 1344

Query: 950  LHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQL 1009
            L A+K  QNNL+ +  + +   +++E  L ++ +  K L+ S+   + E  +    + +L
Sbjct: 1345 LDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEAKADSTTQPEL 1404

Query: 1010 ANALDK------------------SKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXXX 1051
             +AL K                   K  + EL K  S +E L   L +            
Sbjct: 1405 ESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELERRL-DEARREVESLEEV 1463

Query: 1052 XXXVGLQESEIENAKK-------ILIAELEEKLNKTKSELDLKHKE-------------- 1090
                    SE+E  K+        LIAE E ++     EL LK K               
Sbjct: 1464 KQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGKHTP 1523

Query: 1091 -ELKVLKTEYEGDIQ----KRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKL 1145
             +++ LK ++E D +    KR+ E+ E L+++IRLP+EEKIN I+E++ ++LE++++ KL
Sbjct: 1524 VDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKL 1583

Query: 1146 ETVSAE------------------STDIEKIK----QEFEDNLVNAKKKAFEEGKQQASM 1183
            +  ++E                    ++EK+K    +E ++ +   +KKAF+EGKQQASM
Sbjct: 1584 QKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASM 1643

Query: 1184 KTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEK 1220
            K+ FLE KIAKLE+Q++ + ++        K +  EK
Sbjct: 1644 KSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEK 1680

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
           YIL149C (MLP2)
          Length = 1758

 Score =  185 bits (469), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 139/476 (29%), Positives = 254/476 (53%), Gaps = 22/476 (4%)

Query: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273
           L+  +++++ ELE ++P++ +FK  IE L+  LN   L++E+   ++ E +  +   K  
Sbjct: 408 LQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNK 467

Query: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSS 333
           + +  + +  L  QR+DLA Q+Q LLIH S+++D++GPL+  E+ F++ L +       S
Sbjct: 468 VGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGS 527

Query: 334 DVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAK 393
           D Q++IS+RL++FK +V LQ+KN EL  +IR LA  LE +E + ++  ++ + +T+NEAK
Sbjct: 528 DTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAK 587

Query: 394 ETILSLQEYNNVLKLEIGTLQSK-------ISELQ-SSIPNSKESEKQHFNYHSNLVKDL 445
           E ILSLQE+  +L+ ++ T+ ++       +SE + +S+PN   +        ++ +  L
Sbjct: 588 EAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHL 647

Query: 446 ESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLL 505
           E++L  ++  S+   + LN++I+ LY   + + I LE+E+SS  LA+EKL+L+Q S +L+
Sbjct: 648 EARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELV 707

Query: 506 TLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXXXXXXXXXXX 565
             EN +L ++                S + +++  K                        
Sbjct: 708 KGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVE 767

Query: 566 XXXKQEIKS-----NYEQ--IKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQK 618
              K+E +S     N  Q  I  L +  K  +  +E    +Y  +++EL+  +S   +Q 
Sbjct: 768 ADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQ- 826

Query: 619 LILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPADTQNSKAL 674
                 L+ K  E D+L+SS+  Q  W+Q KLD  ++ + + +  L A T    AL
Sbjct: 827 ------LERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDAL 876

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 76/125 (60%), Gaps = 24/125 (19%)

Query: 1098 EYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKL------------ 1145
            EYE    +R+ EAEEALK++IRLPSEE+IN +IE K   LE+++  K+            
Sbjct: 1542 EYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENP 1601

Query: 1146 ETVSAESTDIEKIKQ------------EFEDNLVNAKKKAFEEGKQQASMKTKFLENKIA 1193
            ++++++  D+ K  Q            +FE  LV  KKKAFEEG+QQ  MK K LE+KI+
Sbjct: 1602 DSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKIS 1661

Query: 1194 KLESQ 1198
            KLESQ
Sbjct: 1662 KLESQ 1666

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
           (REAL)
          Length = 1885

 Score =  183 bits (464), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 127/338 (37%), Positives = 200/338 (59%), Gaps = 11/338 (3%)

Query: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273
           L++ I++++ ELE ++P+I +FK   + L++ LN   L++E   N+K   ++ ++   + 
Sbjct: 403 LQNQIESFIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEK 462

Query: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLS- 332
           I +  + I  L  QR DL  Q+QYLLI +S+ ND+ GPL K EI F+QN++  D    + 
Sbjct: 463 IAKCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTE 522

Query: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392
           SD Q +++ RL++F++++ LQEKN EL +  RNLA  LES E + K +    +N TINEA
Sbjct: 523 SDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEA 582

Query: 393 KETILSLQEYNNVLKLEI-------GTLQSKISELQSSIPNS--KESEKQHFNYHSNLVK 443
           KE ILSLQ     L+ ++        TL+S IS+  SS  NS  ++  K      S  V+
Sbjct: 583 KEAILSLQSEKMSLESKVEELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQ-VQ 641

Query: 444 DLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYD 503
           DL++++S+++  S   +  LNK+IQ++Y+ ++DI I L KEKSS ILA E+  LL N+ D
Sbjct: 642 DLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLD 701

Query: 504 LLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCK 541
           L   EN++L  ++                 LN+YI CK
Sbjct: 702 LTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCK 739

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 28/33 (84%)

Query: 1114 LKRKIRLPSEEKINTIIESKVADLEEDYKKKLE 1146
            LK++IRLP+EEKI+ IIE K  DLE+++ +KLE
Sbjct: 1529 LKKRIRLPTEEKISKIIERKKEDLEKEFNEKLE 1561

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
           YKR095W (MLP1) - colied-coil protein (putative), similar
           to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  172 bits (436), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 142/487 (29%), Positives = 248/487 (50%), Gaps = 43/487 (8%)

Query: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268
           +Q   L++ ++ ++ ELE ++P++ +FK   + L+  L +   +++S+  DK E    + 
Sbjct: 396 RQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLK 455

Query: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328
             K  I +  S I AL  QR+DLA Q+QYLLI  +++ D++GPLS  E  F++ ++N + 
Sbjct: 456 RTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMEN 515

Query: 329 QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDT 388
            +   D Q +IS+RL++FK+IV LQ KN +L  ++RNLA  LE++E ++K+  E  +NDT
Sbjct: 516 TQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDT 575

Query: 389 INEAKETILSLQEYNNVLKLEIG----------TLQSKISELQSSIP----NSKESEKQH 434
           I EAKE I++LQ++   L+  I            +QS+ S   S+      N+K SE   
Sbjct: 576 ITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASE--- 632

Query: 435 FNYHSNL-VKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANE 493
              +S+L +++LE  LS     +++ ++ L  + Q L   ++++++N+EKEKSS +LA E
Sbjct: 633 ---NSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEE 689

Query: 494 KLTLLQNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXX 553
           +L + ++S  L   ENEEL+ +  +               +++ I CK            
Sbjct: 690 RLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKN 749

Query: 554 XXXXXXXXXXXXXXXKQEIKSNYEQ-----------IKDLDSKSKHLEQSLENEISKYTD 602
                           Q++K   EQ           +  L +  K  +  L++    +  
Sbjct: 750 SIAKENLLNTSH----QKLKETNEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKG 805

Query: 603 KVKELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLES 662
           K+  LE  IS+L          L  K  E+ D  S++  +  WYQ+K+D   + +K+  S
Sbjct: 806 KIDSLEAEISQLR-------TLLSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTS 858

Query: 663 RLPADTQ 669
            L + TQ
Sbjct: 859 DLNSKTQ 865

 Score =  140 bits (354), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 183/641 (28%), Positives = 297/641 (46%), Gaps = 133/641 (20%)

Query: 734  RVQNLATQNRLLLEK--LERSANLEVDD--------IFVSLRYERDTLSDQVVNYEKDMQ 783
            R+++L+TQNRLL ++  L+ + ++ ++D        +  +L+ E D L  ++   ++D  
Sbjct: 1111 RIEDLSTQNRLLFDQISLKDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDES 1170

Query: 784  VILADLESVQSELNAANSQI----LNFENQRAMVQDHKKGNVNEETLIEKLTELDELKER 839
             +   LE  + EL+ A S+I    +  + +  M++++ K       ++E+L +++ L+E 
Sbjct: 1171 NLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSK-------ILEQLNQVNLLRES 1223

Query: 840  NMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENW 899
            N+ L  E+   ++ N  L+  +EE  E LKPLE  I  L   +  KD  I++  E+   W
Sbjct: 1224 NITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRW 1283

Query: 900  KTRFNELTLSAKNNDNEDLINLQKQVEEKSKENE-------ELSDRFNRLKKQANERLHA 952
            K R  ++ L  +  D E+   L +++ +   E         EL DRF RLKKQA ERL  
Sbjct: 1284 KQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDN 1343

Query: 953  SKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSI-SLKDQELGSIGDLKEQLAN 1011
            ++  QN L  +  E +     LE  L ++ E+ + L+ SI + ++ E+ +    ++QL +
Sbjct: 1344 ARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQD 1403

Query: 1012 ALDK------------------SKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXXXXX 1053
            AL K                   +   EEL +T    + L   L                
Sbjct: 1404 ALQKLEDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQ 1463

Query: 1054 XVGLQESEIENAKKILI-----------AELEEKLNKT----KSELD--LKHKEELKV-- 1094
              G  E+EI   K  LI           AE++EK  K     K+EL+  L   E LK   
Sbjct: 1464 VSGT-EAEIARVKTELIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKSLASSESLKSSD 1522

Query: 1095 ---LKTEYEGDIQ----KRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLET 1147
               LK E+E + +    KR+ EA E L+++IRLP+EEKIN IIE++  +L+E+++ KL+ 
Sbjct: 1523 IENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQ 1582

Query: 1148 VSAE------------------STDIEK----IKQEFEDNLVNAKKKAFEEGKQQASMKT 1185
             ++E                    ++EK    +K+E ++ +  AKKKAF+EGKQQASMK+
Sbjct: 1583 RTSELAGEKPLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKS 1642

Query: 1186 KFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSNPELDKQEAKXXXXXXXXXXXXXX 1245
             FLE KIAKLE+Q +       D      TT N     +LDK                  
Sbjct: 1643 MFLEKKIAKLEAQAKAAAEKPDD------TTVNSPDRKQLDK------------------ 1678

