Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1043.685.700ON1042104252340.0
Kwal_55.197075.700ON1143113226060.0
SAKL0E14872g5.700ON1140112925910.0
TPHA0E002505.700ON1068105425870.0
ZYRO0G06644g5.700ON1166111225860.0
CAGL0H06567g5.700ON1169113325840.0
Kpol_2001.745.700ON1113111625570.0
TDEL0B022105.700ON1095108624220.0
TPHA0D045905.700ON1127111823790.0
AFR284W5.700ON1103110623510.0
Ecym_40205.700ON1125109122920.0
KNAG0L021105.700ON120091222360.0
TBLA0E021005.700ON1140113920090.0
NCAS0G002505.700ON118371117960.0
KLTH0E01100g5.700ON117768516550.0
KAFR0D022405.700ON118771316540.0
KLLA0A00638g5.700ON115572416320.0
Smik_9.225.700ON123073115770.0
NDAI0F003105.700ON125947712691e-154
YIL147C (SLN1)5.700ON122047312501e-152
Skud_9.215.700ON122147412451e-151
Suva_9.415.700ON121945412041e-145
TBLA0I016805.700ON121446811941e-144
Suva_15.4124.385ON6171611844e-13
ADL388W4.385ON4821401809e-13
CAGL0F09097g4.385ON6301211801e-12
KAFR0B069904.385ON5451241791e-12
KNAG0M001804.385ON6151241791e-12
Ecym_74744.385ON4961221772e-12
Smik_8.2964.385ON6251241763e-12
YHR206W (SKN7)4.385ON6221241764e-12
Skud_8.2734.385ON6231241754e-12
NCAS0A064504.385ON6091221711e-11
NDAI0D034304.385ON5971231711e-11
KLLA0A10219g4.385ON4751221673e-11
ZYRO0G00484g4.385ON6471221683e-11
TDEL0D003204.385ON5471221664e-11
SAKL0B12408g4.385ON4651221639e-11
Kpol_265.24.385ON5491241649e-11
TPHA0C001504.385ON5101241639e-11
TBLA0A107004.385ON5871241631e-10
KLTH0D17182g4.385ON4641221621e-10
Ecym_50775.230ON7951531631e-10
KLLA0E09505g5.230ON635981585e-10
Kwal_47.167704.385ON4611231541e-09
KAFR0J007005.230ON6201311513e-09
ADR343C5.230ON7491481504e-09
TPHA0N008505.230ON6702371496e-09
KNAG0B051405.230ON6481321407e-08
CAGL0D02882g5.230ON6671521408e-08
NCAS0D029005.230ON7621441399e-08
Kwal_33.152885.230ON5871431362e-07
Kpol_1004.45.230ON7141501353e-07
KLTH0B02684g5.230ON5951421334e-07
TDEL0E039805.230ON7301401282e-06
Suva_10.845.230ON6951471282e-06
SAKL0G12100g5.230ON738991282e-06
Skud_12.725.230ON7021471272e-06
YLR006C (SSK1)5.230ON7121521254e-06
Smik_12.685.230ON7121521254e-06
TBLA0D031705.230ON7651531255e-06
NDAI0I020005.230ON8901481247e-06
ZYRO0A11154g5.230ON7761511237e-06
Klac_YGOB_Anc_8.348.34ON1571951000.005
ACR218W8.34ON1569126970.010
TBLA0B015507.222ON39481850.17
KLLA0E04533g7.222ON42181820.50
CAGL0B00792g1.36ON445102810.64
YFL033C (RIM15)8.34ON1770128801.1
CAGL0K12562g8.34ON1682125801.1
KAFR0C035208.34ON145077781.6
Suva_6.268.34ON1753128772.2
Skud_6.388.34ON1758124772.2
TBLA0G034508.34ON197275772.6
Smik_6.468.34ON1760128753.7
NCAS0D012805.58ON40041735.4
Suva_15.3795.58ON40041735.7
TBLA0E049804.385ON791124736.8
KNAG0F031406.86ON633158727.0
Kpol_478.217.222ON43981727.6
Smik_10.781.191ON69968719.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1043.68
         (1042 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...  2020   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1008   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1002   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...  1001   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1000   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   999   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   989   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   937   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   920   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   910   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   887   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   865   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   778   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   696   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   642   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   641   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   633   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   612   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   493   e-154
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   486   e-152
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   484   e-151
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   468   e-145
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   464   e-144
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    75   4e-13
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    74   9e-13
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    74   1e-12
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    74   1e-12
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    74   1e-12
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    73   2e-12
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    72   3e-12
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    72   4e-12
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    72   4e-12
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    70   1e-11
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     70   1e-11
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    69   3e-11
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    69   3e-11
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    69   4e-11
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    67   9e-11
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    68   9e-11
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    67   9e-11
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    67   1e-10
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    67   1e-10
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    67   1e-10
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    65   5e-10
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    64   1e-09
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    63   3e-09
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    62   4e-09
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    62   6e-09
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    59   7e-08
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    59   8e-08
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    58   9e-08
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    57   2e-07
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    57   3e-07
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    56   4e-07
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    54   2e-06
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    54   2e-06
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    54   2e-06
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    54   2e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    53   4e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    53   4e-06
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    53   5e-06
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    52   7e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    52   7e-06
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    43   0.005
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    42   0.010
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    37   0.17 
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    36   0.50 
CAGL0B00792g Chr2 complement(70860..72197) [1338 bp, 445 aa] {ON...    36   0.64 
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    35   1.1  
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    35   1.1  
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    35   1.6  
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    34   2.2  
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    34   2.2  
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    34   2.6  
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    33   3.7  
NCAS0D01280 Chr4 complement(232270..233472) [1203 bp, 400 aa] {O...    33   5.4  
Suva_15.379 Chr15 (668836..670038) [1203 bp, 400 aa] {ON} YHR179...    33   5.7  
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    33   6.8  
KNAG0F03140 Chr6 (593032..594933) [1902 bp, 633 aa] {ON} Anc_6.8...    32   7.0  
Kpol_478.21 s478 complement(66004..67323) [1320 bp, 439 aa] {ON}...    32   7.6  
Smik_10.78 Chr10 complement(124678..126777) [2100 bp, 699 aa] {O...    32   9.7  

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score = 2020 bits (5234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 989/1042 (94%), Positives = 989/1042 (94%)

Query: 1    MLRACNVSIWKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIA 60
            MLRACNVSIWKAPYKVKLRTQLTTLVCFV           TGVYFTKNYRDLRLQQLYIA
Sbjct: 1    MLRACNVSIWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIA 60

Query: 61   ARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSV 120
            ARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSV
Sbjct: 61   ARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSV 120

Query: 121  VFLTTTLYDSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLN 180
            VFLTTTLYDSQF            DYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLN
Sbjct: 121  VFLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLN 180

Query: 181  DSTYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTN 240
            DSTYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTN
Sbjct: 181  DSTYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTN 240

Query: 241  TNGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAI 300
            TNGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAI
Sbjct: 241  TNGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAI 300

Query: 301  GYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPI 360
            GYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPI
Sbjct: 301  GYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPI 360

Query: 361  VRLQKATEVISKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLYEDVEKYTEIG 420
            VRLQKATEVISKRDGNEVH                  KDGRHNSSSYNLYEDVEKYTEIG
Sbjct: 361  VRLQKATEVISKRDGNEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLYEDVEKYTEIG 420

Query: 421  KANKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDA 480
            KANKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDA
Sbjct: 421  KANKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDA 480

Query: 481  LDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAME 540
            LDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAME
Sbjct: 481  LDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAME 540

Query: 541  ETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFG 600
            ETDMERIQSSLKLIYRSG            FSKNVLKQTKLEKTHFCVIDLALQIESIFG
Sbjct: 541  ETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFG 600

Query: 601  KISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLG 660
            KISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLG
Sbjct: 601  KISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLG 660

Query: 661  EYDKDRSAAENYKDVYMKEIRNSNGDKIKPLMTLISSKDTMSVADNISNKSVASDTERST 720
            EYDKDRSAAENYKDVYMKEIRNSNGDKIKPLMTLISSKDTMSVADNISNKSVASDTERST
Sbjct: 661  EYDKDRSAAENYKDVYMKEIRNSNGDKIKPLMTLISSKDTMSVADNISNKSVASDTERST 720

Query: 721  NNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQG 780
            NNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQG
Sbjct: 721  NNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQG 780

Query: 781  DQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNEL 840
            DQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNEL
Sbjct: 781  DQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNEL 840

Query: 841  VFEDEFNINSKKNREVKFQEITDEVDQVNIEGNSGVEVEPGKCTEPKKSTESESQAVVPS 900
            VFEDEFNINSKKNREVKFQEITDEVDQVNIEGNSGVEVEPGKCTEPKKSTESESQAVVPS
Sbjct: 841  VFEDEFNINSKKNREVKFQEITDEVDQVNIEGNSGVEVEPGKCTEPKKSTESESQAVVPS 900

Query: 901  KSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEI 960
            KSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEI
Sbjct: 901  KSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEI 960

Query: 961  QSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDG 1020
            QSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDG
Sbjct: 961  QSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDG 1020

Query: 1021 FLAKPIKREQLKGILTEFCPKA 1042
            FLAKPIKREQLKGILTEFCPKA
Sbjct: 1021 FLAKPIKREQLKGILTEFCPKA 1042

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/1132 (47%), Positives = 711/1132 (62%), Gaps = 95/1132 (8%)

Query: 1    MLRACNVSI-------WKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLR 53
            M+R  N+ +        + P  V +RTQLT LVC V           TGVYFT +++ LR
Sbjct: 1    MVRLNNIDLGAFFQRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLR 60

Query: 54   LQQLYIAARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLS 113
             ++L++AA+LKSSQIDQ +N LYYQC WL+ RD +++ALT Y AGN S ENW+  S  L 
Sbjct: 61   AERLHVAAQLKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLD 120

Query: 114  TFLESSVVFLTTTLYDSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGL 173
             FL SS +F    +YDS F            + IP+++L+ L PLS   +LPS L  TG+
Sbjct: 121  KFLGSSNLFSLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGM 180

Query: 174  LTDPVLNDSTYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIV 233
            LTDPVLN S YLMSMSLPI ANPS+ LS ++V+GY+TVV+SAE +++V NDTTAL+ S V
Sbjct: 181  LTDPVLNGSVYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSV 240

Query: 234  AVISST-NTNGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKS 292
             ++S+  + +  +G  YH VFPP+    D++N  Y +EN +FL DA    +GGSI  ++ 
Sbjct: 241  IIVSTVYDDHELAG--YHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRF 298

Query: 293  LYSKAVAIGYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPL 352
              +K +A+GY PC+  LA WV  ++QPE +F+S S +L KII GT IAI V  CV+TFPL
Sbjct: 299  FNNKKIAVGYSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPL 358

Query: 353  SRWSVQPIVRLQKATEVISKRDGNEVHXXXXXXXXXXXXXXXX---------XXKDGRHN 403
            S W+VQPIVRLQKATE+I+   G                               + G   
Sbjct: 359  SHWAVQPIVRLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVA 418

Query: 404  SSSYNLY-EDVEKYTEIGKANKSTESLSKENITD-----------YSSSNSSAIVMRK-- 449
             +  + Y  D  K    G ++ +   +++ENI D           YS  N S  V  +  
Sbjct: 419  RAGRDKYIPDSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERY 478

Query: 450  ----NLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIE 505
                NL + +VP  +R   DELSELTET+  MTD LD H  LLE RV+ RT+QLEAAKIE
Sbjct: 479  ITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIE 538

Query: 506  AESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXX 565
            AE ANEAKTVFIAN++HELRTPLNGILGMTAIAM E D  +++SSLKLI+RSG       
Sbjct: 539  AEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIM 598

Query: 566  XXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLW 625
                 FSKNVLK+TKLE+  F ++D+ALQ+ESIFGK++KDQHV L+I ILPN LRSMVLW
Sbjct: 599  TELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLW 658

Query: 626  GDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYM---KEIRN 682
            GD NRI+Q++MNLVSNALKFTPVDGK+ V  +LLGEYD+++S A  YK+V++    E R 
Sbjct: 659  GDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRT 718

Query: 683  SNGD---------------KIKPLMTLISSKDTMSVA----------------------D 705
            S+ +                +  L +   S D  +V                       +
Sbjct: 719  SSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDE 778

Query: 706  NISNKSVASDTERSTNNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGI 765
            N   KS+ S    S ++ I+  + +  S+ ++ ++  G  L+  +KWVIS+EV DTGPGI
Sbjct: 779  NEDTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEE--GRALESPKKWVISMEVHDTGPGI 836

Query: 766  EPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTV 825
            +P+L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +MHGTMKL+S+VGVGSKF FTV
Sbjct: 837  DPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTV 896

Query: 826  PLLQTREIEFNGNELVFEDEFNINSKKNREVKFQ------EITDEVDQVNIEGNSGVE-- 877
            PL QT+E+ F   E  FEDEFN +SKKNR+VKF+            +    EGN G    
Sbjct: 897  PLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSKSRSESSGTEGNGGNSPG 956

Query: 878  VEPGKCTEPKKSTESESQAV-VPSKSSQEMGNSIKYDV-------KNFKLLIVEDNKVNQ 929
            VE      P   +E    +V V     Q  G ++   +          K+L+ EDN VNQ
Sbjct: 957  VEGSGGNSPGTGSEVSVGSVRVDRPFLQSTGTALSTTLVTTSSLADRRKILVAEDNNVNQ 1016

Query: 930  LVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIR 989
             V+ RML LEG+E+  +ACDGQ+A +K+K   + G++Y L+ MD+QMP+VDG+TAT++IR
Sbjct: 1017 EVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIR 1076

Query: 990  QELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEFCPK 1041
            +EL Y  PIVALTAFADDSNI+ C  +GM+GFL+KPIKR ++K IL E+CP+
Sbjct: 1077 KELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPR 1128

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1129 (47%), Positives = 718/1129 (63%), Gaps = 111/1129 (9%)

Query: 11   KAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70
            K P+KV +RTQL  LVC V           TGVYFT NY+ LR  +L++AA+LKSSQIDQ
Sbjct: 12   KPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQIDQ 71

Query: 71   TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130
             +N LYYQC WL+ RD ++ +L  Y AGN + ENW+    VL  FL SS +F    +YDS
Sbjct: 72   NLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYDS 131

Query: 131  QFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190
             F            + +P+ VL++L PLS  D L S L T+G+LTDPVLND+ Y+MSMSL
Sbjct: 132  TFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMSL 191

Query: 191  PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250
            PI A+PS+ L++S + GY+TVVMSAE+++ V NDTTAL+KS VA++S+  +N +    YH
Sbjct: 192  PIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSYH 251

Query: 251  FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310
            FVFPPHG   DI++ ++ +EN +F+  AF   + GS+ ++   Y K VA+GY PC F   
Sbjct: 252  FVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQV 311

Query: 311  NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370
             WV  +SQPE+VF+S S +LT II GT + I VF+C++TFPL+ W+V+PIVRLQKATE+I
Sbjct: 312  QWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEII 371

Query: 371  SKRDGNEVHXXXXXXXXXXXXXXXXXX-----------------KDGRHNSSSYNLY--- 410
            + R G   +                                   +D  H  S++ L+   
Sbjct: 372  TARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGH--SNFELHHRT 429

Query: 411  ------EDVEKYTEIGKANKSTESLSKENIT-DYSSSNSSAIVMRKNLADFQVPASRRFV 463
                  ++     EI  A   T   +  + T D  S  S   V   NL D +VP   R  
Sbjct: 430  SNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDARVPVYGRLF 489

Query: 464  KDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHE 523
             DELSELT+T+  MTD LD H  LLE RV+ RTKQLEAAKIEAE+ANEAKTVFIAN++HE
Sbjct: 490  SDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHE 549

Query: 524  LRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEK 583
            LRTPLNGILGMTAI+M E DM+++Q+SLKLI+RSG            FSKNVL++TKLE+
Sbjct: 550  LRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEE 609

Query: 584  THFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNAL 643
             +F ++D+ALQ++SIFGK++KDQHV LSI + PN +R+M+LWGD NRI+Q++MNLVSNAL
Sbjct: 610  RNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQIVMNLVSNAL 669

Query: 644  KFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK---EIRNSNGD----------KIKP 690
            KF+PVDGK+ V IKLLGEYD  +S   NY DV++K   EI +++            K+  
Sbjct: 670  KFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLSTLEYTKVDA 729

Query: 691  LMTLISSKDTMSVA---DNISNKSVAS-------------DTERSTNNTIYS-------- 726
            +   ++SK + S     + I++  V+S             DT++ +N+ I          
Sbjct: 730  IQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKRSNSEISDSLSLVSSN 789

Query: 727  -------------NKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSV 773
                          K  +  N +D+ D++G  L+  + WVI++EVEDTGPGIEP+L +SV
Sbjct: 790  NSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESV 849

Query: 774  FEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREI 833
            FEPFVQGDQTLSRQYGGTGLGLSICRQLA +M GTMKLES+VGVGSKF FTVPL QTRE+
Sbjct: 850  FEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREV 909

Query: 834  EFNGNELVFEDEFNINSKKNREVKFQEITDEVDQVNIEGNS-GVEVEPGKCTEPKKSTES 892
             F+  E  FEDEFN +SKKNR+VKF+          +  NS G +  P   T     T+S
Sbjct: 910  SFDDVENPFEDEFNAHSKKNRKVKFK----------MNKNSGGSKSRPSVNTSLNSGTDS 959

Query: 893  ESQAVVPSKSSQEMGN---------------------SIKYDVKNFKLLIVEDNKVNQLV 931
             ++ +  S+S   +G+                     ++K   + FK+L+ EDN VNQ V
Sbjct: 960  TAEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTVKSLERPFKILVAEDNNVNQEV 1019

Query: 932  VIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQE 991
            V RML LEG+ +  +ACDGQEA +K+K +Q   ++Y ++ MD+QMP+VDG+ +TK+IRQE
Sbjct: 1020 VKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQE 1079

Query: 992  LKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEFCP 1040
            L+Y  PIVALTAFADDSNI+ C  SGM+GFL+KPIKR +LK +L+EFCP
Sbjct: 1080 LRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCP 1128

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/1054 (50%), Positives = 699/1054 (66%), Gaps = 33/1054 (3%)

Query: 13   PYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQTI 72
            PY + LR QL TL C V           TGVYFT NY+ LR +QL+IAA+LKSSQ+DQ++
Sbjct: 13   PYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQSL 72

Query: 73   NLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDSQF 132
            N LYYQ +W    D +  AL  Y +GN++ ENW  +   +S FL SS +F   T+YD+ F
Sbjct: 73   NYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTNF 132

Query: 133  XXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSLPI 192
                         +IPDD++  L PLS  + LP+ +GT G LTDPVLN S YLMS+SLPI
Sbjct: 133  MEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLPI 192

Query: 193  IANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTS-GQEYHF 251
              NPS+ LSDSRV+GY+T++  A +I AV NDTTALE S VA+IS+   N T+    YHF
Sbjct: 193  FGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYHF 252

Query: 252  VFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLAN 311
            VFPP+G+   +++  YP+ N++FL DAF+    GS++ +   YS  VA+GY  C+F LAN
Sbjct: 253  VFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLAN 312

Query: 312  WVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVIS 371
            WV  VSQPE VF SS++KLTKII+GTV+ I   VC +TF +S + V+PI++L++ATE+IS
Sbjct: 313  WVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELIS 372

Query: 372  KRDG-----NEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLYEDVEKYTEIGKANKST 426
            +  G       +                    DG  N    +L    E       +N ++
Sbjct: 373  RGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKEKSLPTCTEDERSKSLSNIAS 432

Query: 427  ESL--SKENITDYSSSN------SSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMT 478
            +S+  +   I  +SS +      S+  ++  +    +VP    ++ DEL+EL ET+ +M 
Sbjct: 433  KSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMA 492

Query: 479  DALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIA 538
            D+LDEHS LLE RVK RTK+LEAAKI AE+ NEAKTVFIAN++HELRTPLNGILGMTAIA
Sbjct: 493  DSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIA 552

Query: 539  MEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESI 598
            +EE D E++Q SLKLIYRSG            FSKNVL++TKLEK HFC+ D+ALQI+SI
Sbjct: 553  LEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSI 612

Query: 599  FGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKL 658
            FGKI+KDQ V  SI I PN +R+MV +GD NRI+QVIMNLVSNALKFTP+DG + V IKL
Sbjct: 613  FGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKL 672

Query: 659  LGEYDKDRSAAENYKDVYMKEIRNSNGDK----IKPLMTLISSKDTMSVADNISNKSVAS 714
            LGEYD+++S+  NY  VY+KE  +  GD      +P+   IS     S   +  +K+  +
Sbjct: 673  LGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDKISFAGGSSSIHDYCSKTDEN 732

Query: 715  D---TE-RSTNNTI--YSNKFKNGSNFQDTD---DAIGVPLDKKRKWVISVEVEDTGPGI 765
            D   TE +S ++TI  YS +   GS +++ +   + +GVP+ K +KWVISV+VEDTGPGI
Sbjct: 733  DNIKTEIKSDDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPKKWVISVDVEDTGPGI 792

Query: 766  EPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTV 825
             P+LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM+L+S  G+GSKF FTV
Sbjct: 793  SPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTV 852

Query: 826  PLLQTREIEFNGNELVFEDEFNINSKKNREVKFQEITDEVDQVNIEGNSGVEVEPGKCT- 884
            PLLQ R+I F+  E  FEDEFN NSKKNR+V F+  TD+V    I   +  + +      
Sbjct: 853  PLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFK--TDKVTSRGIPSKAAEKNDDANTNG 910

Query: 885  EPKKSTESESQAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENF 944
            +   + E++S+ + P+  +    N  ++D   FK+LIVEDN VNQ V+ R+LKLE I+  
Sbjct: 911  QTTLNAEAKSKTLKPTHITISEDNIDQHD---FKVLIVEDNMVNQEVIKRLLKLEKIKTI 967

Query: 945  TIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAF 1004
              A DGQEA++ +K+  S  + + ++ MDIQMP VDG TAT++IR EL Y  PIVALTAF
Sbjct: 968  EYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAF 1027

Query: 1005 ADDSNIQACYKSGMDGFLAKPIKREQLKGILTEF 1038
            ADDSN + C  SGM+ FLAKPIKR +LK I+ EF
Sbjct: 1028 ADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1000 bits (2586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1112 (47%), Positives = 711/1112 (63%), Gaps = 82/1112 (7%)

Query: 2    LRACNVSIWKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAA 61
            +R      +++P ++ +R QLT LV  V           TGVYFT NY++LR ++LY+AA
Sbjct: 3    MRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAA 62

Query: 62   RLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVV 121
            +LKS+QIDQ +N +YYQC WL+ RD ++ AL +Y AGN++  NW  + +V+  FL SS +
Sbjct: 63   QLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGL 122

Query: 122  FLTTTLYDSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLND 181
            F   T+YD+ F            ++IP+  L  L+PLSG   LPS L + G+LT+PVLN 
Sbjct: 123  FSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNG 182

Query: 182  STYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNT 241
            ++YLMSMSLPI ANPS+ L+ S V+GY+T+VMSA++++ V +DTTALEKS VA++S+   
Sbjct: 183  TSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYD 242

Query: 242  NGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301
               +   Y+FVF P G    I+    P++N TFLS A    +GG++ ++K LY+K VA+G
Sbjct: 243  QNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302

Query: 302  YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361
            Y PCS    NW+  V Q E VFM  + KLTKII+GTV+ I VFVC++TFPL+ W+V+PIV
Sbjct: 303  YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362

Query: 362  RLQKATEVISKRDG-----------NEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLY 410
            RLQKATE+I++  G           N                         HN   ++L+
Sbjct: 363  RLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDLH 422

Query: 411  -EDVEK--YTEIGKANKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDEL 467
             E ++   +   G  N S  +    +  +  S  S  +    NL + +VP  RRF  DEL
Sbjct: 423  GEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDEL 482

Query: 468  SELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTP 527
            SELT+T+  MTDALD+H  LLE RV+ RT+QLEAAKI+AE+ANEAKTVFIAN++HELRTP
Sbjct: 483  SELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISHELRTP 542

Query: 528  LNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFC 587
            LNGILGMTAI+MEE D+++IQ+SLKLI+RSG            FSKNVLK+TKLEK +F 
Sbjct: 543  LNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFS 602

Query: 588  VIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTP 647
            V D+ALQI+SIFGK++KDQ V+LSI + PN +R+MVL+GD NRI+Q++MNLVSNALKFTP
Sbjct: 603  VTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTP 662

Query: 648  VDGKITVNIKLLGEYDKDRSAAENYKDVYMKEIRNSNGDKIKPLMTLISSKDTMSV---- 703
            VDGK+ V + LLGEYD +RS  EN+K VY+       G+  K     I  K+  S+    
Sbjct: 663  VDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPKGNDEKD-KGGIEEKERFSIENTP 721

Query: 704  ---ADNISNKSVASDTERST-------------------------------------NNT 723
               + N SNK   SDTE +                                      N+T
Sbjct: 722  NDTSSNSSNKH--SDTETTPGLNDTDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDT 779

Query: 724  IYSNKFKNGSNF-QDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQ 782
            ++ ++FK       D+ + +GV +  K+KWVIS+ VEDTGPGI+ SL +SVFEPFVQGDQ
Sbjct: 780  VFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQ 839

Query: 783  TLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVF 842
             LSRQYGGTGLGLSICRQLA +M+GTM L+S++GVGS+F FTVPL QTREI F+     F
Sbjct: 840  ALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAF 899

Query: 843  EDEFNINSKKNREVKFQEITDEVDQVNIEGNSGVEVEPG-----------KCTEPKKSTE 891
            EDEFN +SKKNR+VKF+    +  +     +S + V P            K T+  +S  
Sbjct: 900  EDEFNPDSKKNRKVKFK--IAKSLKSKRSKSSLMTVGPKSSSSDKSLSQLKLTDSDRSVR 957

Query: 892  SES---QAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIAC 948
             +    Q+   + S+  +G +   +    K+L+ EDN VNQ V+ RML LEG+ N  + C
Sbjct: 958  LDRPFLQSTGTASSNTNLGTTSTIN----KILVAEDNDVNQEVIKRMLNLEGVHNIELVC 1013

Query: 949  DGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDS 1008
            DGQEA++K+K++   GE+Y L+ MD+QMPK+DG+ +TK+IR++L Y  PIVALTAFADDS
Sbjct: 1014 DGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDS 1073

Query: 1009 NIQACYKSGMDGFLAKPIKREQLKGILTEFCP 1040
            NI+ C  +GMDGFLAKPIKR QL+ I+ EFCP
Sbjct: 1074 NIRECLDAGMDGFLAKPIKRAQLRKIIEEFCP 1105

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/1133 (48%), Positives = 725/1133 (63%), Gaps = 107/1133 (9%)

Query: 11   KAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70
            K P+++ +R QLT LV  V           TGVYFT NY++LR  +LYIAA+LKSSQ+DQ
Sbjct: 15   KPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQ 74

Query: 71   TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130
             +N LYYQC WL  RD +++AL  Y AGN++ ENW  +++V+  FL SS +F  + +YD 
Sbjct: 75   NLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSRVYDY 134

Query: 131  QFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190
             F            D +P+ + + L PLS    LPS L T G+LTDPVLN + YLMSMSL
Sbjct: 135  DFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSL 194

Query: 191  PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250
            PI ANPS+  SD +V+GY+TVVMSAE +R+V NDTTALEKS VA++S+  +N T    Y 
Sbjct: 195  PIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYR 254

Query: 251  FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310
            FVFPP+G S  I+N  + +++S+FL+ AF   +GGSI K+K  Y+K VAIGY+PCSF   
Sbjct: 255  FVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFV 314

Query: 311  NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370
            NWV  VSQ E VF+S S KLTKII+GTV+ I VFV ++TFPL+ W+V+PIVRLQKATE+I
Sbjct: 315  NWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELI 374

Query: 371  SKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLYEDVEK--YTEIGKANKSTE- 427
            ++  G                       +  +  S  +L E   +  Y     +N +T+ 
Sbjct: 375  AEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLSEKNHRPAYDSASDSNYATDG 434

Query: 428  SLSKENITDYSSSNSSA----------IVMRKNLADFQVPASRRFVKDELSELTETYKLM 477
            SLS +  T  +S+  S           +    NL + ++P  RR   DELS+LT T+  M
Sbjct: 435  SLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNAM 494

Query: 478  TDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAI 537
            TDALD+H  LLE RV+ RTKQLEAAKI+AE+ANEAKTVFIAN++HELRTPLNGILGMTAI
Sbjct: 495  TDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAI 554

Query: 538  AMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIES 597
            +MEETD+ +I++SLKLI+RSG            FSKNVLK+T LEK +FC+ D+ALQI+S
Sbjct: 555  SMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKS 614

Query: 598  IFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIK 657
            IFGK++KDQHV+LSI + PN +R+MVLWGD NRI+Q++MNLVSNALKFTPVDGK+ V IK
Sbjct: 615  IFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIK 674

Query: 658  LLGEYDKDRSAAENYKDVYMKEIRNSNGDKIKPL-------------------------- 691
            LLGEYD++ + A+N+K ++   I +S+  +  P+                          
Sbjct: 675  LLGEYDEEATKADNFKQIHT--IADSDAHQQHPVSSSPNGVLVKHLSTSSDSNSNLSDSD 732