Query: 1246 XXXQDTDSPVSVFG-------IKPTFSLGANPFKISPVAPS 1279
                   SP++          I    + G  P   SP+ PS
Sbjct: 1679 ------PSPIAEISHQEDKTHIAEELAEGPRPITTSPIPPS 1713

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar
           to uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  171 bits (432), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 147/458 (32%), Positives = 247/458 (53%), Gaps = 15/458 (3%)

Query: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268
           +Q   L++ +++++ ELE ++P+I +F+     L+  L    L++E    + +     + 
Sbjct: 407 RQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQ 466

Query: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328
           S+KK I++ +S +E L  QRTDLAHQLQYLLI+ SI NDN+  L++ EI F++NL++ D 
Sbjct: 467 SLKKKISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDN 526

Query: 329 QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENY---D 385
              ++D Q VIS+ LIKFKDI  LQEKNMEL K++R LA  LE  E + K++  N    D
Sbjct: 527 MASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDED 586

Query: 386 NDTINEAKETILSLQEYNNVLK--LEIGTLQSKISEL------QSSIPNSKESEKQH--F 435
           N+   EAKE IL+L++ N  L+  L+I T +    +L      + +  +S    K H   
Sbjct: 587 NEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELK 646

Query: 436 NYHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKL 495
           +Y+  +VKDLE++L++L+  S +  + L +++  L+ E + + + +EK +S+  LA E+L
Sbjct: 647 SYNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERL 706

Query: 496 TLLQNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXX 555
            + QNS +LL+ ENE+L  ++S                 + Y++                
Sbjct: 707 KITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLE 766

Query: 556 XXXXXXXXXXXXXKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVK-ELELNISKL 614
                        K E+ +  E+   L      L QSL++E     ++V+ + +  IS++
Sbjct: 767 TEVTLLKDREISLKSELSNTTEEKTKLRIMVTQL-QSLQSERETLLERVQSDFKKRISEV 825

Query: 615 NEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQ 652
           N     L+++L  +  EID +      Q  WYQKK+D+
Sbjct: 826 NYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDE 863

 Score =  160 bits (406), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 190/640 (29%), Positives = 306/640 (47%), Gaps = 119/640 (18%)

Query: 734  RVQNLATQNRLLLEKL----------ERSANLEVDD---IFVSLRYERDTLSDQVVNYEK 780
            R+ ++  QN+LL  ++          E S++ E +    + +SLR ERD L  ++   E 
Sbjct: 1126 RIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIET 1185

Query: 781  DMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERN 840
            +   +   L+ +Q+EL          E++ +   +H     N +T+   L +L+ L+E N
Sbjct: 1186 EKNSLQQKLDDIQNELENTKRSAALLESEYS---EHSDLINNYQTIRGDLEQLNLLRESN 1242

Query: 841  MELTQEI-HALNENN-IALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAEN 898
            + L  E+  AL+E + IA   Q+      L PL++ +   N LI++KD  I  +N++++ 
Sbjct: 1243 VTLRNELKQALDEKDKIAKDLQI--CRNELLPLQSNLESANNLIKEKDLKIASANDESQR 1300

Query: 899  WKTRFNELTLSAKNNDNEDLINLQKQVEE-------KSKENEELSDRFNRLKKQANERLH 951
            WKTR  E+    +  + +D   L++ + E       K +E  EL+DRFNRLKKQA+E+L+
Sbjct: 1301 WKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLN 1360

Query: 952  ASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLAN 1011
             SK  Q++L EQ + L +   D+ + L  + E   EL + ++   ++   +  L+E+L  
Sbjct: 1361 TSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNK 1420

Query: 1012 ALDKSKKFEEELI--------------KTVSESESLVSDLKNX-XXXXXXXXXXXXXXVG 1056
             + KS++ E +L               K + E + ++ DLK                 V 
Sbjct: 1421 EISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVE 1480

Query: 1057 LQESEIENAKKILIAELEEKLNKTKSELDLKHKEELK--------------VLKTEYEGD 1102
              + E EN K   IAE  E+ NK   E   K + E +               L+ ++E D
Sbjct: 1481 AIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEED 1540

Query: 1103 ----IQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAE------- 1151
                IQKR+AEAE+ LK++IRLPSEEKIN IIE + ++LE ++ +K+   + +       
Sbjct: 1541 SEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHS 1600

Query: 1152 -------STDIEK-IKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNNE 1203
                      +EK +K+ FED L  A+KKAFEEGKQQA+MKT  LE KI KLESQ+Q  E
Sbjct: 1601 NEFNNELKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKE 1660

Query: 1204 SDVTDKEAEVKTTDNEKSNPELDKQEAKXXXXXXXXXXXXXXXXXQDTDSPVSVFG---- 1259
             D +++  +VK  +N  S P + K                     +  +S  + FG    
Sbjct: 1661 KD-SEETQDVKPEEN--STPSVKK-------------------IPETLNSSDTSFGNSNN 1698

Query: 1260 ---IKPTFSLGAN---------------PFKISPVAPSFQ 1281
               +KP+   GA                P   S  AP+F+
Sbjct: 1699 VKVLKPSSPFGATSAFNNPFTFNNNGNPPAFASAFAPTFK 1738

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score =  170 bits (431), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 109/315 (34%), Positives = 193/315 (61%), Gaps = 6/315 (1%)

Query: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268
           +Q + LK  ++ ++ ELE ++P++ +FK   E L+  LN+  +++ES   D+ +    +D
Sbjct: 395 RQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLD 454

Query: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328
            +K T+    + I +L  QR DLAHQ+QYLL++ SI++++ GPLS  E+ F++NL N  +
Sbjct: 455 YLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQE 514

Query: 329 QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDT 388
              +SD Q +I+DRL++F+ +V LQ+KN EL  +IRNLA  LE +E+E K+  +  +++T
Sbjct: 515 ITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDET 574

Query: 389 INEAKETILSLQEYNNVL--KLEIGTLQSKISELQSSIPNSKESEKQHFNYHS----NLV 442
           + EAKETIL+L ++   L  +L I + +    +  S   +S  +  +   Y S    + V
Sbjct: 575 VREAKETILTLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKV 634

Query: 443 KDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSY 502
           KDLE++L+ +   +++  +  + +  NL  +  +I +N E EK+S  LA ++L LLQ++ 
Sbjct: 635 KDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTL 694

Query: 503 DLLTLENEELSSKNS 517
           +L   + EEL  ++S
Sbjct: 695 ELSKRQCEELQKRSS 709

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 105/208 (50%), Gaps = 63/208 (30%)

Query: 1094 VLKTEYEGDIQKRVAE----AEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKL---- 1145
             LK E+E + +K+  E    AEEALK++IRLP+++KI+ I+E++ A LEE +++K+    
Sbjct: 1551 ALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKA 1610

Query: 1146 ----ETVSAESTDIEK-----------IKQEFEDNLVNAKKKAFEEGKQQASMKTKFLEN 1190
                  +  ++  +EK           ++++FE +L   K+K+FEEGKQQ S+K KFLE+
Sbjct: 1611 QKLAGEIGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLES 1670

Query: 1191 KIAKLESQLQNNESDVTDKEAEVKTTDNEKSNPELDKQEAKXXXXXXXXXXXXXXXXXQD 1250
            KI  LE Q           ++ +K  +N+ SN     Q                      
Sbjct: 1671 KIRNLEQQ-----------KSTIKPVENDTSNMSAAFQ---------------------- 1697

Query: 1251 TDSPVSVFGIKPTFSLGANPFKISPVAP 1278
              +P  VFG   TF+   +PF  S ++P
Sbjct: 1698 --AP--VFGSHSTFT---SPFSTSEISP 1718

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
           similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  168 bits (426), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 206/357 (57%), Gaps = 19/357 (5%)

Query: 176 KNEVEIINDSKTINDDIENSKATIPPSPAKALS----------KQNNGLKSDIQNYLNEL 225
           KN V +IN +  ++D   +SK +  P     +           +Q   L++ +++++ EL
Sbjct: 365 KNGVAVINSN--VSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVEL 422

Query: 226 EQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALD 285
           E ++P++ +FK   + L+  LN   L++ES    + +    ++  K  IN   S + +L 
Sbjct: 423 EHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLI 482

Query: 286 IQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIK 345
           +QR+DLAHQ+QYLL+  S+++D +GPL++ E+ F++ +I+ + +   SD Q +IS+RL++
Sbjct: 483 VQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQ 542

Query: 346 FKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNV 405
           FK ++ LQ KN EL  +IR LA  LE +E + +   ++ +  T+ EAKE ILSLQE+   
Sbjct: 543 FKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQR 602

Query: 406 L--KLEIGTLQSKISELQSSIPNSKESEKQHFNYHSN----LVKDLESKLSKLSAYSQST 459
           L  +L+I + +    +L +S  N +        Y S      + +LE +L  L+  SQ  
Sbjct: 603 LEDQLKIVSKERDAFKLANS-ANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDN 661

Query: 460 IENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKN 516
           I+ LN +I+ LY  ++++ + LE+E+SS +LA E+L L+Q++  L   EN EL  ++
Sbjct: 662 IKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRS 718

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 76/124 (61%), Gaps = 20/124 (16%)

Query: 1095 LKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAE--- 1151
            L+ EYE    +R+ EAEEALK++IRLPSEE+IN +IE +   L+++++ ++   + E   
Sbjct: 1543 LEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFK 1602

Query: 1152 -----------------STDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAK 1194
                               +++K++ +F++ L   +KKAFEEGKQQ  MK K LE+KIAK
Sbjct: 1603 ENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAK 1662

Query: 1195 LESQ 1198
            LE Q
Sbjct: 1663 LEGQ 1666

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  155 bits (393), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 164/542 (30%), Positives = 280/542 (51%), Gaps = 74/542 (13%)

Query: 725  TKELED----TKVRVQNLATQNRLLLEKLERSANLE-------VDDIFVSLRYERDTLSD 773
            T+ELED       R+ +L TQN LL E+L  + +LE       + DI V ++ ERDTL  
Sbjct: 976  TRELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIKDIIVCMKRERDTLQK 1035

Query: 774  QVVNYEKDMQVILADLESVQSELNAANSQILNFENQRA--MVQDHKKGNVNEETLIEKLT 831
            ++   E++ +V+      ++SEL+A  S+   + N     ++  H+K       ++++L 
Sbjct: 1036 KLAIVEREGEVLRERCAGLKSELDAV-SKGQQWHNLPLSNLLTGHEK-------ILDELK 1087

Query: 832  ELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINV 891
            E+  L+E N+ L  E++ L  +N  L  +L +  +   PL+ + +      ++KD  I++
Sbjct: 1088 EVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISL 1147

Query: 892  SNEKAENWKTRFNEL------TLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQ 945
              ++ E WK R+ ++      TL  + N   ++ +L+  +EE++KE E+LS++F  LKKQ
Sbjct: 1148 YKDEIERWKKRWQQMVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQ 1207

Query: 946  ANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISL------KDQEL 999
            A+E+L A+K+    L    +E+KA N  LE  + E+ ++ +E+E ++        KD++L
Sbjct: 1208 AHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKL 1267

Query: 1000 GSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXXXXXXVGLQE 1059
             S    KE  A  L+K+    ++L +T+++    V  L+                +   +
Sbjct: 1268 VSEKTFKENEAK-LNKTITMLQKLNETLNQE---VVSLREEINVLRKKDDETNQLISTMK 1323

Query: 1060 SEIENAKKILI----AELEEKLNKTKSELDLKHKEEL-------------KVLKTEYEGD 1102
             + E  K  LI     EL EK    ++E+  K  E +             + L+ ++E  
Sbjct: 1324 LDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQ 1383

Query: 1103 IQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVS-----AESTDI-- 1155
              +R+ EA+E LKR IRLPSEEKI  IIE + A+LE D+ K++E  +     A+  D+  
Sbjct: 1384 TLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSP 1443

Query: 1156 ------------EKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQL-QNN 1202
                          I+Q+ +  L   + KAFEEGK+QA MKT  LE K++KLESQ+ ++N
Sbjct: 1444 DELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDN 1503

Query: 1203 ES 1204
            ES
Sbjct: 1504 ES 1505

 Score =  118 bits (295), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 90/301 (29%), Positives = 169/301 (56%), Gaps = 7/301 (2%)

Query: 210 QNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS 269
           Q + L++ ++N++ ELE ++P+I++ + + ++L+  L+    +++ +  +++   K   S
Sbjct: 312 QKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQS 371

Query: 270 MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQ 329
            K+        I+ L  QR+DLAHQ+Q+LL+    Q   N  LSK E  F++ L   D  
Sbjct: 372 FKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTY 431

Query: 330 RLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTI 389
             ++D QS+IS+RL+KF DI  LQ++NM++  ++R+LA  LE +E   +      +  T+
Sbjct: 432 ARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTL 491

Query: 390 NEAKETILSLQEYNNVL--KLEIGTLQSKISELQS---SIPNSKESEKQHFNYHSNLVKD 444
            EAK+ +L LQEY N L  KLE    +  + +L S   S  ++K SE    + H+     
Sbjct: 492 EEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHT--TGK 549

Query: 445 LESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDL 504
           L+++L +   Y    IE L +  +++ N++ ++  +++K +S+   A  K  L++N+  +
Sbjct: 550 LQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLLM 609

Query: 505 L 505
           L
Sbjct: 610 L 610

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  153 bits (387), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 171/540 (31%), Positives = 273/540 (50%), Gaps = 74/540 (13%)

Query: 714  PIEEEKNL----ELITKELEDTKVRVQNLATQNRLLLEKLERSANLEVD--------DIF 761
            P E  K L    + + +EL+    R+++LA QN +L +      +++ D        ++ 
Sbjct: 941  PAEARKTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLV 1000

Query: 762  VSLRYERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNV 821
            ++LR ERD    Q    ++D++++  +L+ +  +L     +I    N     +D     V
Sbjct: 1001 INLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTE---KDDFSLTV 1057

Query: 822  NEETLIEKLTELDELKERNMELTQEIHALNENNIALK---CQLEESLERLKPLETKISEL 878
              E ++ +L  L   KE N+ L + I +LNE+   L+    +L ES E  K   + ISE 
Sbjct: 1058 THEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQEEVSRLRESEELAKKNSSAISE- 1116

Query: 879  NILIEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLINLQKQVEE-------KSKE 931
                ++    I    +++E WK    +++     N   ++ NLQ+Q+E        K++E
Sbjct: 1117 ----QEWQQKIETYQQESEKWKLMCQQMS----ENTATEIQNLQQQLETFKADIQLKTQE 1168

Query: 932  NEELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENS 991
            N++L+DRF RLKKQA+E+L+ASK   ++L  + +ELK  N  L+  L+ Q     + E++
Sbjct: 1169 NDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESN 1228

Query: 992  ISLKDQELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSD-------LKNXXXXX 1044
             +L       I  LKE+   A    K  E EL  +V  SE L++D       LK      
Sbjct: 1229 AAL-------ILQLKEENKQA----KSLELELRHSVDSSEKLIADMTKELTTLKENPIQG 1277

Query: 1045 XXXXXXXXXXVGLQESEIENAKKILI----AELEEKLNKTKSEL--DLKHKEEL-KVLKT 1097
                      +   +SE E+ K++LI    +EL E+  + K EL  +  + EEL K L+ 
Sbjct: 1278 SVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMNNNANLEELRKPLEE 1337

Query: 1098 EYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKK---------KLETV 1148
            E+E    +R+ EA+E LK+ IRLP+EEKI  +I  + A LEE ++          KL  +
Sbjct: 1338 EWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSEL 1397

Query: 1149 SAESTD------IEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNN 1202
            S ++ D       E+IK   E++    KKKAFEEG+QQASMKT  LE KIAKLE++LQ  
Sbjct: 1398 SNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGG 1457

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 141/289 (48%), Gaps = 53/289 (18%)

Query: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKK-NLIIESLQNDKKENLKLM 267
           K+N  LK  +++++ ELE +LP ++  + + + +Q  L+   N +IE  +   +   +L 
Sbjct: 296 KENVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELS 355

Query: 268 DSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKD 327
            S +K ++  +     L +QR+DLAHQ+Q+LL      N ++  L  SE+ F++ +I  +
Sbjct: 356 SSRQK-VDHLNQIFHKLRVQRSDLAHQIQFLLT----VNSSDTVLPPSELSFIKTIIENE 410

Query: 328 KQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDND 387
                 D Q ++SDRL++F +I  LQE+NM+L  ++R+L   +ES E+         DND
Sbjct: 411 NWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEA---------DND 461

Query: 388 ---TINEAKETILSLQEYNNVLKLEIGTL------------------------QSKISEL 420
              T+  AK  I  L++ N  L+ E+                           Q KI EL
Sbjct: 462 SGLTLEAAKLQISKLEQSNAQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEEL 521

Query: 421 QSSIPNSKESEKQHFNYHSNLVKDLESKLSKLSAYSQSTIENLNKDIQN 469
           +S + +  ES  Q  N            L+K    +QSTI  LN+ I+N
Sbjct: 522 ESKLTDVGESHVQKINV-----------LNKTIDRNQSTINMLNEQIKN 559

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  151 bits (381), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 151/465 (32%), Positives = 238/465 (51%), Gaps = 88/465 (18%)

Query: 824  ETLIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIE 883
            E ++E  T+L  L+E N +L +E+    + N  L  QL +   +L+PLE +I+EL + + 
Sbjct: 1060 EEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVA 1119

Query: 884  DKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLI-------NLQKQVEEKSKENEELS 936
            +K+  +N+  E+ E WK R   +    K  + E  +        L++Q+E    EN +L+
Sbjct: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLT 1179

Query: 937  DRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKD 996
            DRF+RLKKQA+E+L A+K  Q NLT Q NEL     +LE++L +++E+  +  N  + + 
Sbjct: 1180 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADES 1239

Query: 997  QELGSIGDLKEQLANALDKSKKFEEELIKTV-------SESESLVSDLKNXXXXXXXXXX 1049
            +E+        +L   L+KS  F  EL K V       +E ESL S+L++          
Sbjct: 1240 EEII-------RLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQS---------- 1282

Query: 1050 XXXXXVGLQESEIENAKKILIAELEEKLNKTKSELDLKHKEELKVLKTEYEGD------- 1102
                 V   E+   N+K  +I +L+E   + K EL  + K+E K  K E E +       
Sbjct: 1283 -----VKAYENSTVNSK--IIKDLKESFKREKDELIEQMKKEFKT-KLEKEKETILAQRK 1334

Query: 1103 ---------------------------IQKRVAEAEEALKRKIRLPSEEKINTIIESKVA 1135
                                       I KR+ EAEE LK+++RLPSEEKIN +IE +  
Sbjct: 1335 NNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRK 1394

Query: 1136 DLEEDYKKKLE----------TVSAESTDIEK-IKQEFEDNLVNAKKKAFEEGKQQASMK 1184
             LE++++ KL            V+     IEK ++++F   L   KKKAFEEGKQQ+ MK
Sbjct: 1395 VLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMK 1454

Query: 1185 TKFLENKIAKLESQ----LQNNESDVTDKEAEVKTTDNEKSNPEL 1225
            +  LE K++KLESQ     +NN+S+ T   +++  ++   S+P L
Sbjct: 1455 STLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPL 1499

 Score = 89.0 bits (219), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 122/214 (57%), Gaps = 20/214 (9%)

Query: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKE----NL 264
           +  + L+  ++++L ELEQ+LP+I++FK    +L+  L +   I  SL+   KE    + 
Sbjct: 379 RHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLR---ITSSLEETAKERDIKDR 435

Query: 265 KLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLI 324
           +L +  KK  N +  + E L  QR+DLAHQ+QYLL+      DN  P ++ E   ++ ++
Sbjct: 436 ELTNLQKKISNNEQFNDELLR-QRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIV 490

Query: 325 NKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENY 384
           + +     +D   +IS RL+ F+++  LQ+KNMEL ++ R L  +LE +E E + +    
Sbjct: 491 SNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRIT 550