Query: 692  ----MTLISSKDTMSVADNISNKSVASDTERST-----NNTIYSNKFKNGSN-FQDTDDA 741
                 T     D  S+  NIS+ S    +  S+     +N +++ +FK   + ++D++D 
Sbjct: 733  KYNEKTYDEDDDEHSIT-NISDHSDDLSSLVSSSTSSYDNALFNTQFKKTPDLYEDSNDG 791

Query: 742  IGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQL 801
            +G  L  ++ WV ++EVEDTGPGI+P L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 792  LGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQL 851

Query: 802  ANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQEI 861
            A +MHGTMKLES+VGVGSKF FTVPL QTR I+F+  E +FEDEFN  SKKNR VKF++ 
Sbjct: 852  ATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEEEDLFEDEFNPESKKNRRVKFKDS 911

Query: 862  TDEV-----------------DQVNIEGNS-----------GVEVEPGKCTEPKKSTESE 893
            T  +                 D+ + EG+S            +E  P     PK   E++
Sbjct: 912  TRSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVGDEND 971

Query: 894  S--------------------------QAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKV 927
            S                          Q+   + SS+ +       ++ FK+L+ EDN V
Sbjct: 972  SKASSSSSKSDNIKEKEEKVHLDRPFLQSTGTATSSRNVPTMADVTMR-FKILVAEDNHV 1030

Query: 928  NQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKI 987
            NQ V+ RML LEGI N  +ACDGQ+A +K++ +  + + Y ++ MDIQMPKVDG+ +TK+
Sbjct: 1031 NQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKM 1090

Query: 988  IRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEFCP 1040
            IR++L Y   IVALTAFADDSNI+ C ++GM+GFL+KPIKR +LK IL E+CP
Sbjct: 1091 IRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCP 1143

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  989 bits (2557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1116 (49%), Positives = 720/1116 (64%), Gaps = 106/1116 (9%)

Query: 10   WKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQID 69
            +K PY++ +R QLT LV  V           TGVYFT+NY++LR  +L IAA+LKSSQID
Sbjct: 9    FKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSSQID 68

Query: 70   QTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYD 129
            QT+N L+YQC +LT RD +++AL +Y AGN++ ENW  + +V+  FL SS +F    LYD
Sbjct: 69   QTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYD 128

Query: 130  SQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMS 189
              F            D IP++VLS L PLS   SLPS L   G+LTDPVLN S YLMSMS
Sbjct: 129  LNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMS 188

Query: 190  LPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEY 249
            LPI+ NPS+ LS SRV+GY+T+VMSA+ ++ V  + TALE S V VIS+   +      +
Sbjct: 189  LPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGF 248

Query: 250  HFVFPPHGASDDIVN-TAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFG 308
            HFVF     +DD      YP++N T+LS A    + GSI K+K  +++ +AIGY PCSF 
Sbjct: 249  HFVFEVE--NDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFS 306

Query: 309  LANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATE 368
            L+NWV  V+QPE VF+S S KL KII+GTV+AI VFVC+ITFPLS W+V+PIVRLQKATE
Sbjct: 307  LSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATE 366

Query: 369  VISKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLYEDVEKYTEIG-------K 421
            +IS+  G                       +G  +S+S N  E VE +           +
Sbjct: 367  LISQGRG---------------LKPTSNFSNGDSSSTSDNWRESVESHVRASLGIFKSLR 411

Query: 422  ANKSTESLSKEN---ITDYSSSNSSA----------------IVMRKNLADFQVPASRRF 462
             N S E  S ++   I + SS N+S                      NL   +VP   RF
Sbjct: 412  NNGSNELQSNDDMNEINERSSKNNSTGDNIKSSDNDSSSSFQRYTTSNLVQARVPVYGRF 471

Query: 463  VKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTH 522
            ++DELSELT+T+  MT+ALD+H  LLE RV+ RTKQLEAAKIEAE+ANEAKTVFIAN++H
Sbjct: 472  LQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISH 531

Query: 523  ELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLE 582
            ELRTPLNGILGMTAI+MEE D ++I+ +LKLI+RSG            FSKNVLK+T LE
Sbjct: 532  ELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLE 591

Query: 583  KTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNA 642
            K  FC+ ++ALQI+SIFGK+++DQHVKL I ++PN++RSMVLWGD NRI+Q++MNLVSNA
Sbjct: 592  KRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNA 651

Query: 643  LKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK---EIRNSNG---DKIKPLMTLIS 696
            LKFTP+DGK+ V IKLLGEYD++RS  ++YK+VY+K   E+   NG   D ++  +  +S
Sbjct: 652  LKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELS 711

Query: 697  SKDTM---------------------------SVADN------ISNKSVASDTERSTNNT 723
             KD +                           S +DN      I   S+ + + RS ++ 
Sbjct: 712  EKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYDDA 771

Query: 724  IYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQT 783
                +FK   +  D ++ +GV L + + WVISVEVEDTGPGIEP LQ++VFEPFVQGDQ 
Sbjct: 772  ALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQA 831

Query: 784  LSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFE 843
            LSRQYGGTGLGLSICRQLA +MHGTMKLES VGVGSKFIFTVPL QTREI F+  +  FE
Sbjct: 832  LSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDDEK--FE 889

Query: 844  DEFNINSKKNREVKFQ-------EITDEVDQVNIEGNSGV-----EVEPGKCTEPKKSTE 891
            DEFN  SKKNR +KF+         +++ D+  I+ +  +     E +    T P   ++
Sbjct: 890  DEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSK 949

Query: 892  SE-----SQAVVPSKSSQEMGNSI-KYDV---KNFKLLIVEDNKVNQLVVIRMLKLEGIE 942
                    Q+   + SSQ++   I K D    K+ ++L+ EDN VNQ V+ RML LE I+
Sbjct: 950  VRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKID 1009

Query: 943  NFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALT 1002
            N  +ACDGQ+A +K+K +    EYY ++ MD+QMPKVDG+ +TK+IR++L Y  PIVALT
Sbjct: 1010 NIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALT 1069

Query: 1003 AFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEF 1038
            AFA+D NI+ C  +GMDGFL KPIKR +LK IL E+
Sbjct: 1070 AFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/1086 (47%), Positives = 695/1086 (63%), Gaps = 67/1086 (6%)

Query: 10   WKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQID 69
            +  P+++ +RTQLT LV  V           TGVYFT NY+ LR ++LY+AA+LKSSQID
Sbjct: 11   FSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSSQID 70

Query: 70   QTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYD 129
            Q +N LYYQC WL+ +  ++++L +Y +GN++  NW  +S VL  FL SS +F    +YD
Sbjct: 71   QNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVARVYD 130

Query: 130  SQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMS 189
            + F            D + DDVL+ L+PLS   +LP+ L + G+LTDPVLN ++YLMSMS
Sbjct: 131  ADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMS 190

Query: 190  LPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEY 249
            LPI ANPS+ L++SRV+GY+T++MSA+++++V +D TALEKS V ++S+          Y
Sbjct: 191  LPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSY 250

Query: 250  HFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGL 309
             FVF P+G +  I++  +P+ N++FLS A    + GS  ++   Y++  A+GY PCSF  
Sbjct: 251  RFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKF 310

Query: 310  ANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEV 369
             NWV  +SQ E VFM  S +LTKII G V+ I  FVC+ TFPL+ W+VQPIVRLQKATE+
Sbjct: 311  VNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATEI 370

Query: 370  ISKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLYED----VEKYTEIGKANKS 425
            I+  +G  +                   +    +S       D    V + +  G  N  
Sbjct: 371  IT--EGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADEKGAVGRASTEGSFNYD 428

Query: 426  TESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHS 485
                S  +  + SS  +   +   NL + +VP  R F  DE SELT+T+  MT+ALD+H 
Sbjct: 429  QAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHY 488

Query: 486  QLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDME 545
             LLE RV+ RTKQLEAAK+EAE+ANEAKTVFIAN++HELRTPLNGILGMTAI+MEE D++
Sbjct: 489  ALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDID 548

Query: 546  RIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKD 605
            +IQSSLKLI+RSG            FSKNVL++TKLEK  F + D+A+QI+SIFGK++KD
Sbjct: 549  KIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKD 608

Query: 606  QHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKD 665
            Q VK SI + PN++R MVL+GD NRI+Q++MNLVSNALKFTPVDGK++V ++LLGEYDK 
Sbjct: 609  QRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQ 668

Query: 666  RSAAENYKDVYMKEIRNSNGDKIKPLMTLISSKDTMSVADNISNK-----SVASDTER-- 718
            RS  E++K VY+ +      D + P       K      + IS K     +  SD+E+  
Sbjct: 669  RSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTN 728

Query: 719  -------------------------STNNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWV 753
                                     S ++TI+  +FK  ++   + D  G  L+  + W 
Sbjct: 729  LDDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHTS--SSGDENGHLLEHPKNWA 786

Query: 754  ISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLES 813
            ISVEVEDTGPGI+PSL +SVFEPFVQGDQ LSRQYGGTGLGLSICRQLA +M+GTMKL+S
Sbjct: 787  ISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDS 846

Query: 814  EVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQ-------------- 859
            ++GVGSKF FT+PL QTREIEF  +E  FEDEFN  SKKNR+VKF+              
Sbjct: 847  KLGVGSKFTFTLPLTQTREIEFE-DENAFEDEFNPLSKKNRKVKFKVAKSIKSRKSKSSL 905

Query: 860  ------EITDEVDQVNIEGNSGVEVEPGKCTEPKKSTESESQAVVPSKSSQEMGNSIKYD 913
                    + +     ++G S  E   G  +  +   +S   A     SS +    +   
Sbjct: 906  SNSSGKGGSSDKSSKQLKG-SESEFSVGNVSLDRPFLQSTGTA-----SSSKNVTVVSNV 959

Query: 914  VKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMD 973
             K++++L+ EDN VNQ V+ RML LEGI+   +A DGQ+A +K+K +Q +GE+Y L+ MD
Sbjct: 960  NKSYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMD 1019

Query: 974  IQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKG 1033
            +QMPKVDG+ ATK+IR++L Y  PIVALTAFADDSNI+ C ++GM+GFL+KPIKR +LK 
Sbjct: 1020 VQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKT 1079

Query: 1034 ILTEFC 1039
            I+ ++C
Sbjct: 1080 IIAQYC 1085

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1118 (45%), Positives = 691/1118 (61%), Gaps = 91/1118 (8%)

Query: 9    IWKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQI 68
             WK PY++ +R QLT LV  V            GVYFT NY++L+  +LYIAA+LK+SQI
Sbjct: 8    FWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQI 67

Query: 69   DQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLY 128
            DQT+N LYYQC +L+  + ++++L  Y+AGN S+ NW  +S VL  FL SS +F    LY
Sbjct: 68   DQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLY 127

Query: 129  DSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSM 188
            D+ F            +Y+P+ V+  L  LS   SLPS L T G+ TDPVLN S +LMSM
Sbjct: 128  DTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSM 187

Query: 189  SLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQE 248
            SLPI ANPS+ LSDSR++GYL+V+MSAE +++V NDTTALE S V VIS+  +  T+ + 
Sbjct: 188  SLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEY 247

Query: 249  YHFVFP-PHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSF 307
            ++F+F   +  +D   +  Y ++N TF+ +   + +GG++ K+      A A+GY  CSF
Sbjct: 248  FNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSF 307

Query: 308  GLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKAT 367
             L NW+  V+QPE  F  S+ KL +II+G V+A+ VFVC++TFPLS W+VQP++RLQKAT
Sbjct: 308  SLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKAT 367

Query: 368  EVISKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLYEDVEKYTEIGKA----- 422
            E I+  +G  +                   ++   N    +L  +  K ++ G       
Sbjct: 368  ERIA--EGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSITANNF 425

Query: 423  ------------------NKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVK 464
                              N S+ S    N  D  SS+S       NL + +VP   R ++
Sbjct: 426  KNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVYWRLLQ 485

Query: 465  DELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHEL 524
            DELSELT+T+  MTDALD+H  LLE RV+ RTKQLEAAKI+AESANEAKTVFIAN++HEL
Sbjct: 486  DELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHEL 545

Query: 525  RTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKT 584
            RTPLNGILGMTAI+MEE D+++I+ +LKLI+RSG            FSKNVL++TKLEK 
Sbjct: 546  RTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKR 605

Query: 585  HFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALK 644
             FC+ ++ALQI+SIFGK++KDQHVKLSI ++PN LRS VLWGD NRI+QV+MNLVSNALK
Sbjct: 606  DFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALK 665

Query: 645  FTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMKE-----------IRNSNGDKIKPLMT 693
            FTPVDG + V I LLGEYD++RS AE+YK VY+K+               N D  +   T
Sbjct: 666  FTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDISRKSET 725

Query: 694  ----------LISSKDT-------------MSVADNISNKSVASDTERSTNNTIYSNKFK 730
                       IS  DT             +S  D +   S+ + + +S ++T    +  
Sbjct: 726  ELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLI 785

Query: 731  NGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGG 790
              ++  D ++ +GV L +++ WVISVEV+DTG GI+P LQ+SVFEPFVQGDQ LSRQYGG
Sbjct: 786  KSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGG 845

Query: 791  TGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINS 850
            TGLGLSIC+QL+ +M+GTM+LESEVGVGSKFIFT+PL QTREI    +EL F DEFN  S
Sbjct: 846  TGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVS 904

Query: 851  KKNREVKFQ----EITDEVDQVNIEGNS-------------------GVEVEPG--KCTE 885
            KKNR+VKF+         +   N  G+S                      V P   +   
Sbjct: 905  KKNRKVKFKFSGSSSAKSIKTRNSIGSSLNNRHSTTSIDSSSSDSDEEDNVRPSSVRLNR 964

Query: 886  P-----KKSTESESQAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEG 940
            P       +T +++   + + +  +  N +   +    +L+ EDN VNQ V+ RMLKLEG
Sbjct: 965  PFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEG 1024

Query: 941  IENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVA 1000
            I N  +A DGQ+A +K K +      Y ++ MD+QMP++DG+ ATK+IR+EL Y +PIVA
Sbjct: 1025 INNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVA 1084

Query: 1001 LTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEF 1038
            L+AF  + N++ C   GM+ FL+KPIKR  LK IL ++
Sbjct: 1085 LSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/1106 (45%), Positives = 670/1106 (60%), Gaps = 94/1106 (8%)

Query: 7    VSIWKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSS 66
            +++ K P+K  LRTQLT LVC +           TGVYFT NYR LR  +L++AARL SS
Sbjct: 10   LAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSS 69

Query: 67   QIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTT 126
            Q+DQ++ LLYYQC  L+ +D I++AL+DY AGNRSAENW     +L  FLE S  F    
Sbjct: 70   QVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAY 129

Query: 127  LYDSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLM 186
            LYD  +              + ++ L  L PL       +      + T P  N +  LM
Sbjct: 130  LYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLM 188

Query: 187  SMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSG 246
            SM+LP+ A  S  +    V G+LT+VMSA+ I A VNDT+ L +S+V++++    +  + 
Sbjct: 189  SMTLPVEA--STIIGRGNVVGFLTIVMSADPITA-VNDTSVLGESMVSILTGIPNDKGNL 245

Query: 247  QEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYS--------KAV 298
             +Y FVFPP      +  T YP++N++FL DAF +     +  + S Y         K V
Sbjct: 246  VKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKV 305

Query: 299  AIGYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQ 358
            A+GY  C F   +WV  VSQ E VF+S + KLTKII GTV+ + VF+C++TF L+ W+V+
Sbjct: 306  AVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVK 365

Query: 359  PIVRLQKATEVISKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRH---------------- 402
            PIVRLQKATE I+   G   +                  +   H                
Sbjct: 366  PIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKHHVSPF 425

Query: 403  -------NSSSYNLYEDVEKYTEIGKANKSTESLSKENITDYSSSNSSAIVMRKNLADFQ 455
                   NS S +   D E+Y          E+ S   ++D+   ++SA     N  D +
Sbjct: 426  VTENHAANSGSCSSMSDHERYLHHIARYHDGET-STNILSDHEKGSTSAT----NWIDTR 480

Query: 456  VPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTV 515
            VP  RR   DELSELT+T+  MTD LD    +LE RV+ RTKQLEAAKI+AE+ANEAKTV
Sbjct: 481  VPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQAEAANEAKTV 540

Query: 516  FIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNV 575
            FIAN+ HELRTPLNGILGMTAIAM E D E+IQ+SLKLI+RSG            FSKNV
Sbjct: 541  FIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILTELLTFSKNV 600

Query: 576  LKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVI 635
            LK+TKLE+ HF +ID+ALQ++SIFGK++KDQHVKLSI+++PN +R+MVLWGD NRI+Q++
Sbjct: 601  LKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIV 660

Query: 636  MNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYM---KEIRNSNGDKIKPLM 692
            MNLVSNALKFTPVDGK+ V IKL+GEYD  RS A N+ +VY+    E+ NS+ + I  ++
Sbjct: 661  MNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTVV 720

Query: 693  TLISS----------------KDTMSVADNISNKSVASDTERSTNNTIYSNKFKNGSNF- 735
                                 KD+ +V D+    S++S    S ++ +   + K    F 
Sbjct: 721  EEEEKACEEEPTADDTPERKKKDSETV-DDADAISISSSVATSYDDAVLHAQLKKIPTFI 779

Query: 736  --QDTDDAIGVP-LDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTG 792
              +D+D+ + +  L+K R WVI +EV+DTGPGIEPSL +SVF+PFVQGDQTLSRQYGGTG
Sbjct: 780  DLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTG 839

Query: 793  LGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKK 852
            LGLSICRQLA +M GTMKLES+VG GSKF FTVPL QT  ++FN  + +FEDEFNI SKK
Sbjct: 840  LGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKK 899

Query: 853  NREVKFQ---------------EITDEVDQVNIE--GNSGVEVEPGKCTEPKKSTESESQ 895
            NR+VKFQ                    + +  IE  G S  E   G     +   +S   
Sbjct: 900  NRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGT 959

Query: 896  AV----VPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQ 951
            A     VP+ SS E          + ++L+ EDN VNQ V+ RML LEG  N  +ACDG+
Sbjct: 960  ATSTRSVPTLSSAE---------SSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGE 1010

Query: 952  EAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQ 1011
            +A +K+  +  +GE+Y L+ MD+QMP++DG+  TK++RQ+L Y+ PIVALTAFADDSNI+
Sbjct: 1011 DAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIK 1070

Query: 1012 ACYKSGMDGFLAKPIKREQLKGILTE 1037
             C +SGM+ FLAKPIKR  LK IL E
Sbjct: 1071 ECLESGMNSFLAKPIKRPMLKKILLE 1096

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1091 (46%), Positives = 681/1091 (62%), Gaps = 70/1091 (6%)

Query: 9    IWKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQI 68
            +++ PYK  L TQLT LVC +           TGVYFT NY+ LR  +L +AA+L S+QI
Sbjct: 22   MFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSAQI 81

Query: 69   DQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLY 128
            +QT+N++YYQC WL+ RD I++AL  Y  GN S+ N  +  +VL  FL+SS     T LY
Sbjct: 82   NQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLY 141

Query: 129  DSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSM 188
            DS F            + I DD+L  LLPLS    LPS +   G+L++PV N S++ MSM
Sbjct: 142  DSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFMSM 201

Query: 189  SLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQE 248
            SLP+ A  S+    S   GY+T+VMSA+ + +V     AL  S V+V++           
Sbjct: 202  SLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILNS 261

Query: 249  YHFVFPPHGAS-DDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSF 307
            Y  +FPP       ++   +P+ N++FL +AF +   GS++K+ + Y   VA+GY  CSF
Sbjct: 262  YQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAACSF 321

Query: 308  GLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKAT 367
             L NWV  V+Q E VF+S S KLTKII GTVI I  F+C++TF ++ W+V+PIVRLQKAT
Sbjct: 322  KLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKAT 381

Query: 368  EVISKRDGNEVHXXXXXXXXXXXXXXXXXXK----------DGRHNS--SSYN-LYEDVE 414
            E+I+   G   +                  K          DG   +  S Y  ++  VE
Sbjct: 382  ELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLREGDGLRKTPPSPYTPMHSHVE 441

Query: 415  -KYTEIGK--ANKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELT 471
               + IG+  +     ++  E  + + S    A     N  + +VP  RR   DELSELT
Sbjct: 442  PNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSANWIETRVPVYRRLFSDELSELT 501

Query: 472  ETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGI 531
            +T+  MTD LD H  LLE RV+ RTKQLEAAKI+AESANEAKT+FIAN++HELRTPLNGI
Sbjct: 502  DTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGI 561

Query: 532  LGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDL 591
            LGMTAIAM E DME++Q+SLKLI+RSG            FSKN+LK+ KLE+ +F ++D+
Sbjct: 562  LGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTFSKNILKRNKLEQRNFSMVDV 621

Query: 592  ALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGK 651
            ALQ++SIFGK++KDQ+VK SIF++PN +R MVLWGD NRI+Q++MNLVSNALKFTPVDGK
Sbjct: 622  ALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGK 681

Query: 652  ITVNIKLLGEYDKDRSAAENYKDVYMKEIRNSNGDKIKPLMTLI-----------SSKDT 700
            +++ IKLLGEYD++ S   N  +V++K+      D+ K +   I           S+ DT
Sbjct: 682  VSLRIKLLGEYDEEESEKCNNAEVFIKQ-GTEISDETKNVFDTITEEKYVSCSGESTDDT 740

Query: 701  MSVA-------DNISNKSVASDTERSTNNTIYSNKFKNGSNFQDTDD----AIGVPLDKK 749
            +          D   N SV S    S ++ I+ ++FK      D D+    +IG   +KK
Sbjct: 741  IETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKK 799

Query: 750  RKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTM 809
            + WVIS+EVEDTGPGI+PSLQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ +M GTM
Sbjct: 800  KVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTM 859

Query: 810  KLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKF---QEITDEVD 866
            KL SEVGVGSKFIFTVPL QT  +E   +E +FEDEFN  SK NR VKF   +       
Sbjct: 860  KLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQS 919

Query: 867  QVNIEGNSGVEVEP---------------GKCTEP--KKSTESESQAVVPSKSSQEMGNS 909
             +++   SGV   P                +   P  + +  + S   +P+  S E    
Sbjct: 920  SLSVPEISGVPDSPLNSMGRSESELSVSSVRVDRPFLQSTGTATSTRSIPTVGSLE---- 975

Query: 910  IKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGL 969
                  NFK+L+ EDN VNQ V+ RML+LEGI +  +ACDG+EA+EK+  + ++ ++Y +
Sbjct: 976  -----SNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNI 1030

Query: 970  VLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKRE 1029
            V MD+QMPK+DG+ AT+ IR+EL Y  PIVALTAFADDSNI+ C +SGMDGFL+KPIKRE
Sbjct: 1031 VFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKRE 1090

Query: 1030 QLKGILTEFCP 1040
            +L+ IL E+CP
Sbjct: 1091 KLRKILLEYCP 1101

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/912 (50%), Positives = 592/912 (64%), Gaps = 63/912 (6%)

Query: 11  KAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70
           K PY+V +R QLT LV  V           TGVYFT NY++LR  +LYIAA+LKSSQIDQ
Sbjct: 11  KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70

Query: 71  TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130
            +N LYYQC W+  RD +++ L +Y AGN+S  NW  +  VL  FL SS +F    +YDS
Sbjct: 71  NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130

Query: 131 QFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190
            F            D IP+DVL+ LLPLS    LPS L T G++T+PV N S+YLMSMSL
Sbjct: 131 SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190

Query: 191 PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250
           PI ANPS+ L+DSRV+GY+TVVMSAE + +V NDTTALE+S VA++S+  TN T    Y 
Sbjct: 191 PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250

Query: 251 FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310
           FVFPP G++  I+N  +P+ N+TFLS A    +GG++  ++  Y   +A+GY P +  LA
Sbjct: 251 FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310

Query: 311 NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370
           NWV  V+Q E VF+S + KL KIIAGTV+ I VF  +ITFPL+ W+V+PIVRLQKATE+I
Sbjct: 311 NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370

Query: 371 SKRDG---------------------------NEVHXXXXXXXXXXXXXXXXXXKDGRHN 403
           ++  G                           + V                   +D   N
Sbjct: 371 TESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTNNINNNNSNEKAQPPSDQDTNTN 430

Query: 404 SSSYNLYEDVEKYTEIGKANKSTESLSKENITDYS---SSNSSAIVMRKNLADFQVPASR 460
           +SS ++     +      A+     +S  N++D     S+ S       NL   +VP+ R
Sbjct: 431 NSSSSIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVNLIQARVPSYR 490

Query: 461 RFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANV 520
              KDELS+LTET+  MTDALD+H  LLE RV+ RTKQLEAAKIEAE+ANEAKTVFIAN+
Sbjct: 491 ALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIANI 550

Query: 521 THELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTK 580
           +HELRTPLNGILGMTAI+MEETD+++I++SLKLI+RSG            FSKNVLK+TK
Sbjct: 551 SHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTK 610

Query: 581 LEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVS 640
           LEK +FC+ D+ALQI+SIFGK++KDQHV+LSI + PN +RSMVL+GD NRI+Q++MNLVS
Sbjct: 611 LEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLVS 670

Query: 641 NALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK---EIRNSN--------GDKIK 689
           NALKFTPVDGK+ V +K+LG YD+  S   N+  VY+K   EI +S         G    
Sbjct: 671 NALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLNVKSEGQGKD 730

Query: 690 PLMTLISSKDTMS-------------VA-----DNI--SNKSVASDTERSTNNTIYSNKF 729
              +  +SK+  S             VA     DN+   N+S+ S T  S ++ I++++F
Sbjct: 731 KFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTSSYDDAIFNSQF 790

Query: 730 KNGSNFQDTDD--AIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQ 787
           K  +N  D DD   +GV L+  + WVIS EVED+GPGI+  LQ+SVFEPFVQGDQTLSRQ
Sbjct: 791 KKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQ 850

Query: 788 YGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFN 847
           YGGTGLGLSICRQLA +M G M LES+VGVGSKF FT+PL QTREI F   E  FEDEFN
Sbjct: 851 YGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFN 910

Query: 848 INSKKNREVKFQ 859
             SKKNR+VKF+
Sbjct: 911 AKSKKNRKVKFR 922

 Score =  179 bits (455), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 76/123 (61%), Positives = 101/123 (82%)

Query: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976
            +K+L+ EDN VNQ V+ RML+LEG+++  +ACDGQ+A +K+K++Q +G  Y L+ MD+QM
Sbjct: 1065 YKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQM 1124

Query: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            PKVDG+T+TK+IR +L  D PIVALTAFADDSNI+ C  +GMDGFL+KPIKR +LK IL 
Sbjct: 1125 PKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILK 1184

Query: 1037 EFC 1039
            EFC
Sbjct: 1185 EFC 1187

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1139 (41%), Positives = 655/1139 (57%), Gaps = 131/1139 (11%)

Query: 11   KAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70
            K PY+  LR QLT LVC V           TGVYFT +Y+DL + +LYIA++LKSSQIDQ
Sbjct: 18   KPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSSQIDQ 77

Query: 71   TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130
            T+N LYYQC W+  R+ I++ +     G  +A     +  VL  F+ +S +F  T +YD 
Sbjct: 78   TLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTMIYDK 137

Query: 131  QFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDS-LPSYLGTTGLLTDPVLNDSTYLMSMS 189
                            +   +LS LLPLS T++ +P  +  TG+LTDP+LN + YLMSMS
Sbjct: 138  NLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYLMSMS 197

Query: 190  LPIIANPSVTLS----DSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTS 245
            LPI + P  T +     S ++GYLTVVMSAE++++V NDT  L  S  A++S+  TN T 
Sbjct: 198  LPI-SGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTNDTL 256

Query: 246  GQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPC 305
             + +HFVFPP    D I++    ++N TF   AF   + GS  K K +  K  AIGY P 
Sbjct: 257  PRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIGYAPT 316

Query: 306  SFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQK 365
            +F L  WV  V+ P+H F S S KLTKII GTV+ I VFV +I+ PLS W+VQPIVRLQ+
Sbjct: 317  NFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQR 376

Query: 366  ATEVISKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLYEDVEKYTEIGKANKS 425
            A+E+I+KR G                       D   +S+  + Y+  + +T   K   S
Sbjct: 377  ASELITKRRG-----------------LRNLNDDSFDDSNDDHTYDSNDDHTYESKLISS 419

Query: 426  TESL--SKENITDYSS------SNSSAIV----------------MRKNLA--------- 452
            T +L  S  NI D  S      +NS  +                 +R+N++         
Sbjct: 420  TPTLKNSDSNIHDEKSGRTRGDANSGTLNSNNTITNNTNNKDFNRLRRNVSVSTHVSLSE 479

Query: 453  --DFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESAN 510
              + QVP  R+   DEL+ELT+T+ +M++ALDEH  LLE RV +RTKQLEAAK++AE+AN
Sbjct: 480  FDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAAN 539

Query: 511  EAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXX 570
            EAKTVFIAN++HELRTPLNGILGMT+ ++EE D+++I+  LKLI+RSG            
Sbjct: 540  EAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLT 599

Query: 571  FSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNK-LRSMVLWGDQN 629
            FSKNVL +TKLE   F +I++  QI++IF K+ + Q VKL I +LP K L+S++ +GD N
Sbjct: 600  FSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSN 659