Query: 385 DNDTINE-AKETILSLQEYNNVLKLEIGTLQSKI 417
           DN+ I E AK T + L+++       I TL+SKI
Sbjct: 551 DNNKIVESAKSTSVDLEKH-------IKTLESKI 577

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1820

 Score =  127 bits (320), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 131/466 (28%), Positives = 239/466 (51%), Gaps = 16/466 (3%)

Query: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273
           L++ I++++ ELE ++P+I +F+ + + L++ L    L++    N+K      +++    
Sbjct: 382 LQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSK 441

Query: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSS 333
           +    S+I+ L  QR DLA+Q+++LL+  +++ND+ GPL++ EI F+  + N  +    S
Sbjct: 442 LLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGS 501

Query: 334 DV--QSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINE 391
           ++  Q VIS+RL+ F +I  LQ KNMEL  SIR+L+ +LE+ E+   NS + + N TI +
Sbjct: 502 ELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIEN--ANSHKEFQNKTIAD 559

Query: 392 AKETILSLQEYNNVLKLEIGTLQSKISELQ----------SSIPNSKESEKQHFNYHSNL 441
           AKE IL+LQ +N++L+ ++  L+++    +          SSI N   S       +   
Sbjct: 560 AKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKS 619

Query: 442 VKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNS 501
           ++ L++ + +L A  +   + L   I +   +++++ I+LEKEKSS  L  EK++L +++
Sbjct: 620 IEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESA 679

Query: 502 YDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXXXXXXX 561
           +D+L  EN+EL+ +                 ++N YI  +                    
Sbjct: 680 FDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFL 739

Query: 562 XXXXXXXKQEIKSNYEQIKDLDSKSKHLEQSLENE-ISKYTDKVKELELNISKLNEQKLI 620
                    E+    E+   L      L QSL+NE ++   D  K+    I +L    L 
Sbjct: 740 VKSQDSLNSELIKTSEEKNKLRIMLSQL-QSLQNERMTLLDDTQKKFMSKIHELENNNLD 798

Query: 621 LERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPA 666
           L + L +K  EI  L+ SN  Q +WYQ  +D  +K    +++ L +
Sbjct: 799 LIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTS 844

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 90/285 (31%), Positives = 155/285 (54%), Gaps = 21/285 (7%)

Query: 727  ELEDTKVRVQNLATQNRLLLEKLE-----------RSANLEVDDIFVSLRYERDTLSDQV 775
            +LE++K ++ NL  QN+L +++LE              + E   +F  LR +RD L  ++
Sbjct: 1079 DLEESKKKIDNLTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLETKL 1138

Query: 776  VNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDE 835
               E+D +   + LES++ EL     ++++ EN+   +  H     N E ++ +L ++  
Sbjct: 1139 SIAERDSKNNASKLESLRDELANVQMKLISSENK---LLRHSDLIENHEKIVSELNQITL 1195

Query: 836  LKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEK 895
             KE N  L  ++  LNE N  L+ +L E   +L  L  ++  +   + DK+  I +  E+
Sbjct: 1196 FKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEE 1255

Query: 896  AENWKTRFNELTLSAKNND-------NEDLINLQKQVEEKSKENEELSDRFNRLKKQANE 948
            +  W+ R  EL++     D       + +L  L+   E K K+N EL +RFN LKKQA+E
Sbjct: 1256 SNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHE 1315

Query: 949  RLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSIS 993
            RL+ASK  Q++L +Q NELKA NT++E  LS + ++  +L+N++S
Sbjct: 1316 RLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLS 1360

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1651

 Score =  119 bits (297), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 102/319 (31%), Positives = 180/319 (56%), Gaps = 23/319 (7%)

Query: 207 LSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKL 266
           LSKQ   L+  +  ++ ELEQ  P+I++FK + E     ++K  L +E +  DK+   + 
Sbjct: 304 LSKQK--LEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQE 361

Query: 267 MDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINK 326
           ++  KK + + S   + L  +R DLA QLQYLL++  ++ D++ PL+ SE  +++ ++N 
Sbjct: 362 VEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNT 420

Query: 327 DKQRL---SSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSREN 383
           D +     S+D Q +IS R++KFK IV LQ++N+ L  ++R L+   E+ E ++    E+
Sbjct: 421 DPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKL----ES 476

Query: 384 YDN-DTINEAKETILSLQEYNNVLKLEIGTLQSKI--SELQSSIPNSKESEKQHFN---- 436
            D+ + INEAK+T+L LQ+YN+ L+ ++ +L +K+  +E  +SI + +      F     
Sbjct: 477 GDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGE------FGNSDL 530

Query: 437 YHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496
              N ++ L++K   L A S  TI +L   I NL   ++D+    E   +S  L  ++L 
Sbjct: 531 SDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLK 590

Query: 497 LLQNSYDLLTLENEELSSK 515
           + Q+  DL   EN  L ++
Sbjct: 591 ITQDMLDLSKNENSTLRNR 609

 Score = 98.6 bits (244), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 149/553 (26%), Positives = 251/553 (45%), Gaps = 70/553 (12%)

Query: 711  KIYPIEEEKNLE----LITKELEDTKVRVQNLATQNRLLLEKLERSANLEVDDIF---VS 763
            K++ +E+EK LE    ++ +++E  K R++  + +  LL E+++  A+ +  D+    VS
Sbjct: 953  KVF-VEKEKELESRIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVS 1011

Query: 764  LRYER--DTLSDQVVNYEKDMQVILADLESVQSELNAANSQI----LNFENQRAMVQDHK 817
              Y      LSD+  N E  +    ++   ++ +L    S+I    +N+E  +  V    
Sbjct: 1012 PEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYEQAKKEV---- 1067

Query: 818  KGNVNEET--LIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKI 875
               VN E+    E + +L+ LKE NM LT E+      N  +  +L E   + K +E+++
Sbjct: 1068 AAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQL 1127

Query: 876  SELNILIEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLIN--------LQKQVEE 927
             E   ++  KD  +     +    K   +++  +   + + +L+         L +QV+ 
Sbjct: 1128 DEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDN 1187

Query: 928  KSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKE 987
                N EL DRF RLK+QA ERL ASKV  N+L +    L    T L+  +    +   E
Sbjct: 1188 LKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNE 1247

Query: 988  LENSISLKDQELGSIGDLKEQLANALDKSKKFEEELIKTVSES-----------ESLVSD 1036
            L   I    +    + +LK +LA  + K+K  E EL +T   S           ESL  +
Sbjct: 1248 LRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHE 1307

Query: 1037 LKNXXXXXXXXXXXXXXXVGLQES---EIENAKKILI--------AELEEKLNKTKSELD 1085
            ++                 G+ ES     E+ K   +        A L E+  K K E++
Sbjct: 1308 VQYLKEASSAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREME 1367

Query: 1086 L--KHKEELKVLKTEYE-------------GDIQKRVAEAEEALKRKIRLPSEEKINTII 1130
               K K+ L + KT                 DI+    + E + K ++ L  +EK + ++
Sbjct: 1368 ALEKEKDSLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSDQMM 1427

Query: 1131 ESKVADLEEDYKKKLETVSAESTDI-----EKIKQEFEDNLVNAKKKAFEEGKQQASMKT 1185
             +K+ +LEE ++ ++     E   +     EK K   ED L+  KK+AFEEGKQQA+MK 
Sbjct: 1428 RAKMDELEEQFQNRVRNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKM 1487

Query: 1186 KFLENKIAKLESQ 1198
              LE KIAKLE++
Sbjct: 1488 SILERKIAKLEAE 1500

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score =  114 bits (286), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 129/462 (27%), Positives = 229/462 (49%), Gaps = 23/462 (4%)

Query: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273
           L++ +++++ ELE++ P + +FK   E+L+  L     ++E++   K+++ K + S+++ 
Sbjct: 385 LQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQK 444

Query: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSS 333
           IN   ++I +L  QR DLA Q++ LL++ S       PLS  E++ ++ L+         
Sbjct: 445 INNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEK 504

Query: 334 DVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAK 393
           D Q +I++RL++F +   LQEKNMEL   +R LA  LE+ E +   S    +N TI EAK
Sbjct: 505 DSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAK 564

Query: 394 ETILSLQEYNNVLKLEIGTL---QSKISELQSSIPNSKESEKQHFNYHSNL--VKDLESK 448
           + I+ L+  N+ L+  I  L   +     L S+  N   ++  +    +NL  +K+LES+
Sbjct: 565 DAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELESE 624

Query: 449 LSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLL--T 506
           LS     + + ++ LNK++      +++  I L++  +  +LA EK  LLQ   D L   
Sbjct: 625 LSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKTK 684

Query: 507 LENEELSSKNSMXXXXXXXXXXXXXSVLNDYI-KCKXXXXXXXXXXXXXXXXXXXXXXXX 565
           LE +  S+ +S+               L+ Y  K K                        
Sbjct: 685 LEKQRSSAPSSIHGSIGSEETE-----LSQYKNKTKSLMCEISNLSKKNTDLRCMKESLT 739

Query: 566 XXXKQEIKSNYE-QIKDLDSKSKHLEQSLENEIS--KYTDKVKELELNISKLNEQKLILE 622
              ++  K   + Q+K  +S++ H EQ L+++    +Y  K+K LE N  +LN       
Sbjct: 740 RDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELN------- 792

Query: 623 RKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRL 664
            +L +K  EI+ L +S   Q+ W Q  +D  EK +K+L + L
Sbjct: 793 NRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDL 834

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 158/606 (26%), Positives = 275/606 (45%), Gaps = 122/606 (20%)

Query: 734  RVQNLATQNRLLLEKLERSAN--------LEVDDIFVSLRYERDTLSDQVVNYEKDMQVI 785
            + ++L  +N  L+EK++            L++  +F SLR+ER+TL  ++   ++D+   
Sbjct: 1071 QTESLRVENSALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDL--- 1127

Query: 786  LADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERNMELTQ 845
                 ++  + NA   + +N   Q  +V    + +V   T I     +DE ++   E+ Q
Sbjct: 1128 -----ALAKQKNANLEKSVNDMQQTHLVS---RKDVQCSTDI-----IDEFEDIMKEIAQ 1174