Query: 630  RILQVIMNLVSNALKFTP-VDGKITVNIKLLGEYDKDRSAAENYKDVYMK---EIRNSNG 685
            RILQV+MNL+SNA+KFTP V+GK+ VN+ LLGEYD++ S  ENY  V +K   +I   +G
Sbjct: 660  RILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESG 719

Query: 686  DKIK----------------------------------PLMTLISSKDTMSVADNISNKS 711
            + IK                                  P     +   T   AD+  N +
Sbjct: 720  ELIKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGADSRRNSN 779

Query: 712  VAS----------DTERSTNNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDT 761
            V++          ++ +  +N +++   K   +    D      ++  +KWVI  EV D 
Sbjct: 780  VSTVNNSSISLDSESSKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDN 839

Query: 762  GPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKF 821
            GPGI+ +L  SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL  +M GT++LESE+G GSKF
Sbjct: 840  GPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKF 899

Query: 822  IFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQEIT---------DEVDQVNIEG 872
            I+T+PLLQ    + + ++   E++ N N+  + ++   E T            D  +++ 
Sbjct: 900  IYTIPLLQVGGTKKDNDD--NEEDHNDNTNSSVDIDIIEDTPVSITSSSQTHSDLNSLQS 957

Query: 873  NSGVEV---EPGKCTEPKKSTESESQAV----------VPSKSSQEMGNSIKYDVKNFKL 919
            NS  EV   +     E   +  S  ++V          V +    ++ +  K      K+
Sbjct: 958  NSTNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKV 1017

Query: 920  LIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKV 979
            L+ EDN VNQ V+ RMLKLE I +  +A DG EA EK+K+     + Y ++ MDIQMPK+
Sbjct: 1018 LVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKM 1077

Query: 980  DGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEF 1038
            DG+ +T  IRQELKY+  IVALTAFAD+SNI+ C  +GMDGF+ KPIKR  L  +L EF
Sbjct: 1078 DGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/711 (50%), Positives = 467/711 (65%), Gaps = 37/711 (5%)

Query: 5   CNVSIW---KAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAA 61
            N+S W   K P+++ +RTQLT LV  V           TGVYFT NY++LR  +LYIAA
Sbjct: 3   VNLSKWYVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAA 62

Query: 62  RLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVV 121
           +LKSSQIDQ +N LYYQ  WL+ RD ++  LT+Y AGN++AENWA +  V+  FL S+ +
Sbjct: 63  QLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNL 122

Query: 122 FLTTTLYDSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLND 181
           F    LYDS F            D IP+ VL  L PL+    L S L T G+LTDPVLN 
Sbjct: 123 FSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNG 182

Query: 182 STYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNT 241
           STY+MSMSLPI ANPS+ L+DS+V+GY+T+VMSAE ++ V NDTTALE+S VA++S    
Sbjct: 183 STYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYN 242

Query: 242 NGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301
           N ++   YHFVF P+GA   ++N+ + + N++FL+ A    +GGS+ K+K  Y+K +A+G
Sbjct: 243 NESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVG 302

Query: 302 YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361
           Y PC+F   NW+  VSQ E VF+S S KL KII+GTV+AI VFV +ITFPL+ W+V+PIV
Sbjct: 303 YSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIV 362

Query: 362 RLQKATEVISKRDG------NEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLY----- 410
           RLQKATE++S+  G         +                      HN S  NL      
Sbjct: 363 RLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNG 422

Query: 411 --------------------EDVEKYTE-IGKANKSTESLSKENITDYS--SSNSSAIVM 447
                                D    TE I  AN S  + S    TD++  S+ S  +  
Sbjct: 423 HLNQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTT 482

Query: 448 RKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAE 507
             NL + +VP  RR   DELS+LT+T+  MTDALD+H  LLE RV+ RTKQLEAAKIEAE
Sbjct: 483 SANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAE 542

Query: 508 SANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXX 567
           +ANEAKT+FIAN++HELRTPLNGILGMTAI+MEETD+ +I+SSLKLI+RSG         
Sbjct: 543 TANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTE 602

Query: 568 XXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGD 627
              FSKNVLK+T LEK  FC+ D+ALQI+SIFGK++KDQ V+LSI +LPN +R+M+L+GD
Sbjct: 603 LLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGD 662

Query: 628 QNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK 678
            NRI+Q++MNLVSNALKFTPVDGK+ V IKL+GEYD++ S   N+K V +K
Sbjct: 663 SNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVK 713

 Score =  208 bits (529), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 95/151 (62%), Positives = 123/151 (81%), Gaps = 1/151 (0%)

Query: 710 KSVASDTERSTNNTIYSNKFKNGSN-FQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPS 768
           +S+ S +  S ++ +++N+FK     ++D D  +G+ L   + WVI++EV+DTGPGI+PS
Sbjct: 794 QSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPS 853

Query: 769 LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLL 828
           LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLAN+M+GTM+L+SEVGVGS F FTVPL+
Sbjct: 854 LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLM 913

Query: 829 QTREIEFNGNELVFEDEFNINSKKNREVKFQ 859
           QTRE+E N ++  FEDEFN  S+KNR VKF+
Sbjct: 914 QTRELELNEDDHPFEDEFNPASRKNRRVKFK 944

 Score =  170 bits (431), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 73/126 (57%), Positives = 100/126 (79%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K FK+L+ EDN VNQ V+ RML LEG+EN  +A DGQ+A  ++K +  +GE++ ++ MD+
Sbjct: 1043 KKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDV 1102

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
            QMPKVDG+ +TK+IR +L Y  PIVALTAFADDSNI+ C ++GM+GFL+KPIKR ++K I
Sbjct: 1103 QMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTI 1162

Query: 1035 LTEFCP 1040
            L E+CP
Sbjct: 1163 LEEYCP 1168

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/685 (49%), Positives = 440/685 (64%), Gaps = 28/685 (4%)

Query: 11  KAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70
           K P+ + +RTQLT LVC V           TGVYFT +++ +R ++LY+A++LK+SQIDQ
Sbjct: 18  KPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQIDQ 77

Query: 71  TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130
            +  LYYQC +L+ RD +++ALT Y AGN + ENWA     L  FL SS +F    +YDS
Sbjct: 78  NLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDS 137

Query: 131 QFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190
            F            + +P+ VL+ L PLS   SLPS L   G+LTDPVLND+ YLMSMSL
Sbjct: 138 SFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSL 197

Query: 191 PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250
           PI ANPS+ LS S+V+GY+TVV+SAE ++ V NDTTALE S V ++S+   N      YH
Sbjct: 198 PIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRELAG-YH 256

Query: 251 FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310
            VFPP+G   DI++  Y + N +FL DAF   +GGSI  +  LYSKAVAIGY PCS  L 
Sbjct: 257 LVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLV 316

Query: 311 NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370
            WV  ++QPE  F+  S +L +II GT +AI V  C +TFPLS W+VQPIVRLQKATE+I
Sbjct: 317 QWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEII 376

Query: 371 S------KRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNS---SSYNLY----------- 410
           +        +G+ ++                     R  S   SS + Y           
Sbjct: 377 TAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAKGTLNK 436

Query: 411 EDVEKYTEIGKANKSTESLSKEN-------ITDYSSSNSSAIVMRKNLADFQVPASRRFV 463
            D E+    G  N    +L K +        ++  S+ S   +   NL + +VP   R  
Sbjct: 437 NDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLIEARVPTYNRLF 496

Query: 464 KDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHE 523
            DELSELTET+  MTD LD H  LLE RV+ RT+QLEAAKIEAE ANEAKTVFIAN++HE
Sbjct: 497 SDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHE 556

Query: 524 LRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEK 583
           LRTPLNGILGMTAIAM E DM++++SSLKLI+RSG            FSKNVLK+TKLE+
Sbjct: 557 LRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEE 616

Query: 584 THFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNAL 643
             F V ++ALQ+ESIFGK++KDQHV L+I I+PN LR+MVLWGD NRI+Q++MNLVSNAL
Sbjct: 617 RDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNAL 676

Query: 644 KFTPVDGKITVNIKLLGEYDKDRSA 668
           KFTPVDG++ V   LLGEYD+ +++
Sbjct: 677 KFTPVDGRVNVKFTLLGEYDESKAS 701

 Score =  339 bits (869), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 236/344 (68%), Gaps = 23/344 (6%)

Query: 710  KSVASDTERSTNNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSL 769
            +S+ S+   S ++ I+ ++ + G++ ++ D   G PL+  R+  I++EV+DTGPGIEP+L
Sbjct: 827  RSIESENASSYDDAIFHSRLRKGNSGENED---GRPLEHPRRLAIAMEVQDTGPGIEPAL 883

Query: 770  QKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQ 829
            Q+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M+G+M L+S+VGVGSKF FTVPL Q
Sbjct: 884  QESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQ 943

Query: 830  TREIEFNGNELVFEDEFNINSKKNREVKFQ------------EITDEVDQVNIEGNSGVE 877
            T+E+ F  +E  FEDEFN +SKKNR+VKF+              + +   V     S  E
Sbjct: 944  TKELCFEEDENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQNSSVGTPTVSESE 1003

Query: 878  VEPGKCTEPKKSTESESQAV-VPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRML 936
            V  G     +   +S   A+   S ++  + N         K+L+ EDN VNQ V+ RML
Sbjct: 1004 VSVGSVRVDRPFLQSTGTALSTRSVTTTSVANKC-------KVLVAEDNNVNQEVIKRML 1056

Query: 937  KLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDK 996
             LEG+++  +ACDGQ+A +K+K     G++Y L+ MD+QMP+VDG++AT++IR EL Y  
Sbjct: 1057 NLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTH 1116

Query: 997  PIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEFCP 1040
            PIVALTA+ADD NI+ C  +GM+GFLAKPI+R ++K IL+E+CP
Sbjct: 1117 PIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCP 1160

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/713 (48%), Positives = 454/713 (63%), Gaps = 53/713 (7%)

Query: 11  KAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70
           K PY++ +RTQL  +V  V           TGVYFT +Y++LR  +LYIAA+LKSSQIDQ
Sbjct: 24  KPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83

Query: 71  TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130
           T+  LYYQ  W++ RD ++ +L ++ AGN+S+ NW ST  VL  FL SS  F    +YD 
Sbjct: 84  TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143

Query: 131 QFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190
            F            + I  DVL  L PLS    L S L TTG+LTDPVLN ++YLMSMSL
Sbjct: 144 NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203

Query: 191 PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250
           P+ ANPS+ LS SRV+GY+T++M+A+ + +V NDTTA+EKS VA++S+   N +    YH
Sbjct: 204 PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263

Query: 251 FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310
              PP+G +  + +  + ++NS+FL+ A    +GGSI K+  LY+KAVA+GY PCSF LA
Sbjct: 264 LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323

Query: 311 NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370
           NWV  VSQ E VF   S KLTKIIAG V+ I+VFV ++T PL+ ++V+PIVRL+KATE+I
Sbjct: 324 NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383

Query: 371 SKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLYEDVEKYTEIGKANKSTES-- 428
           +  +G  +                   K  R +  S        K T  G +N   E+  
Sbjct: 384 T--EGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSS------RKSTATGNSNSLNENSA 435

Query: 429 --------LSKEN--ITDYSSSNSSAIVMRKNLADFQVPASRRFV----KDELSE----- 469
                   L+ EN  +T++S  +   + M + L D    ++   +     D LSE     
Sbjct: 436 SLSSHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHL 495

Query: 470 -----LTE-------------------TYKLMTDALDEHSQLLEYRVKERTKQLEAAKIE 505
                LTE                   T+  MTDALDEH  LLE RV+ RTKQLEAAKI+
Sbjct: 496 ITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQ 555

Query: 506 AESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXX 565
           AE+ANEAKTVFIAN++HELRTPLNGILGMTAI+MEE D+ +I+SSLKLI+RSG       
Sbjct: 556 AEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHIL 615

Query: 566 XXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLW 625
                FSKNVL++TKLEK +FC+ D+ALQ++SIFGK++KDQHV+LSI + PN +R+MVL+
Sbjct: 616 TELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLY 675

Query: 626 GDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK 678
           GD NRI+QV+MNLVSNALKFTPVDGK+ V IKLLGEYD++ S    ++ VY+K
Sbjct: 676 GDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVK 728

 Score =  350 bits (897), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/378 (49%), Positives = 248/378 (65%), Gaps = 33/378 (8%)

Query: 696  SSKDTMSVADNISNKSVASDTERSTNNTIYSNKFKNGSN-FQDTDDAIGVPLDKKRKWVI 754
            S + T S  D + N S+AS +  S ++ I++++FK   + ++D D  +G  L +++ WV 
Sbjct: 791  SQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVF 850

Query: 755  SVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESE 814
             +EV DTGPGI+ SLQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M+GTM LES 
Sbjct: 851  RIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLEST 910

Query: 815  VGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQE-------------I 861
            VG GSKFIFTVPL QTR I+ + +E  +EDEFN  SK NR+VKF               I
Sbjct: 911  VGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARSINSRRSRSSLI 970

Query: 862  TDEVDQV-NIEGNSGVEVEPGKCTEPKKSTESESQAVVPSKSS---------QEMGNSIK 911
            T    ++  +   S +E      ++   S ++ES +  P   S         Q  G +I 
Sbjct: 971  TSNSSRIATVREESRLETRSNH-SDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTAIS 1029

Query: 912  YD--------VKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSR 963
                       K   +L+ EDN VNQ V+ RML LEG++N  +ACDGQ+A + +K ++ R
Sbjct: 1030 SANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKER 1089

Query: 964  GEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLA 1023
            GE+Y ++ MD+QMPKVDG++ATK+IR +LKY+ PIVALTAFADDSNI+ C  +GMDGFL+
Sbjct: 1090 GEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLS 1149

Query: 1024 KPIKREQLKGILTEFCPK 1041
            KPIKR QLK IL E+CPK
Sbjct: 1150 KPIKRPQLKTILLEYCPK 1167

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1155

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/724 (46%), Positives = 457/724 (63%), Gaps = 44/724 (6%)

Query: 3   RACNVSIWK----APYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLY 58
           R C++   +     P+ V LRTQL  LVC +           TGVYFT NY+ +R ++L 
Sbjct: 7   RRCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQ 66

Query: 59  IAARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLES 118
           +AA+LKSSQ+DQ +N LYYQ  WL+ RD ++ AL ++ AGN S +NW S  D L  FL S
Sbjct: 67  VAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGS 126

Query: 119 SVVFLTTTLYDSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPV 178
           S +F    +YD+ F            D IP++VL+ L PLSG + L S L TTG++TDPV
Sbjct: 127 SGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPV 186

Query: 179 LNDSTYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISS 238
            N + YL+SMSLP+  NPS+ L+ + + GY+TV+ SAE+++AVVNDT AL+KS V+++S+
Sbjct: 187 YNWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSA 246

Query: 239 TNTNGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAV 298
              + +S   YHFVFPPHG S       +P++N TF++DAF + + GS+ K+  +  + +
Sbjct: 247 VFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNI 306

Query: 299 AIGYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQ 358
           A+GY P +F L NWV  V+QPE VF+S +I+L KIIAGTV AI VF+C++TFP++ W+VQ
Sbjct: 307 AVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQ 366

Query: 359 PIVRLQKATEVI-SKRDGNEVHXXXXXXXXXXXXXXXXXXKDGRHNSSSYNLY-EDVEKY 416
           PIVRLQKATE+I S RD    H                  +   + +    L+ + V K 
Sbjct: 367 PIVRLQKATEIITSGRDLK--HYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKG 424

Query: 417 TEIGKANKSTESL--SKENITDYSSSNSSAIV-----MRKNLADFQVP--------ASRR 461
           T     N +      S+ +    S+ NS  I      + ++      P         S R
Sbjct: 425 TPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSER 484

Query: 462 FVKDELSELTETY-----KLMTDALDE--------------HSQLLEYRVKERTKQLEAA 502
           ++K   + L E Y     +   D L E              H  LLE RV+ RTKQLEAA
Sbjct: 485 YIKS--TNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAA 542

Query: 503 KIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXX 562
           KI+AESANEAKTVFIAN++HELRTPLNGILGMTAIAM ETDM+++Q+SLKLI+RSG    
Sbjct: 543 KIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLL 602

Query: 563 XXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSM 622
                   FSKNVLK+TKLE+  F V+D+ALQI+SIFGK++KDQHVKLSI + PN +R++
Sbjct: 603 HILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTL 662

Query: 623 VLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMKEIRN 682
           VLWGD NRI+Q++MNLVSNALKFTPVDGK+ V IKLLGEYD  RS + +Y++V++     
Sbjct: 663 VLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSE 722

Query: 683 SNGD 686
           +N D
Sbjct: 723 ANDD 726

 Score =  354 bits (908), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 237/335 (70%), Gaps = 14/335 (4%)

Query: 721  NNTIYSNKFKN--GSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFV 778
            ++ I+ ++FK    S   DT++     L   + WVIS+EVEDTG GI+PSLQ+SVFEPFV
Sbjct: 814  DDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFV 873

Query: 779  QGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGN 838
            QGDQTLSRQYGGTGLGLSICRQLA +M GTMKL+S+VGVGSKFIFTVPL QT+EI F+G 
Sbjct: 874  QGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGA 933

Query: 839  ELVFEDEFNINSKKNREVKF------QEITDEVDQVNIEGNSGVEVEPGKCTEPKKSTES 892
            E  FEDEFNI+S+KNR+VKF      + +  +  + +I+G+S   V   K +   +++  
Sbjct: 934  EKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSIDGHSDNNVSERKASNSTENSVG 993

Query: 893  ESQAVVP------SKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTI 946
              +   P      + +S    +S+  +V   ++L+ EDN VNQ V+ RML+LEG+ +  +
Sbjct: 994  NVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDM 1053

Query: 947  ACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFAD 1006
            ACDGQEA EK++EI   GE Y ++ MD+QMP+VDG+ ATK+IR +L Y  PIVALTA+AD
Sbjct: 1054 ACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYAD 1113

Query: 1007 DSNIQACYKSGMDGFLAKPIKREQLKGILTEFCPK 1041
            DSNI+ C +SGMDGFL KPIKR  LK I+ ++C K
Sbjct: 1114 DSNIKVCLESGMDGFLPKPIKRPLLKKIIAQYCSK 1148

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/731 (48%), Positives = 463/731 (63%), Gaps = 126/731 (17%)

Query: 431  KENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEY 490
            + N TD SS+ S  +    NL + ++P  RR   DELS+LTET+  MTDALD+H  LLE 
Sbjct: 485  RNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLED 544

Query: 491  RVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSS 550
            RV+ RTKQLEAAKIEAE+ANEAKTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I++S
Sbjct: 545  RVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604

Query: 551  LKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKL 610
            LKLI+RSG            FSKNVL++TKLEK  FC+ D+ALQI+SIFGK++KDQ V+L
Sbjct: 605  LKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664

Query: 611  SIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAE 670
            SI + PN +R+MVLWGD NRI+Q++MNLVSNALKFTPVDG + V +KLLGEYDKD S  +
Sbjct: 665  SISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKK 724

Query: 671  NYKDVYMK---EIR-------------NSNGDKIKPL----MTLISSKDTMSVADNISNK 710
             +K+V++K   EI              +SN  K   L     ++ S++DT  + + I+ +
Sbjct: 725  QFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEEITKR 784

Query: 711  SVAS---------DTER---------------STNNTIYSNKFKN--GSNFQDTDDAIGV 744
            + A+         D E+               S ++ I++++F    GS+ +D    +G 
Sbjct: 785  NTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGSD-EDEGGNLGK 843

Query: 745  PLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANL 804
            P++  + WVIS+EVEDTGPGI+PSLQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLAN+
Sbjct: 844  PIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANM 903

Query: 805  MHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKF------ 858
            M+GTM+LES+VGVGSKF FT+PL QT+EI F   +  FEDEFN  S+KNR VKF      
Sbjct: 904  MNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVAKSI 963

Query: 859  --------------------QEITDEVDQVN-------------IEGNSGV--------- 876
                                 ++  E+   N              EG +G+         
Sbjct: 964  KSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQE 1023

Query: 877  -EVEPGKCTEPKKSTESESQAVVPSK--SSQEMGNSIKYD----------VKNFKLLIVE 923
              V+P  C     S ES  +  VP K  S +E   S+  D            +  +  ++
Sbjct: 1024 KNVKPFICFS---SAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080

Query: 924  DNKVN---------------QLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYG 968
            DN  N               Q V+ RML LEGIEN  +ACDGQEA +K+KE+ S+G  Y 
Sbjct: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140

Query: 969  LVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKR 1028
            ++ MD+QMPKVDG+ +TK+IR++L Y  PIVALTAFADDSNI+ C +SGM+GFL+KPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1029 EQLKGILTEFC 1039
             +LK ILTEFC
Sbjct: 1201 PKLKTILTEFC 1211

 Score =  392 bits (1008), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 259/374 (69%)

Query: 2   LRACNVSIWKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAA 61
           LR  + S +  P+++ +R QLT LV  V           TGVYFT NY++LR  +LYIAA
Sbjct: 3   LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 62  RLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVV 121
           +LKSSQIDQT+N LYYQ  +L  RD ++S+LT + AGN+SA+NW  +  V+  FL SS +
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122

Query: 122 FLTTTLYDSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLND 181
           F    +YDS F            D IP+DVL  L PLS    LPS L TTG+LTDPV+N+
Sbjct: 123 FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182

Query: 182 STYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNT 241
           + YLMSMSLPI ANPS+ L+DSRV+GY+T++MSAE +++V NDTTALEKS VA+IS+   
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYN 242

Query: 242 NGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301
           N      YHF+FPP+G +  +  + + ++N+TF+S AF + +GGS+ ++ S   K +A+G
Sbjct: 243 NQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALG 302

Query: 302 YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361
           Y PCSF L NWV  VSQPE VF+S + KL KII GTVIAI VFV ++T PL+ W+VQPIV
Sbjct: 303 YSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362

Query: 362 RLQKATEVISKRDG 375
           RLQKATE+I++  G
Sbjct: 363 RLQKATELITEGRG 376

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  493 bits (1269), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 260/477 (54%), Positives = 327/477 (68%), Gaps = 56/477 (11%)

Query: 439 SSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQ 498
           S+ S  +    NL + +VP  RR   DELS+LT+T+  MTDALD+H  LLE RV+ RTKQ
Sbjct: 514 STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573

Query: 499 LEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSG 558
           LEAAKIEAE ANEAKTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I+SSLKLI+RSG
Sbjct: 574 LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633

Query: 559 XXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNK 618
                       FSKNVLK+T LEK  FC+ D+ALQI+SIFGK++KDQ VKLSI + PN 
Sbjct: 634 ELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693

Query: 619 LRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK 678
           +R+MVL+GD NRI+Q++MNLVSNALKFTPVDGK+ V +KL+GEYD+  SA  N+K+VY+K
Sbjct: 694 IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753

Query: 679 E----------IRNSNGDKIKPL------MTLISSKDTMS---------VADNISNKSVA 713
           +          I  +N     P        +  S KDT +          AD++ ++ +A
Sbjct: 754 QGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADDLDDEKIA 813

Query: 714 S---------DTER--------------------STNNTIYSNKFKNGSNFQDTDDA--I 742
           +         DTE                     S ++ I++++FK      D D+    
Sbjct: 814 TKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDA 873

Query: 743 GVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 802
           GV ++  + WVI + VEDTGPGI+ +LQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 874 GVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLA 933

Query: 803 NLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQ 859
           N+MHGTMKL+SEVGVGS F FTVPL QTREI F+  E  FEDEFN  S+KNR+VKF+
Sbjct: 934 NMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFK 990

 Score =  415 bits (1066), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 204/367 (55%), Positives = 256/367 (69%)

Query: 9   IWKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQI 68
           + K P+++ +R QLT LV  V           TGVYFT NY++LR  +LYIAA+LKSSQI
Sbjct: 8   VLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQI 67

Query: 69  DQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLY 128
           DQT+N LYYQC +++ RD ++ ALT+Y AGN+S ENWA ++ +L  FL SS +F    +Y
Sbjct: 68  DQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVY 127

Query: 129 DSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSM 188
           D+ F            D IPD +L+ LLPLS    L S L TTG+LTDPVLN STYLMSM
Sbjct: 128 DASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSM 187

Query: 189 SLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQE 248
           SLPI ANPSV L++SRV+GYLTVVMSAE +R V NDTTALEKS VA++S+   N ++   
Sbjct: 188 SLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTA 247

Query: 249 YHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFG 308
           Y FVF P GA   I+N+ Y + N +FLS A    +GGS+  +K  YSK VAIGY PC+F 
Sbjct: 248 YRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFS 307

Query: 309 LANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATE 368
             NWV  VSQ E VF+S S KL KIIAGTV+AI VFV ++TFPL+ W+V+PIVRLQKATE
Sbjct: 308 FVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATE 367

Query: 369 VISKRDG 375
           +IS+  G
Sbjct: 368 LISEGRG 374

 Score =  175 bits (444), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 100/127 (78%)

Query: 914  VKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMD 973
             +N K+L+ EDN VNQ V+ RML LEG+    +ACDGQEA +K+K +  + + Y ++ MD
Sbjct: 1126 AQNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMD 1185

Query: 974  IQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKG 1033
            +QMPKVDG+ +TK+IR++L YD PIVALTAFADDSNI+ C +SGM+GFL+KPIKR +L+ 
Sbjct: 1186 VQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRT 1245

Query: 1034 ILTEFCP 1040
            I+ E+CP
Sbjct: 1246 IIKEYCP 1252

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  486 bits (1250), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 263/473 (55%), Positives = 333/473 (70%), Gaps = 45/473 (9%)

Query: 431 KENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEY 490
           + N TD SS+ S  +    NL + ++P  RR   DELS+LTET+  MTDALD+H  LLE 
Sbjct: 485 RHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEE 544

Query: 491 RVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSS 550
           RV+ RTKQLEAAKIEAE+ANEAKTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I++S
Sbjct: 545 RVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604

Query: 551 LKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKL 610
           LKLI+RSG            FSKNVL++TKLEK  FC+ D+ALQI+SIFGK++KDQ V+L
Sbjct: 605 LKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664

Query: 611 SIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAE 670
           SI + PN +R+MVLWGD NRI+Q++MNLVSNALKFTPVDG + V +KLLGEYDK+ S  +
Sbjct: 665 SISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKK 724

Query: 671 NYKDVYMKEIRN----------------SNGDKIKPL----MTLISSKDTMSVADNISNK 710
            YK+VY+K+                   SN  K   L     +L S++DT ++ + I+ +
Sbjct: 725 QYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKR 784

Query: 711 SVAS---------DTERSTN---------------NTIYSNKFKNGSNFQDTDDA-IGVP 745
           +  +         D E+++N               N I++++F       D +   +G P
Sbjct: 785 NTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNLGRP 844

Query: 746 LDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLM 805
           ++  + WVIS+EVEDTGPGI+PSLQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLAN+M
Sbjct: 845 IENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMM 904

Query: 806 HGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKF 858
           HGTMKLES+VGVGSKF FT+PL QT+EI F   E  FEDEFN  S+KNR VKF
Sbjct: 905 HGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKF 957

 Score =  390 bits (1001), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 192/363 (52%), Positives = 251/363 (69%)

Query: 13  PYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQTI 72
           P+++ +RTQLT LV  V           TGVYFT NY++LR  +LYIAA+LKSSQIDQT+
Sbjct: 14  PFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTL 73

Query: 73  NLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDSQF 132
           N LYYQ  +L  RD ++S+LT Y AGN+SA+NW  +  V+  FL SS +F    +YDS F
Sbjct: 74  NYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSSF 133

Query: 133 XXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSLPI 192
                       D IP+DVL  L PLS    LPS L T G+LTDPVLN + YLMSMSLPI
Sbjct: 134 NAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLPI 193

Query: 193 IANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYHFV 252
            ANPS+ L+DSRV+GY+T++MSAE +++V NDTTALE S +A+IS+   +      YHFV
Sbjct: 194 FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHFV 253

Query: 253 FPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLANW 312
           FPP+G+  D+    + ++N TF+S AF + +GGS+ ++  L ++  A+GY PCSF L NW
Sbjct: 254 FPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVNW 313

Query: 313 VGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVISK 372
           V  VSQPE VF+S + KL KII GTVIAI VFV ++T PL+ W+VQPIVRLQKATE+I++
Sbjct: 314 VAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373

Query: 373 RDG 375
             G
Sbjct: 374 GRG 376

 Score =  188 bits (477), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%), Gaps = 3/134 (2%)

Query: 909  SIKYDVKN---FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGE 965
            ++K D KN    K+L+VEDN VNQ V+ RML LEGIEN  +ACDGQEA +K+KE+ S+GE
Sbjct: 1077 TVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGE 1136

Query: 966  YYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKP 1025
             Y ++ MD+QMPKVDG+ +TK+IR++L Y  PIVALTAFADDSNI+ C +SGM+GFL+KP
Sbjct: 1137 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKP 1196

Query: 1026 IKREQLKGILTEFC 1039
            IKR +LK ILTEFC
Sbjct: 1197 IKRPKLKTILTEFC 1210

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  484 bits (1245), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 261/474 (55%), Positives = 337/474 (71%), Gaps = 47/474 (9%)

Query: 431 KENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEY 490
           + N TD SSS S  +    NL + ++P  +R   DELS+LTET+  MTDALD+H  LLE 
Sbjct: 485 RNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLED 544