Query: 846  EIHALNENNIALKCQLEESLER-------LKPLETKISEL-NILIEDKDNI------INV 891
             ++ L ENN  L+  L++  E+          L+ +IS+L   L + K+ +      + V
Sbjct: 1175 -VNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLV 1233

Query: 892  SNEKAENWKTRFNELTLSAK---NNDNEDLIN----LQKQVEEKSKENEELSDRFNRLKK 944
               + E WK R++ L+   K    ++ E L N    L+ ++      N +L+D+FNRLKK
Sbjct: 1234 YESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKK 1293

Query: 945  QANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGD 1004
            QA+E+L ASK  Q  LT + +ELK    +LE +L  +  +  ELE               
Sbjct: 1294 QAHEKLDASKKQQTALTNEVDELKDMKNELEESLHSEESKVLELE-------------AK 1340

Query: 1005 LKEQLANALDKSKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXXXXXXVGLQESEIEN 1064
            LK+ L  A   SK  EE+  K + E   L+                           IE 
Sbjct: 1341 LKKHLVQAEGVSKDQEEDTSKPLMEEIELL-----------KRELQVFKETSDSSDTIEK 1389

Query: 1065 AKKILIAE----LEEKLNKTKSELD----------LKHKEELKVLK----TEYEGDIQKR 1106
             K+I+ AE    +EEK  + + +L+          +++ E ++ LK     +YE +  +R
Sbjct: 1390 MKEIMEAEKNKIIEEKTTEFERKLEEATGKNTGATIENGENMEELKKQWLKQYEEETMRR 1449

Query: 1107 VAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAE---STDIEKIKQEFE 1163
            + EAEE LK++IRLPSEE+I  II  +  +LE+++++KL+  S     S+D ++ +   E
Sbjct: 1450 IKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSDKKENEVNAE 1509

Query: 1164 DNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSNP 1223
            D+L N+  K   E   + S+ T  +  K   L+ QL+N +  +   ++   +++ E   P
Sbjct: 1510 DDLWNSPSKGNSE---KPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTSSNKENDIP 1566

Query: 1224 ELDKQEAKXXXXXXXXXXXXXXXXXQDTDSPVSV-FGIKPTFSLGANPFK-----ISPVA 1277
                 E K                     +P++  FG KP F    + F+      +P A
Sbjct: 1567 GSTTAENK---------------------APLAFNFG-KPLFPSNTSSFQSFQNPFTPAA 1604

Query: 1278 PSFQTA 1283
             SF T 
Sbjct: 1605 TSFNTG 1610

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score =  112 bits (281), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 109/345 (31%), Positives = 181/345 (52%), Gaps = 22/345 (6%)

Query: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268
           +Q   L+  ++  L ELE+ +P + ++K     L+  LN  N+++E +   KKENL    
Sbjct: 340 QQKRQLEEQMRQILQELERNMPSLSSYKERSTFLEKELNSSNILLEHI---KKENLDKSA 396

Query: 269 SMKKTINEKS---SSIEALDIQRTDLAHQLQYLLIHSSIQNDN--NGPLSKSEILFMQNL 323
            ++K  +E S   SSI +L  QRT LA Q++YLL+   IQN+      L + ++  +   
Sbjct: 397 ELEKKESECSNLRSSINSLAFQRTVLARQVKYLLL--IIQNNETLGSSLGRKDLELLGQY 454

Query: 324 INKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSREN 383
           +  +     SD + ++ +RL +FK++  LQ +NM+L +  R LA   E  E        +
Sbjct: 455 LAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISS 514

Query: 384 YDNDTINEAKETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEKQHFNYHSNLVK 443
            +++TIN+AKE IL LQEY+  L+ +I  L  ++     ++   +++EK+  +  S +  
Sbjct: 515 EEDETINDAKEAILVLQEYSQKLESQIKELSDEL-----AVQKKEKTEKESISAMSKIED 569

Query: 444 DLESK---LSK-LSA---YSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496
           D  S    L K LSA   +S+  I+ LN +I+NL+   TD+ I+L+KEKS+  LA ++  
Sbjct: 570 DASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYN 629

Query: 497 LLQNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCK 541
           LL+ +  LL  E EEL  + +                  DYI CK
Sbjct: 630 LLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQFSYSSRDYISCK 674

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 93/155 (60%), Gaps = 25/155 (16%)

Query: 1069 LIAELEEKLNKTKSELDLKHKEEL-------KVLKTEYEGDIQKRVAEAEEALKRKIRLP 1121
            L+ E+++   K KS L  + ++E+       + L+  YE +IQK+V++AEE LK++IRLP
Sbjct: 1187 LVQEMKDNFEKEKSSLLSQQEQEIEKLTDNERKLREFYEEEIQKKVSQAEENLKKRIRLP 1246

Query: 1122 SEEKINTIIESKVADLEEDYKKKLETVSA------------------ESTDIEKIKQEFE 1163
            +EEKIN IIE + ++LE  +++K++  +                   E +  E ++QEF+
Sbjct: 1247 TEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDDKIKKIYKEIEESGRETLQQEFD 1306

Query: 1164 DNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQ 1198
            + L   +KKAFEEGKQ   MK+ FLE KI+ LE Q
Sbjct: 1307 EQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  112 bits (280), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 132/479 (27%), Positives = 237/479 (49%), Gaps = 44/479 (9%)

Query: 225 LEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDK---KENLKLMDSMKKTINEK---- 277
           LE  +  +EN   E+ N  D +N+  L++   +N     K  +K +++ KK I  +    
Sbjct: 319 LEYLIHELENHAPELNNQYDKINELELLLSKEKNTSEHFKTTIKEIENEKKNIISRLKLS 378

Query: 278 SSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDV-- 335
              IE L  +  DL +Q+Q++LI +SIQND  G L+++EI F++ L  K  +   +++  
Sbjct: 379 DDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYN 438

Query: 336 -QSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKE 394
            Q +ISDRLI+F+ ++SLQ+KNMEL K++R +   L+++E E++   E  ++D +NEAKE
Sbjct: 439 SQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKE 498

Query: 395 TILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKE--------SEKQHFNYHSNLVKD-L 445
            IL +   ++ LK +I  LQ    +L ++ P S E        +E + +     L+ D L
Sbjct: 499 EILKVVSESDKLKEKISELQ---QQLNANRPVSHEKNGHESVLAENKLYTEGDRLILDEL 555

Query: 446 ESKLSKLSAYSQSTIENLNKD-IQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDL 504
           ++ + + +  + S I ++N D + +LYN+  ++  +  K   S  +  +KL LLQ+ YD 
Sbjct: 556 KNNIPEFTKQA-SNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDY 614

Query: 505 LTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXXXXXXXXXX 564
           L++ NE+L     +             S + +++ CK                       
Sbjct: 615 LSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYL 674

Query: 565 XXXXKQ---EIKSNYEQIKD--LDSKSKHLEQSLENEISKYT--DKVKELELNISKLNEQ 617
                +   E+K   EQ+K   L+ K+  ++  LE+   K +   K+ +LE+  S L+  
Sbjct: 675 KDQQSRITNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLS-- 732

Query: 618 KLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESR------LPADTQN 670
                + L+ K  E+ D  S+   ++ WYQKK D +   +K +         +P  T+N
Sbjct: 733 -----KDLRTKEQELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDIPVKTEN 786

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 90/155 (58%), Gaps = 16/155 (10%)

Query: 845  QEIHALNENNIALKCQLEESLERLKPLETKISELN-ILIEDKDNIINVSNE------KAE 897
            QE  +L ++N  L+ +L +S + ++ ++ +I +LN  ++E + N +N+++E      + +
Sbjct: 899  QEHSSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCK 958

Query: 898  NWKTRFNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQ 957
              + +  E +L +         + +++ E KSKEN+E  DRFNRLKKQAN RLH+SK  Q
Sbjct: 959  ELENKLKEASLQS---------DFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQ 1009

Query: 958  NNLTEQSNELKARNTDLERNLSEQMERFKELENSI 992
            N L EQ + LK    +++  L  Q +  +ELE  I
Sbjct: 1010 NALNEQISSLKKDLAEVQSKLEVQSKTVQELETQI 1044

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (78%)

Query: 1253 SPVSVFGIKPTFSLGANPF 1271
            +P S FG+KP FS G+NPF
Sbjct: 1202 TPTSSFGMKPAFSFGSNPF 1220

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
           YIL149C (REAL)
          Length = 1680

 Score =  112 bits (280), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 109/377 (28%), Positives = 192/377 (50%), Gaps = 30/377 (7%)

Query: 163 IENLLKLGKSPKFKNEVEIINDSKTINDDIENSKATI-----PPSPAKALS--------- 208
           I+  LKL KS   K E +++ +   ++D IE +  T+      P+  K  S         
Sbjct: 320 IDAKLKLEKS---KEECQLLKN--IVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLKRQL 374

Query: 209 ----KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENL 264
                Q   +++ +++++ ELE + P + +FK   E L+  L     ++E++   K+++ 
Sbjct: 375 VKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDE 434

Query: 265 KLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLI 324
           K + S+++ IN   ++I +L  QR DLA Q++ LL + S       PLS  E++ ++ L+
Sbjct: 435 KKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLL 494

Query: 325 NKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENY 384
             +      D Q +I+++L++FK+I  LQEKNMEL   IR LA  LE+ E E   +    
Sbjct: 495 ESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKI 554

Query: 385 DNDTINEAKETILSLQEYNNVLKLEIGTL---QSKISELQSSIPNSKESEKQHFN--YHS 439
           +N TI EAKE I+ ++  N+ L L +  L   +     L S+  N   ++ +      + 
Sbjct: 555 ENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGITEATYE 614

Query: 440 NLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQ 499
             +++L+SKLS     S + I+NLN  +      +TD  I L++ ++  +L  EK  +LQ
Sbjct: 615 KKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQ 674

Query: 500 NSYDLL--TLENEELSS 514
              + L   LE + LS+
Sbjct: 675 ERINHLKTQLEKQRLSA 691

 Score =  110 bits (276), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 153/580 (26%), Positives = 272/580 (46%), Gaps = 73/580 (12%)