Query: 491 RVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSS 550
           RV+ RTKQLEAAKIEAE+ANEAKTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I+++
Sbjct: 545 RVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNN 604

Query: 551 LKLIYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKL 610
           LKLI+RSG            FSKNVL++TKLE+  FC+ D+ALQI+SIFGK++KDQ V+L
Sbjct: 605 LKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRL 664

Query: 611 SIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAE 670
           SI + PN +R+MVLWGD NRI+Q++MNLVSNALKFTPVDG + V +KLLGEYDKD S   
Sbjct: 665 SISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKR 724

Query: 671 NYKDVYMK---------------EIRNSNGDKI-----KPLMTLISSKDTMSVADNISNK 710
            +K+V++K               ++  S G +          ++ S +D  ++ + I+ +
Sbjct: 725 QFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKR 784

Query: 711 SVAS---------DTERSTN---------------NTIYSNKFKNGSNFQDTDDA--IGV 744
           + A+         D E+S+N               + I++++F N +   D+D++  +G 
Sbjct: 785 NTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQF-NKALDSDSDESGNVGR 843

Query: 745 PLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANL 804
           P++  + WVIS+EVEDTGPGIEPSLQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQLAN+
Sbjct: 844 PIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANM 903

Query: 805 MHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKF 858
           MHGTMKLES+VGVGSKF FT+PL QT+EI F   E  FEDEFN  SKKNR VKF
Sbjct: 904 MHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKF 957

 Score =  394 bits (1011), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 195/363 (53%), Positives = 255/363 (70%)

Query: 13  PYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAARLKSSQIDQTI 72
           P+++ +R QLT LV  V           TGVYFT NY++LR  +LYIAA+LKSSQ+DQT+
Sbjct: 14  PFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQTL 73

Query: 73  NLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDSQF 132
           N LYYQ  +L  RD ++S+LT Y AGN+S +NW  +  V+  FL SS +F    +YDS F
Sbjct: 74  NYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSSF 133

Query: 133 XXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSLPI 192
                       D IP+DVL +L PLS    LPS L TTG+LTDP++N++ YLMSMSLPI
Sbjct: 134 TTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLPI 193

Query: 193 IANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYHFV 252
            ANPS+ L+DSRV+GY+T+VMSAE +++V NDTTALEKS VA+IS+T         YHFV
Sbjct: 194 FANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHFV 253

Query: 253 FPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLANW 312
           FPP+G    I    +P+EN+TF+S  F + +GGS+ K+ +  +K +A+GY PCSF L NW
Sbjct: 254 FPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLVNW 313

Query: 313 VGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVISK 372
           V  VSQPE VF+S + KLTKIIAGTVIAI VFV ++T PL+ W+V+PIVRLQKATE+I++
Sbjct: 314 VAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELITE 373

Query: 373 RDG 375
             G
Sbjct: 374 GRG 376

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 104/127 (81%)

Query: 913  DVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLM 972
            D  + K+L+VEDN VNQ V+ RML LEGI+N  +ACDGQEA +K+KE+ S+GE Y ++ M
Sbjct: 1085 DGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFM 1144

Query: 973  DIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLK 1032
            D+QMPKVDG+ +TK+IR++L Y  PIVALTAFADDSNI+ C +SGM+GFL+KPIKR +L 
Sbjct: 1145 DVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLN 1204

Query: 1033 GILTEFC 1039
             IL+EFC
Sbjct: 1205 TILSEFC 1211

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  468 bits (1204), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 251/454 (55%), Positives = 323/454 (71%), Gaps = 45/454 (9%)

Query: 450 NLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESA 509
           NL + ++P  RR   DELS+LTET+  MTDALD+H  LLE RV+ RTKQLEAAKIEAE+A
Sbjct: 504 NLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAA 563

Query: 510 NEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGXXXXXXXXXXX 569
           NEAKTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I++SLKLI+RSG           
Sbjct: 564 NEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELL 623

Query: 570 XFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQN 629
            FSKNVL++TKLEK  FC+ D+ALQI+SIFGK++KDQ V+LSI + PN +R+MVLWGD N
Sbjct: 624 TFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDSN 683

Query: 630 RILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK-------EIRN 682
           RI+Q++MNLVSNALKFTPVDG + V +KLLGEYDK+ S  + +K+V+++       +I N
Sbjct: 684 RIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIGN 743

Query: 683 SNG-------------DKIKPLMTLISSKDTMSVADNISNKSVAS---------DTERST 720
            N              D      ++ S++DT ++ + I+ ++ A+         D E+S+
Sbjct: 744 INKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEEITKRNTAANENIYKKTRDREKSS 803

Query: 721 N---------------NTIYSNKFKNGSNFQDTDDA-IGVPLDKKRKWVISVEVEDTGPG 764
           N               + I++++F       D +   +G P++  + W IS+EVEDTGPG
Sbjct: 804 NDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGDLGKPIENPKTWAISIEVEDTGPG 863

Query: 765 IEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFT 824
           I+PSLQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLAN+MHGTMKLES+VGVGSKF FT
Sbjct: 864 IDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFT 923

Query: 825 VPLLQTREIEFNGNELVFEDEFNINSKKNREVKF 858
           +PL QT+EI F      FEDEFN  S++NR VKF
Sbjct: 924 LPLHQTKEISFANMNFPFEDEFNPESRQNRRVKF 957

 Score =  401 bits (1030), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/374 (52%), Positives = 259/374 (69%)

Query: 2   LRACNVSIWKAPYKVKLRTQLTTLVCFVXXXXXXXXXXXTGVYFTKNYRDLRLQQLYIAA 61
            R  + S++  P+++ +R QLT LV  V           TGVYFT NY++LR  +LYIAA
Sbjct: 3   FRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 62  RLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVV 121
           +LKSSQIDQT+N LYYQ  +L  RD ++++LT Y AGN+S++NW  +  ++  FL SS +
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNL 122

Query: 122 FLTTTLYDSQFXXXXXXXXXXXXDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLND 181
           F    +YDS F            D IP D+   L PLS   +LPS L TTG+LTDP+LN 
Sbjct: 123 FFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNS 182

Query: 182 STYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNT 241
           + YLMSMSLPI ANPS+ L+DSRV+GY+T++MSAE +++V NDTTALEKS VA+IS+   
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYN 242

Query: 242 NGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301
           N +    YHFVFPP+G S  I  T +P++N+TF+S AF + +GGS+ K+ S   K +A+G
Sbjct: 243 NQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALG 302

Query: 302 YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361
           Y PCSF L NWV  VSQPE VF+S S KL KII GTVIAI VFV ++T PL+ W+VQPIV
Sbjct: 303 YSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362

Query: 362 RLQKATEVISKRDG 375
           RLQKATE+I++  G
Sbjct: 363 RLQKATELITEGRG 376

 Score =  186 bits (471), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (80%), Gaps = 1/134 (0%)

Query: 906  MGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGE 965
            + NS K D  + K+L+VEDN VNQ V+ RML LEGIEN  +ACDGQ+A +K+KE+ SRGE
Sbjct: 1079 VSNSDKSD-SSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGE 1137

Query: 966  YYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKP 1025
             Y ++ MD+QMPKVDG+ +TK+IR++L Y  PIVALTAFADDSNI+ C +SGM+GFL+KP
Sbjct: 1138 SYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKP 1197

Query: 1026 IKREQLKGILTEFC 1039
            IKR +LK IL EFC
Sbjct: 1198 IKRPKLKTILIEFC 1211

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  464 bits (1194), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/468 (55%), Positives = 336/468 (71%), Gaps = 44/468 (9%)

Query: 434 ITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVK 493
            + + SSN+    M   + + +VP  RR   DELSELT+T+  M+DALD+H  LLE RV+
Sbjct: 458 FSSHKSSNTPPPPM-STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVR 516

Query: 494 ERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKL 553
            RTKQLEAAKIEAE+ANEAKTVFIAN++HELRTPLNGILGMTAI+MEE D++ I+SSLKL
Sbjct: 517 ARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKL 576

Query: 554 IYRSGXXXXXXXXXXXXFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIF 613
           I+RSG            FSKNVL++TKLE+  FC+ D+ALQI+SIFGK++KDQHVKLSI+
Sbjct: 577 IFRSGELLLHILTELLTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIY 636

Query: 614 ILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYK 673
           ++PN++R++VLWGD NRI+Q++MNLVSNALKFTP+DGK++V + LLGEYDK++S A +YK
Sbjct: 637 LIPNEIRTLVLWGDSNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYK 696

Query: 674 DVYMK---EIRNSNGDKIKPLMT--LISSKDTMSV-------------ADNISNKSVASD 715
           +V++K   E   +    ++ L T  LI+++   S               D ISN   +S+
Sbjct: 697 EVFVKTGTEPEENYSKILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSN 756

Query: 716 T--ERSTNN-------------------TIYSNKFKNGSNFQDTDDA-IGVPLDKKRKWV 753
           T  + S +N                   T+++++FK  +  QD D+  +GV + + + WV
Sbjct: 757 TTFDISIHNRTRDDTLSLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWV 816

Query: 754 ISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLES 813
           I +EVEDTGPGI P+LQ+SVFEPFVQGDQ LSRQYGGTGLGLSICRQLA +M+GTM LES
Sbjct: 817 ICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLES 876

Query: 814 EVGVGSKFIFTVPLLQTREIEFNGNELV---FEDEFNINSKKNREVKF 858
           +VG GSKF FTVPL QTREI    +E +   F+DEFNI SKKNR+VKF
Sbjct: 877 KVGSGSKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKF 924

 Score =  169 bits (428), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 96/126 (76%), Gaps = 5/126 (3%)

Query: 920  LIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQS-----RGEYYGLVLMDI 974
            L+ EDN VNQ V+ RMLKLE + N  +ACDG+EA  K+KEI S     +  YY L+ MD+
Sbjct: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
            QMP++DG+ +TK+IR ELKY KPIVALTAFAD+SNI+ C   GMDGFL+KPIKR +LK I
Sbjct: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192

Query: 1035 LTEFCP 1040
            L EFCP
Sbjct: 1193 LNEFCP 1198

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 81/161 (50%), Gaps = 11/161 (6%)

Query: 881  GKCTEPKKSTESESQAVVPSKSS---QEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLK 937
            G    P  ST S     +P ++S      GN++    K F +L+VED+ V+  +  + L+
Sbjct: 340  GNNASPTTSTVSLQMPNLPDENSLTPNAQGNAVTLR-KGFHVLLVEDDAVSIQLCSKFLR 398

Query: 938  LEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKP 997
              G     +  DG  A+  +++ +     Y LVLMDI MP +DG TAT I+R     + P
Sbjct: 399  KYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVR-SFDNETP 451

Query: 998  IVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEF 1038
            I+A+T    + ++    + GM+  LAKP  R+ L  IL  +
Sbjct: 452  IIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 492

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 73/140 (52%), Gaps = 10/140 (7%)

Query: 899  PSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIK 958
            PSK       S++     F +L+VED+ V   +  + L+  G  +  +  DG  A+E ++
Sbjct: 303  PSKEEANPPTSLR---PGFHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVE 358

Query: 959  EIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGM 1018
            + Q     Y LVLMDI MP +DG TAT +IR       PI+A+T   +D ++    + GM
Sbjct: 359  KFQ-----YDLVLMDIVMPNLDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGM 412

Query: 1019 DGFLAKPIKREQLKGILTEF 1038
            +  LAKP  ++ L  +L  +
Sbjct: 413  NDILAKPFTKDDLHSMLVRY 432

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 65/121 (53%), Gaps = 7/121 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED+ V+  +  + L+  G     +  DG  A+  +++ +     Y LVLMDI
Sbjct: 403  KGFHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEKFR-----YDLVLMDI 456

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT I+R       PI+A+T   +D ++    + GM+  LAKP  R  L  I
Sbjct: 457  VMPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSI 515

Query: 1035 L 1035
            L
Sbjct: 516  L 516

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 67/124 (54%), Gaps = 7/124 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED+ ++  +  + L+  G     +  DG  A+  +++ +     Y LVLMDI
Sbjct: 351  KGFHVLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDI 404

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT IIR       PI+A+T   +D ++    + GM+  LAKP  R+ L  +
Sbjct: 405  VMPNLDGATATSIIR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSM 463

Query: 1035 LTEF 1038
            L  +
Sbjct: 464  LIRY 467

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 7/124 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED+ ++  +  + L+  G     +  DG  A+  ++   SR   Y LVLMDI
Sbjct: 401  KGFHVLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLEN--SR---YDLVLMDI 454

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT IIR       PI+A+T   DD ++    + GM+  LAKP  R+ L  +
Sbjct: 455  VMPNLDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSM 513

Query: 1035 LTEF 1038
            L  +
Sbjct: 514  LIRY 517

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976
            F +L+VED+ V   +  + L+  G  +  +  DG  A+E +++ Q     Y LVLMDI M
Sbjct: 329  FCVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKFQ-----YDLVLMDIVM 382

Query: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            P +DG TAT +IR       PI+A+T   +D ++    + GM+  LAKP  ++ L  +L 
Sbjct: 383  PNLDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1037 EF 1038
             +
Sbjct: 442  RY 443

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 67/124 (54%), Gaps = 7/124 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED+ V+  +  + L+  G     +  DG  A+  +++ +     Y LVLMDI
Sbjct: 377  KGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDI 430

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT I+R     + PI+A+T    + ++    + GM+  LAKP  R+ L  I
Sbjct: 431  VMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSI 489

Query: 1035 LTEF 1038
            L  +
Sbjct: 490  LIRY 493

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 67/124 (54%), Gaps = 7/124 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED+ V+  +  + L+  G     +  DG  A+  +++ +     Y LVLMDI
Sbjct: 375  KGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLSAISTLEKYR-----YDLVLMDI 428

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT I+R     + PI+A+T    + ++    + GM+  LAKP  R+ L  I
Sbjct: 429  VMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSI 487

Query: 1035 LTEF 1038
            L  +
Sbjct: 488  LIRY 491

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 67/124 (54%), Gaps = 7/124 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED+ V+  +  + L+  G     +  DG  A+  +++ +     Y LVLMDI
Sbjct: 377  KGFHVLLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDI 430

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT I+R     + PI+A+T    + ++    + GM+  LAKP  R+ L  I
Sbjct: 431  VMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSI 489

Query: 1035 LTEF 1038
            L  +
Sbjct: 490  LIRY 493

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 66/122 (54%), Gaps = 7/122 (5%)

Query: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976
            F +L+VED+ V+  +  + L+  G     +  DG  A+  +++ +     Y LVLMDI M
Sbjct: 381  FHVLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 434

Query: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            P +DG TAT IIR       PI+A+T   +D ++    + GM+  LAKP  ++ L  +L 
Sbjct: 435  PNLDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1037 EF 1038
             +
Sbjct: 494  RY 495