Query: 734  RVQNLATQNRLLLEKLERSAN--------LEVDDIFVSLRYERDTLSDQVVNYEKDMQVI 785
            + ++L  +N +L+EK++ +          LE+  +F +LR+ER +L  ++   ++D+ ++
Sbjct: 1070 QTESLRVENSVLIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALL 1129

Query: 786  L---ADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERNME 842
                A LE    +L  AN+   N     A++ D        E +I+++ +++ L+E N  
Sbjct: 1130 RQKNASLEKSIGDLQRANTVPRNKVQCPAVIIDEY------EKIIKEIAQVNILRENNAI 1183

Query: 843  LTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTR 902
            L + +  + E N A+  +L    E +  L+  + +    +    N +     + E  K R
Sbjct: 1184 LHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQR 1243

Query: 903  FNELTLSAK---NNDNEDLINLQKQVEEK----SKENEELSDRFNRLKKQANERLHASKV 955
            + +L+   K    N+ E L N+   +E K       N +L ++FNRLKKQA+E+L ASK 
Sbjct: 1244 YQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKK 1303

Query: 956  AQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDK 1015
             Q  LT + NELK     LE NL  +  +  +LE  +     ++G +    + +A     
Sbjct: 1304 QQTALTNELNELKETKDKLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIA----- 1358

Query: 1016 SKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXXXXXXVGLQESE---IENAKKILIAE 1072
             K F EE+       ESL  +L+                  ++E +   I+   K    +
Sbjct: 1359 FKPFVEEI-------ESLKKELQVFRNANDASDAFEKIKNNMEEEKNKIIDEKTKDFEKK 1411

Query: 1073 LEEKLNKTKS-ELDLKHKEELKVLK----TEYEGDIQKRVAEAEEALKRKIRLPSEEKIN 1127
            L++ +NK+KS E ++++ E ++ LK     EYE +  KR+ EAEE LK++IRLPSEE+I 
Sbjct: 1412 LQDAVNKSKSNESEVENSEHIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQ 1471

Query: 1128 TIIESKVADLEEDYKKKLETVSAESTDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKF 1187
             II  +  +LE+++++KL+  +         ++E ED L N+  K   E   + S+ T  
Sbjct: 1472 KIISKRKGELEQEFERKLKENNKSLVFSGSNEEEAEDELWNSPSKGSSE---KPSVVTDL 1528

Query: 1188 LENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSNPELDKQEAKXXXXXXXXXXXXXXXX 1247
            ++ K  KL+ QL+N ++ VT  +   K+ + E + P+                       
Sbjct: 1529 IKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENNIPD---------------------SA 1567

Query: 1248 XQDTDSPVSVFGIKPTFSLGANPFK-----ISPVAPSFQT 1282
              D   P +    KP FS   + F+      +P A +F T
Sbjct: 1568 AADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFST 1607

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  102 bits (255), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 139/514 (27%), Positives = 261/514 (50%), Gaps = 52/514 (10%)

Query: 734  RVQNLATQNRLLLEKLERSA-------NLEVDDIFVSLRYERDTLSDQVVNYEKDMQVIL 786
            + ++L  +N +L+EK++ +A       +L++  +F +LR+ER++L  ++   ++++  + 
Sbjct: 1070 QTESLRVENSVLIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVK 1129

Query: 787  ADLESVQSELN-AANSQILN---FENQRAMVQDHKKGNVNEETLIEKLTELDELKERNME 842
               +S++  +N    +Q L+   ++    ++ + K        + +++T+++ LKE N  
Sbjct: 1130 QKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFK-------DITKEVTQVNILKENNAI 1182

Query: 843  LTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTR 902
            L + +  + E N  +  QL +  E +  L+  + +    +    N I V   + E  K R
Sbjct: 1183 LQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQR 1242

Query: 903  FNELTLS---AKNNDNEDLIN----LQKQVEEKSKENEELSDRFNRLKKQANERLHASKV 955
            + +L+     A+  D E L N    L+ ++      N +L ++FNRLKKQA+E+L ASK 
Sbjct: 1243 YQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKK 1302

Query: 956  AQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDK 1015
             Q  LT + NELKA    LE++L    E  K ++    LK  EL S            D 
Sbjct: 1303 QQAALTNELNELKAIKDKLEQDL--HFENAKVIDLDTKLKAHELQS-----------EDV 1349

Query: 1016 SKKFEEELIKTVSES-ESLVSDLKNXXXXXXXXXXXXXXXVGLQESE---IENAKKILIA 1071
            S+  E++  +T+ E  ESL  +L+                V +++ +   I+   K    
Sbjct: 1350 SRDHEKDTYRTLMEEIESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDERTKEFEK 1409

Query: 1072 ELEEKLNKTKSELDLKHKEELKVLKTE----YEGDIQKRVAEAEEALKRKIRLPSEEKIN 1127
            +L+E LNK+ S  + ++ ++++ LK E    YE +  +R+ EAEE LK++IRLPSEE+I 
Sbjct: 1410 KLQETLNKSTSS-EAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQ 1468

Query: 1128 TIIESKVADLEEDYKKKLETVSAEST--DIEKIKQEFEDNLVNAKKKAFEEGKQQASMKT 1185
             II  +  +LEE+++KKL+  +   T  D +   ++ E+ L N+  K      ++ S   
Sbjct: 1469 KIISKRKEELEEEFRKKLKENAGSLTFLDNKGSGEDAEEELWNSPSKG---NSERPSAVA 1525

Query: 1186 KFLENKIAKLESQLQNNESDVTDKEAEVKTTDNE 1219
             F+  K  K + QL+N ++DV+  +++   T+ E
Sbjct: 1526 GFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKE 1559

 Score = 99.0 bits (245), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 132/526 (25%), Positives = 249/526 (47%), Gaps = 44/526 (8%)

Query: 163 IENLLKLGKSPKFKNEVE----IINDSKTINDDIENSKATIPPSPAKALS---------- 208
           I+  L+L KS   KNE +    I+ D  T  ++   + + + P+  K  S          
Sbjct: 320 IDTKLRLEKS---KNECQRLQNIVMDC-TKEEEATMTTSAVSPTVGKLFSDIKVLKRQLI 375

Query: 209 ---KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLK 265
               Q   L++ +++++ ELE + P + +FK   ++L+  L +   ++E++   K++  +
Sbjct: 376 KERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQER 435

Query: 266 LMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLIN 325
            + S+++ IN   ++I +L  QR DLA Q++ LL+++S   +   PLS+ E++ ++ ++ 
Sbjct: 436 EITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILE 495

Query: 326 KDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYD 385
                  +D Q++I++RL++F ++  LQEKN+EL   IR LA  LE+ E +   + +  +
Sbjct: 496 SSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVE 555

Query: 386 NDTINEAKETILSLQEYNNVLKLEIGTLQSKISELQS-SIPNSKESEKQHFNYHSNL--- 441
           N TI EAK+ I+ L+  N  ++  I  L   + E  S  +  S E  K + N  +++   
Sbjct: 556 NQTIKEAKDAIIELENINAKMETRINIL---LRERDSYKLLASTEENKANTNSVTSMEAA 612

Query: 442 ----VKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTL 497
               +++LE++LS     + + I+NL K++      +      LE  ++   LA EK  +
Sbjct: 613 REKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERM 672

Query: 498 LQNSYDLLTLENEELSSKNSMXXXXXXXXXXXXXSVLNDYIKCKXXXXXXXXXXXXXXXX 557
           L+ + D L  E E+   K+ +              +    IK K                
Sbjct: 673 LEEAIDHLKAELEK--QKSWVPSYIHVEKERASTELSQSRIKIKSLEYEISKLKKETASF 730

Query: 558 XXXXXXXXXXXKQEIKSNYE-QIKDLDSKSKHLEQSLE--NEISKYTDKVKELELNISKL 614
                      +Q  K   E Q++  +S+  H E  ++  ++  +Y  K+KELE N+ +L
Sbjct: 731 IPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERL 790

Query: 615 NEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTL 660
                     LQ+K  EI+ + S    Q+ W Q  +D  E  +K+L
Sbjct: 791 RSD-------LQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSL 829

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score =  102 bits (255), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 174/335 (51%), Gaps = 23/335 (6%)

Query: 188 INDDIENSKATIPPSPA-----------KALSKQ-------NNGLKSDIQNYLNELEQQL 229
           I+D ++  KAT+  + A           K L KQ          L++ +++++ ELE + 
Sbjct: 340 ISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKT 399

Query: 230 PLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALDIQRT 289
           P + +FK   ++L+  L +   ++E++   K+++ + + S+++ IN   ++I  L  QR 
Sbjct: 400 PELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRL 459

Query: 290 DLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDI 349
           DLA Q++ LL+++S       PLSK +++ ++ ++        +D Q++IS+RL++F +I
Sbjct: 460 DLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNI 519

Query: 350 VSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLE 409
             LQEKN+EL   IR LA  LE  E +   +    +  TI EAK+ I+ L+  N  ++  
Sbjct: 520 NELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESR 579

Query: 410 IGTL---QSKISELQSSIPNSKESEKQHFN--YHSNLVKDLESKLSKLSAYSQSTIENLN 464
           I  L   +     L SS  N+     ++F    H   +K+LE++LS     S + I+NL 
Sbjct: 580 INILLRERDSYKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLR 639

Query: 465 KDIQNLYNERTDILINLEKEKSSTILANEKLTLLQ 499
           K++        D  I  +  ++  +LA EK ++L+
Sbjct: 640 KELTTYKKLLCDKKIASQDFENFKMLAKEKESILE 674

 Score = 75.9 bits (185), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 153/287 (53%), Gaps = 32/287 (11%)

Query: 934  ELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSIS 993
            EL ++FNRLKKQA+E+L ASK  Q  LT +  ELKA    LE++L+ +   FK ++    
Sbjct: 1282 ELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSK--NFKTVDLDTE 1339

Query: 994  LKDQELGSIGDL---KEQLANALDKSKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXX 1050
             K+  + S GDL   +E++A+            +  + E ESL  +L+            
Sbjct: 1340 PKEHTVQS-GDLLRDQEKVAS------------LPLIEEIESLKRELQVFKNANNSSDAF 1386

Query: 1051 XXXXVGLQESE---IENAKKILIAELEEKLNKTKSELDLK-HKEELKVLKTE----YEGD 1102
                  ++E +   I    K    +LEE ++K+KS   +  + E ++ LK E    YE +
Sbjct: 1387 EKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSKSTGKVADNSENIETLKKEWLKEYEEE 1446

Query: 1103 IQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAE---STDIEKIK 1159
              +R+ EAEE LK++IRLPSEE+I  II  +  +LEE++++KL+  ++    S D ++  
Sbjct: 1447 TIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSCDRKETN 1506

Query: 1160 QEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNNESDV 1206
             + +++L N+  K      ++ S+ T F++ K  K++ QL+  ++ V
Sbjct: 1507 DDPDEDLWNSPSKG---NSERPSVITDFMKQKNIKVQEQLKKAKNGV 1550

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1735

 Score = 99.8 bits (247), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 96/311 (30%), Positives = 160/311 (51%), Gaps = 28/311 (9%)

Query: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268
           +Q + L+  ++ ++ ELE QLP + + K   + L+  L +   ++E  + +    +K + 
Sbjct: 371 RQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELT 430

Query: 269 SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328
           +  + + E++ +I  L  QR DLAHQ+Q+LL++  ++      L+  EI F++ +I    
Sbjct: 431 TENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRN 490

Query: 329 QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDT 388
            +  SD Q +IS+RL+KF DI  LQ++NMEL  + RNLA  LES ++      ++    T
Sbjct: 491 SQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDT------KSVQKIT 544

Query: 389 INEAKETILSLQEYNNVLKLEIGTLQSKISELQS--------SIPNSKESEKQHFNYHSN 440
            NE+KE I  LQE        I  L SK+ +LQ         S+ N+ E         S 
Sbjct: 545 RNESKEKIAKLQE-------SINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTE-ELRSQ 596

Query: 441 LVKDLE--SKLSKLSAYSQSTIEN----LNKDIQNLYNERTDILINLEKEKSSTILANEK 494
           L K  E  +KL ++S+      E     LN+ I  L  E+ D+   + KE S   +A +K
Sbjct: 597 LQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKK 656

Query: 495 LTLLQNSYDLL 505
             +L++S +LL
Sbjct: 657 SKMLEDSLELL 667

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 158/284 (55%), Gaps = 18/284 (6%)

Query: 758  DDIFVSLRYERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQILNFE----NQRAMV 813
            +++ ++LR ERD L  ++   ++++  +   +E++++ L+         E     +    
Sbjct: 1097 NELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTT 1156

Query: 814  QDHKKGNVNEETLIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLET 873
            + HK+        +++L EL+ LKE N +L Q++   ++ N  +  +LE     + PL+ 
Sbjct: 1157 EQHKEA-------VKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKD 1209

Query: 874  KISELNILIEDKDNIINVSNEKAENWKTRFNELTLSAKNND-------NEDLINLQKQVE 926
            K+  L   I +KD  + + +E+ E WK R  E+ +  +  D        E+L  L+ Q++
Sbjct: 1210 KVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLD 1269

Query: 927  EKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFK 986
             K+K+NE+L+DRFNRLKKQA+E+L A+K    +LT +  +L    + LE +L E+ +R +
Sbjct: 1270 TKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQ 1329

Query: 987  ELENSISLKDQELGSIGDLKEQLANALDKSKKFEEELIKTVSES 1030
            E+E+ +  K      I  L+++L+++++ SKK EE L +TV+ S
Sbjct: 1330 EVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSS 1373

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 128/222 (57%), Gaps = 16/222 (7%)

Query: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD-SMKK 272
           L+    ++L ++E +LP ++N    +EN  +N NK   I E     + ++LKL + S+K 
Sbjct: 300 LEKKFNDFLFDIESKLPYLQN--NSVENETNNGNK---IEEQKIIHEHDSLKLENQSLKI 354

Query: 273 TINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQN-DNNGPLSKSEILFMQNLINKDKQRL 331
            +N+  S+++ L  QR+DL HQ+ YLLI  S  N DNN  L+++E+ F++NL+ +     
Sbjct: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTW 414

Query: 332 SSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLES--KESEIKNSRENYDNDTI 389
           S++ Q++IS+RL+KF ++  L  KN++L   +R L   +ES  K++  K      D  +I
Sbjct: 415 STETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSI 474

Query: 390 NEAKETILSLQEYN-------NVLKLEIGTLQSKISELQSSI 424
           +EAK+ ++ L+E N       N +  E   L+ KI  L S++
Sbjct: 475 DEAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTV 516

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 128/478 (26%), Positives = 213/478 (44%), Gaps = 74/478 (15%)

Query: 792  VQSELNAANSQILNFENQRAMV----QDHKKGNVNEETLIEKLTE-LDELKERNMELTQE 846
            V+ EL    S+   F++ R  +    Q+     +NE T  + L E L+ +K  N  L  +
Sbjct: 638  VKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAK 697

Query: 847  IHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTRFNEL 906
            I  L EN+I  K  +E+   ++K  + KI E+N  +E K + +  S E A          
Sbjct: 698  I-KLQENDI--KILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAESA---------A 745

Query: 907  TLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNE 966
             L  KN  +E    L+KQ+E KSKE  E  DRF RLKKQA ++L+  K  +N L E   +
Sbjct: 746  MLKNKNEIDE----LKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCD 801

Query: 967  L-KARNTDL---------ERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDKS 1016
            L K++N            E++L E++ + K+    +   + EL +    +E+L N  +K 
Sbjct: 802  LEKSKNELEQRLLLLESSEKSLQEEIVKMKD---ELMTSNNELDNNQRSQEELRNEYEKQ 858

Query: 1017 KKF----EEELIKTVSES------------ESLVSD----LKNXXXXXXXXXXXXXXXVG 1056
             K     EEEL   +++             ESL  D    LK                  
Sbjct: 859  NKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEIENDIILKAK 918

Query: 1057 LQESEIENAKKILIAELEEKLNKTKSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALKR 1116
            L+E E  +AK +    +E   +   +  +   KE   +LK   E    + +A   + L++
Sbjct: 919  LKEIEKNSAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIRIEDAENQAMARTRKELEK 978

Query: 1117 KI--RLPSE-EKINTIIESKVAD--------LEEDYKKKLETVSAESTDIEKIKQEFEDN 1165
            +   RL  E EK++    +K+ D        +++ Y  +LET     TD  + K+EF+D 
Sbjct: 979  EYEERLSKESEKLSDQYNNKLKDDLSEELLKIDKKYAMELETKLKNETD--ESKKEFQDA 1036

Query: 1166 LVNAKKKAFEEGKQQA-SMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSN 1222
            L        E+ K +  S K +FLE +I +L+ +   + S+    + ++ +T N  +N
Sbjct: 1037 L------GTEQTKNKILSKKIEFLETQIKELKDEQTKHHSNPMKSDEKIPSTTNLSTN 1088

>TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {ON}
           Anc_4.46 YLR309C
          Length = 910

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query: 587 KHLEQSLENEISKYTDKVKELELNISKLNEQKLILERKLQNKNIEIDDLNSSN------Y 640
           K+ E  LE  I KY D + +L+ NISKLNEQ+   E+ +   N+ I  L + N       
Sbjct: 440 KNKEDELEASIKKYQDDITDLKKNISKLNEQRTAHEQAISQSNVTITKLKNDNNVLNVQL 499

Query: 641 DQISWYQKK-------LDQYEKTIKTLESRLPADTQNSKA 673
            +++  +K        L Q EKTI  LE+++   T++ K+
Sbjct: 500 KELAVLKKSENQLKTNLVQKEKTITYLENQIKKYTEDEKS 539

>SAKL0H17754g Chr8 (1569016..1575546) [6531 bp, 2176 aa] {ON} similar
            to uniprot|P32639 Saccharomyces cerevisiae YER172C BRR2
            RNA-dependent ATPase RNA helicase involved in the
            facilitation and disruption of snRNA interactions
            required for disruption of U4/U6 base-pairing in native
            snRNPs to activate the spliceosome for catalysis
          Length = 2176

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (44%), Gaps = 40/158 (25%)

Query: 215  KSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDS----- 269
            +S++Q YL  L QQLP+   F ++I    DNLN + +++ S++  +KE +  +       
Sbjct: 903  QSEVQYYLAVLNQQLPIESQFMSKI---ADNLNAE-VVLGSVKT-RKEAIDWLGYTYLYI 957

Query: 270  -------MKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQN 322
                   + K INE+      L   R DLAH                   S  +IL   N
Sbjct: 958  RMLKDPVLYKVINERHPEDNTLYYYREDLAH-------------------SALQILHDNN 998

Query: 323  LINKDKQR---LSSDVQSVISDRLIKFKDIVSLQEKNM 357
            LI  DK     +S+++  + S   IK+ D +++  KN+
Sbjct: 999  LIVYDKANGTIISTELGRIASHFYIKY-DSIAMYNKNL 1035

>Kpol_541.40 s541 (134533..139098) [4566 bp, 1521 aa] {ON}
           (134533..139098) [4566 nt, 1522 aa]
          Length = 1521

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 80/157 (50%), Gaps = 23/157 (14%)

Query: 762 VSLRYERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNV 821
           +SL  ER  +    V   K  + I+  ++    +LNA     L+  +++A+V +     +
Sbjct: 373 ISLEGERKRIRQGKVLLLKQQKKIVGLVKPWLLKLNAKPISDLSKVDEKALVLE-----L 427

Query: 822 NEETLIEKLTELDELKERNMELTQEI-HALNENNIALKCQL---------EESLERLKPL 871
           N++ ++E L   D LKE + EL   I H+ +++  +LK  +         EE +ER+K +
Sbjct: 428 NDQPIVENL---DFLKEFSFELGLFIIHSKSKDTYSLKLDIDSINPSETEEEHIERIKSM 484

Query: 872 ETKISELN--ILIEDKDNIIN---VSNEKAENWKTRF 903
           +    + +  IL+ED++ +     + NE+ ENWKT +
Sbjct: 485 KVTFKKFSNAILVEDQEELDTEQEIYNERFENWKTDY 521

>NCAS0A09440 Chr1 complement(1873689..1877132) [3444 bp, 1147 aa] {ON}
            Anc_1.274
          Length = 1147

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 51/121 (42%), Gaps = 16/121 (13%)

Query: 906  LTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSN 965
            L    K   N D+ NL+     K   N +L      LK     +L  +K A  N T  SN
Sbjct: 552  LYFDGKKKKNLDISNLEADYTNKRYLNVKL------LKTYFVGKLQENKPADENPTSSSN 605

Query: 966  ELKARNTD----LERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDKSKKFEE 1021
                R+ D     ERN    +ER +E  NS++L   +L  + D  E      ++S+KF  
Sbjct: 606  ADSIRDIDTSYDAERNSMTVLERIREFFNSLTLYTSDLPDLSDFTE------NESQKFRR 659

Query: 1022 E 1022
            E
Sbjct: 660  E 660

>NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON} 
          Length = 1119

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 45/85 (52%), Gaps = 15/85 (17%)

Query: 13  RYHIPIDQLNLLNETSIDQLLNYNENSDTESFKDKFKIDNLNLQIQH---INNDNL-KLS 68
           ++H P  +++ LNE+ I+  LNY  N D       F ++ L+L +Q+   I ND L KLS
Sbjct: 898 KFHHPSQEISSLNESFINLALNYLHNDD-------FIVEGLDLILQNFSIIQNDQLKKLS 950

Query: 69  NQLKNIIEKFNLSK----IDQNKTI 89
           N L N   +F  S     ID NK I
Sbjct: 951 NHLTNAFYQFGNSTNDDDIDFNKFI 975

>KLLA0D09042g Chr4 (760795..761832) [1038 bp, 345 aa] {ON} some
           similarities with uniprot|P38272 Saccharomyces
           cerevisiae YBR130C SHE3 Protein that acts as an adaptor
           between Myo4p and the She2p-mRNA complex part of the
           mRNA localization machinery that restricts accumulation
           of certain proteins to the bud also required for
           cortical ER inheritance
          Length = 345

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 98/185 (52%), Gaps = 13/185 (7%)

Query: 803 ILNFENQRAM--VQDHKKGNVNEETLIEKLT-ELDELKERNMELTQEIHAL-NENNIALK 858
           I N ENQ +   +  +  G  +   +IE L  ++DEL   N+++T + H L NE   + K
Sbjct: 29  ITNLENQESPSKLGAYTPGKYSTSRVIESLHKQIDELTSTNLKMTSQCHQLVNELESSGK 88

Query: 859 CQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDL 918
            Q  + LE +  L+T+   LN +++ K N +N   E +   +T FNE   +AK N     
Sbjct: 89  KQ-NKQLETISRLQTENMNLNAILDRKTNRMN-ELESSLKKQTVFNE--DAAKKN----- 139

Query: 919 INLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNL 978
           + L++ V++ S ENE+L+++    K Q    + A +  +   T +++ L+     L++++
Sbjct: 140 LELEETVKKLSLENEKLTEQSTLYKIQYEAIVDAHQSYKQFFTNETSTLRNDLMSLKQSM 199

Query: 979 SEQME 983
           ++Q+E
Sbjct: 200 TKQLE 204

>KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some
           similarities with uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport coiled-coil protein necessary for protein
           transport from ER to Golgi Integrin analogue gene
          Length = 950

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 4/81 (4%)

Query: 915 NEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDL 974
            + ++ L++Q+ +  KENE++  RFN L+KQ    L A  + ++ L E + ELK+  T L
Sbjct: 459 GDTVVTLRQQLADAEKENEKILVRFNMLEKQ---HLEAENL-RDGLEETNQELKSVVTRL 514

Query: 975 ERNLSEQMERFKELENSISLK 995
           E+  S+Q++    LE  +  K
Sbjct: 515 EKISSDQLQTIGRLEEEVERK 535

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
            Anc_8.604 YOR195W
          Length = 732

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 102/396 (25%), Positives = 183/396 (46%), Gaps = 54/396 (13%)

Query: 836  LKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEK 895
            LK +  E   EI+ LN N   LK + +  +     L+     LN L  + + +IN    +
Sbjct: 295  LKVKVTEFKNEINTLNANQSLLKSKYDNLISENDALKKNKELLNNLSIENEKLIN----Q 350

Query: 896  AENWKTRFNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKV 955
             +NW+TRF+EL  + K++ +E    +++Q  E +  NE L ++   L    NE L  +K 
Sbjct: 351  GKNWETRFSELE-NEKDSADEKFAQIKEQFSELTSRNESLENQITEL----NELLSVAKE 405

Query: 956  AQNN--LTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANAL 1013
               N  L  + N L+    +L++ L E++E  KE  N +S+ + ++ ++     +  ++L
Sbjct: 406  ENKNSDLLNEVNSLQEERKELQKKL-EKIELDKE--NEVSILESKISALN----ETISSL 458

Query: 1014 DKSKKFEEELIKTVSESESLVSDLKNXXXXXXXXXXXXXXXVGLQESEIENAKKILIAEL 1073
               +K  E L  T +  E+ ++ LK+               V    S+IE+     + E 
Sbjct: 459  QSCQKEIENLNSTKTNLENDLTALKSKFEEVNDNSSIRTAEVTELNSQIES-----LRES 513

Query: 1074 EEKLNKTKSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESK 1133
             ++L +  S+LD    EE+++LK+E        + + EE  K  I L S +  N  +E +
Sbjct: 514  NDQLQELNSKLD----EEIEILKSE-------SLKQDEEYKKVSIELESIQLKNKNVEVE 562

Query: 1134 VAD-LEEDYK------KKLETVSAESTDIEKIKQE-------FEDN------LVNAKKKA 1173
              D LE  +K      K L+    E T ++K+ ++       FE N       V   KK 
Sbjct: 563  RNDELESLHKTVDSLEKSLKGGYDEITQLKKVNEQLKSQLESFEQNTHEDHSAVETLKKD 622

Query: 1174 FEEGKQQASMKTKFLENKIAKLESQLQNNESDVTDK 1209
            FE   + +  + K LE++I     ++++NE D+T +
Sbjct: 623  FELKDKDSQEQIKALESQITSWRQKMEHNERDITQR 658

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 120/252 (47%), Gaps = 35/252 (13%)

Query: 789  LESVQSELNAANSQILNF-----ENQRAMVQDHKKGNVNEETLIEKLTELDELKERNMEL 843
            LE  ++E+   N +IL++     E  + ++   ++   N E+L E+L  L   KE   ++
Sbjct: 1427 LEEKRNEIKILNDEILSYKEKLSETNKGLLSKERENKQNIESLREQLRTL---KESKTKV 1483

Query: 844  TQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTRF 903
             + +  + + +   K +LE+S E +K LE+ I      ++    ++  S+EK E  +   
Sbjct: 1484 EEGLKVIEQKSATQKAELEKSKETVKTLESTIKCNEKELKSSMKVMKESDEKLEQCRKSA 1543

Query: 904  NELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKK-------------QANERL 950
             E     KN  NE    L+ Q++E  KE EEL  +     K             +ANE+L
Sbjct: 1544 EE---EIKNLQNEK-STLETQIKESKKEIEELERKLKIEAKSTTELETIEQQLSKANEKL 1599

Query: 951  HASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLA 1010
            + ++       ++   LK++  DLER L E+  + K   N+I  K+     +  L+++L 
Sbjct: 1600 NVNR-------KEDALLKSKLKDLERELKEKQVKIK---NNIEEKELLTSQLKTLEQELD 1649

Query: 1011 NALDKSKKFEEE 1022
            NA  K++K EEE
Sbjct: 1650 NAQQKTQKCEEE 1661

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
            plaque spindle pole body (SPB) component, ortholog of
            human kendrin; involved in connecting nuclear
            microtubules to SPB; interacts with Tub4p-complex and
            calmodulin; phosphorylated by Mps1p in cell
            cycle-dependent manner
          Length = 944

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 107/218 (49%), Gaps = 16/218 (7%)

Query: 789  LESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERNMELTQEIH 848
            L++++ EL+A N  +    N R  V DH  G + E   +E+  +L EL+ +   +  ++ 
Sbjct: 200  LQALEKELDAKNKIV----NSRK-VDDHS-GCIEEREQMER--KLAELERKLKTVKDQVL 251

Query: 849  ALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTRFNELTL 908
             L  N+     +L    + LK L  +++EL    E+KD  +     K    + R NEL  
Sbjct: 252  ELENNSDVQSLKLRSKEDELKNLMNELNELKSNAEEKDTQLEF---KKNELRKRTNELNE 308

Query: 909  SAKNNDNEDLINLQKQVEEKSKENE--ELSDRFNRLKKQANERLHASKVAQNNLTEQSNE 966
                +D  DL   QKQ E K  ++E  EL  +F+    Q++ + +  K+ +N + E   E
Sbjct: 309  LKIKSDEMDLQLKQKQNESKRLKDELNELETKFSENGSQSSAKENELKMLKNKIAELEEE 368

Query: 967  LKARNTDL---ERNLSEQMERFKELENSISLKDQELGS 1001
            +  +N+ L   E  L+  M +  +LE+ ++ +D +LGS
Sbjct: 369  ISTKNSQLIAKEGKLASLMAQLTQLESKLNQRDSQLGS 406

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 32.3 bits (72), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 140 ELELKRNNDIQLKDK-LIQQLNSKIENLLKLGKSPKFKNEVEII---NDSKTIN 189
           EL +     + LKD  +I    +K+  +L  G +PKFK+ V+ I   N++KTI 
Sbjct: 255 ELNVSSGRSMALKDADVILVFGAKLNWILHYGDTPKFKDNVKFIQVDNNTKTIG 308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.125    0.317 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 131,136,655
Number of extensions: 6331665
Number of successful extensions: 59202
Number of sequences better than 10.0: 3629
Number of HSP's gapped: 52573
Number of HSP's successfully gapped: 7892
Length of query: 1321
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1199
Effective length of database: 39,492,147
Effective search space: 47351084253
Effective search space used: 47351084253
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 72 (32.3 bits)