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 67/123 (54%), Gaps = 11/123 (8%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K + +L+VED+ V+  +  + L+  G     +  DG  A+  ++  +     Y LVLMDI
Sbjct: 422  KGYHVLLVEDDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISILEAFR-----YDLVLMDI 475

Query: 975  QMPKVDGITATKIIRQELKYDK--PIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLK 1032
             MP +DG TAT IIR    +DK  PI+A+T   +D ++    + GM   LAKP  R+ L 
Sbjct: 476  VMPNLDGATATSIIR---NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLL 532

Query: 1033 GIL 1035
             +L
Sbjct: 533  SML 535

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976
            F +L+VED+ V   +  + L+  G  +  +  DG  A+  +++     + + LVLMDI M
Sbjct: 329  FHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAISTLEK-----QRFDLVLMDIVM 382

Query: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            P +DG TAT I+R     + PI+A+T   DD ++    + GM+  LAKP  ++ L  +L 
Sbjct: 383  PNLDGATATSIVR-SFDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1037 EF 1038
             +
Sbjct: 442  RY 443

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976
            F +L+VED+ V   +  + L+  G     +  DG  A+  +++ +     Y LVLMDI M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAISTLEKFR-----YDLVLMDIVM 429

Query: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            P +DG TAT I+R       PI+A+T   +D ++    + GM+  LAKP  ++ L  +L 
Sbjct: 430  PNLDGATATSIVR-SFDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 488

Query: 1037 EF 1038
             +
Sbjct: 489  RY 490

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976
            F +L+VED+ V   +  + L+  G     +  DG  A+  +++ +     Y LVLMDI M
Sbjct: 334  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 387

Query: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            P +DG TAT I+R       PI+A+T   +D ++    + GM+  LAKP  ++ L  +L 
Sbjct: 388  PNLDGATATSIVR-SFDNHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 446

Query: 1037 EF 1038
             +
Sbjct: 447  RY 448

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976
            F +L+VED+ V   +  + L   G  +  +  DG  A+  +++ +     Y LVLMDI M
Sbjct: 307  FHVLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 360

Query: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            P +DG TAT I+R       PI+A+T   +D ++    + GM+  LAKP  ++ L  +L 
Sbjct: 361  PNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLI 419

Query: 1037 EF 1038
             +
Sbjct: 420  RY 421

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 66/124 (53%), Gaps = 7/124 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED+ V+  +  + L+  G     +  DG  A+  +++ +     + LVLMDI
Sbjct: 380  KGFHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAAISILEKFR-----FDLVLMDI 433

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT IIR       PI+A+T   +  ++    + GM+  LAKP  R+ L  I
Sbjct: 434  VMPNLDGATATSIIRN-FDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSI 492

Query: 1035 LTEF 1038
            L  +
Sbjct: 493  LIRY 496

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 67/124 (54%), Gaps = 7/124 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED++V+  +  + L   G     +  DG  A+  +++ +     + LVLMDI
Sbjct: 348  KGFNVLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAISTLEKYR-----FDLVLMDI 401

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT IIR     + PI+A+T   +  ++    + GM+  LAKP  R  L  +
Sbjct: 402  VMPNLDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSM 460

Query: 1035 LTEF 1038
            LT +
Sbjct: 461  LTRY 464

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 7/124 (5%)

Query: 915  KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDI 974
            K F +L+VED++V   +  + L+  G     +  DG  A+  ++        + LVLMDI
Sbjct: 414  KGFHVLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAISVLEN-----HRFDLVLMDI 467

Query: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034
             MP +DG TAT I+R    Y  PI+A+T   +D ++    + GM+  LAKP  +  L  +
Sbjct: 468  VMPNLDGATATSIVRNFDNY-TPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSM 526

Query: 1035 LTEF 1038
            L  +
Sbjct: 527  LVRY 530

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976
            F +L+VED+ +   +  + L   G     +  DG  A+  +++ +     Y LVLMDI M
Sbjct: 305  FHVLLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVM 358

Query: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            P +DG TAT I+R       PI+A+T   +D ++    + GM+  LAKP  ++ L  +L 
Sbjct: 359  PNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 417

Query: 1037 EF 1038
             +
Sbjct: 418  RY 419

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 35/153 (22%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ +++  LK   I ++ IA +G EAVEK ++    G  + L+LMD+Q+P 
Sbjct: 551  VLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVEKWRQ----GGIH-LILMDLQLPL 604

Query: 979  VDGITATKIIRQELKYD----------KP------------------IVALTAFADDSNI 1010
            + G+ ATK IR   K +          KP                  IVALTAF+  ++ 
Sbjct: 605  LSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADR 664

Query: 1011 QACYKSGMDGFLAKPIKREQLKGILTEF-CPKA 1042
            +    +G + +L KP+  + L   +TE+ C +A
Sbjct: 665  REALVAGCNDYLTKPVNLDWLSSKITEWGCMQA 697

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
           similar to uniprot|Q07084 Saccharomyces cerevisiae
           YLR006C SSK1 Cytoplasmic response regulator part of a
           two-component signal transducer that mediates
           osmosensing via a phosphorelay mechanism
           dephosphorylated form is degraded by the
           ubiquitin-proteasome system potential Cdc28p substrate
          Length = 635

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 58/98 (59%), Gaps = 9/98 (9%)

Query: 894 SQAVVPSKSSQEMGNSIKYDV-KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQE 952
           S+   PS   Q  GN  KY V     +LIVEDN +NQ ++   L+  GI ++ +A DG E
Sbjct: 372 SRRTTPSLDKQ--GNLPKYKVFPRINVLIVEDNAINQAILALFLRKNGI-SYKVAKDGVE 428

Query: 953 AVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQ 990
           A+EK KE  S      L+LMD+Q+P + G+ ATK IR+
Sbjct: 429 AIEKWKEGDSH-----LILMDLQLPLLSGLEATKKIRE 461

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 65/123 (52%), Gaps = 9/123 (7%)

Query: 917  FKLLIVEDNKVN-QLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQ 975
            F +L+VED+ +  QL    ++K        +  DG  A+  +++ +     + LVLMDI 
Sbjct: 302  FHVLLVEDDSICIQLCSKFLMKYACT--VEVVTDGLSAISTLEKFR-----FDLVLMDIV 354

Query: 976  MPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGIL 1035
            MP +DG TAT I+R       PI+A+T   +D ++    + GM+  LAKP  ++ L  +L
Sbjct: 355  MPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 413

Query: 1036 TEF 1038
              +
Sbjct: 414  IRY 416

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (55%), Gaps = 14/131 (10%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +G+EAVE  K     G  + L+ MD+Q+P 
Sbjct: 477  VLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAVEMWK----NGGLH-LIFMDLQLPV 530

Query: 979  VDGITATKIIRQELKYDKP------IVALTAFADDSNIQACYKSGMDGFLAKPIKREQLK 1032
            + GI A K IR + + ++P      IVALTA     + +    SG + +L KP+    L 
Sbjct: 531  LSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWLS 589

Query: 1033 GILTEF-CPKA 1042
              +TE+ C +A
Sbjct: 590  KKITEWGCMQA 600

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (50%), Gaps = 34/148 (22%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ IA +G EAVEK +    +G  + L+LMD+Q+P 
Sbjct: 511  VLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKWR----KGGIH-LILMDLQLPL 564

Query: 979  VDGITATKIIR-------------------QE-------LKYDKP--IVALTAFADDSNI 1010
            + GI A K IR                   QE        K+  P  IVALTAF+  ++ 
Sbjct: 565  LSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHADR 624

Query: 1011 QACYKSGMDGFLAKPIKREQLKGILTEF 1038
                 +G + +L KP+  + L   +TE+
Sbjct: 625  NEALVAGCNDYLTKPVNLDWLSNKITEW 652

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 112/237 (47%), Gaps = 50/237 (21%)

Query: 848  INSKKNREVKFQE--ITDEVDQVNIEGNSGVEVEPGKCTEPKKSTESESQAVVPS----- 900
            IN   N  V+ ++  I++ ++ V  E N  +  +PG  T  K  T S S    PS     
Sbjct: 391  INKATNDMVQSEQDIISNNIENV-YETNENINQQPGDQTL-KNRTNSSSNFKDPSFNSLS 448

Query: 901  KSSQEMGNSIKYDVK------NFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAV 954
             S+ +M + I++         N  +LIVEDN +NQ ++   L+   I ++ IA +G+EAV
Sbjct: 449  YSTDKMISPIEFKFNSEKVFPNITVLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAV 507

Query: 955  EKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIR--QELK------------------- 993
            EK KE    G  + L+ MD+Q+P + GI A K IR  ++LK                   
Sbjct: 508  EKWKE----GGIH-LIFMDLQLPVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVES 562

Query: 994  YDKPI-------VALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEF-CPKA 1042
             +KP+       VA TA    ++ +    SG + +L KP+    L   +TE+ C +A
Sbjct: 563  VEKPVLGAPVIMVAFTASNSLTDKREALVSGCNDYLTKPVNLHWLSKKITEWGCMQA 619

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 72/132 (54%), Gaps = 14/132 (10%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +G+EAV+  KE    G  + L+ MD+Q+P 
Sbjct: 519  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE----GGLH-LIFMDLQLPV 572

Query: 979  VDGITATKIIR-----QELKYDKP--IVALTAFADDSNIQACYKSGMDGFLAKPIKREQL 1031
            + GI A K IR     +    + P  IVALTA     + +    SG + +L KP+    L
Sbjct: 573  LSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLHWL 632

Query: 1032 KGILTEF-CPKA 1042
               +TE+ C +A
Sbjct: 633  SKKITEWGCMQA 644

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 34/152 (22%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I  + IA +G+EAV+K KE    G  + L+ MD+Q+P 
Sbjct: 465  VLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWKE----GNLH-LIFMDLQLPV 518

Query: 979  VDGITATKIIR----------QELKYDKP-----------------IVALTAFADDSNIQ 1011
            + GI A K IR          Q  +   P                 IVALTA     + +
Sbjct: 519  LSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQEDKR 578

Query: 1012 ACYKSGMDGFLAKPIKREQLKGILTEF-CPKA 1042
                SG + +L KP+    L   +TE+ C +A
Sbjct: 579  EALISGCNDYLTKPVNLLWLSKKITEWGCMQA 610

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 75/144 (52%), Gaps = 26/144 (18%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +G+EAV+  KE    G  + L+ MD+Q+P 
Sbjct: 547  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE----GGLH-LIFMDLQLPV 600

Query: 979  VDGITATKIIR----------QE----LKYDKP-----IVALTAFADDSNIQACYKSGMD 1019
            + GI A + IR          QE    LK +K      IVALTA     + +    SG +
Sbjct: 601  LSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISGCN 660

Query: 1020 GFLAKPIKREQLKGILTEF-CPKA 1042
             +L KP+    L   +TE+ C +A
Sbjct: 661  DYLTKPVNLHWLSKKITEWGCMQA 684

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 73/143 (51%), Gaps = 29/143 (20%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +L+VEDN +NQ ++   L+   I ++ +A +G EAV++ KE    G  + L+LMD++MP 
Sbjct: 421  VLVVEDNMINQTILSSFLRKHKI-SYKVAKNGIEAVDRWKE----GGMH-LILMDLEMPL 474

Query: 979  VDGITATKIIRQELKYD-----KP------------------IVALTAFADDSNIQACYK 1015
            + GI A K IR+  K +     KP                  IVALTA    S+      
Sbjct: 475  LSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTEALL 534

Query: 1016 SGMDGFLAKPIKREQLKGILTEF 1038
            +G + +L KP+  + L   +TE+
Sbjct: 535  AGCNDYLTKPVNLDWLTRKITEW 557

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 72/150 (48%), Gaps = 36/150 (24%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +G+EAV+K KE    G  + L+ MD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWKE----GGLH-LIFMDLQLPV 566

Query: 979  VDGITATKIIRQELKY-----------------------DKP-------IVALTAFADDS 1008
            + GI A K IR+  K+                       DK        IVA TA    +
Sbjct: 567  LSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLT 626

Query: 1009 NIQACYKSGMDGFLAKPIKREQLKGILTEF 1038
            + +    SG + +L KP+    L   +TE+
Sbjct: 627  DKREALISGCNDYLTKPVNLHWLSKKITEW 656

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 28/142 (19%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +L+VEDN +NQ ++   L+   I ++ +A +G EAV++ KE    G  + L+LMD++MP 
Sbjct: 408  VLVVEDNMINQAILSSFLRKHKI-HYKVAKNGVEAVDRWKE----GGMH-LILMDLEMPL 461

Query: 979  VDGITATKIIRQ-----------------ELK---YDKP--IVALTAFADDSNIQACYKS 1016
            + GI A K IR+                 ELK      P  IVALTA    ++      +
Sbjct: 462  LSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEALLA 521

Query: 1017 GMDGFLAKPIKREQLKGILTEF 1038
            G + +L KP+  + L   +TE+
Sbjct: 522  GCNDYLTKPVNLDWLTRKITEW 543

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 65/140 (46%), Gaps = 26/140 (18%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   LK   I ++ +A +GQEAV++ KE         L+ MD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRWKE-----GGIDLIFMDLQLPV 556

Query: 979  VDGITATKIIRQELKYDKP--------------------IVALTAFADDSNIQACYKSGM 1018
              G+ A K IR   K +                      IVA TA    ++ +    SG 
Sbjct: 557  FSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGC 616

Query: 1019 DGFLAKPIKREQLKGILTEF 1038
            + +L KP+    L   + E+
Sbjct: 617  NDYLTKPVNLHWLSKKINEW 636

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 68/147 (46%), Gaps = 33/147 (22%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +GQEAV   KE    G  + L+ MD+Q+P 
Sbjct: 488  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE----GGLH-LIFMDLQLPV 541

Query: 979  VDGITATKIIR-----------QELKYDKP----------------IVALTAFADDSNIQ 1011
            + GI A K IR           + L    P                IVALTA     + +
Sbjct: 542  LSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKR 601

Query: 1012 ACYKSGMDGFLAKPIKREQLKGILTEF 1038
                SG + +L KP+    L   +TE+
Sbjct: 602  KALVSGCNDYLTKPVNLHWLSKKITEW 628

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
           similar to uniprot|Q07084 Saccharomyces cerevisiae
           YLR006C SSK1 Cytoplasmic response regulator part of a
           two-component signal transducer that mediates
           osmosensing via a phosphorelay mechanism
           dephosphorylated form is degraded by the
           ubiquitin-proteasome system potential Cdc28p substrate
          Length = 738

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 58/99 (58%), Gaps = 6/99 (6%)

Query: 891 ESESQAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDG 950
           + +SQ   P  + +   N+ +       +LIVEDN +NQ ++   L+   I ++ +A +G
Sbjct: 436 QRQSQLPSPDTTKKNTKNTRENVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNG 494

Query: 951 QEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIR 989
           +EAV+K K+    G  + L+L+D+Q+P + GI ATK IR
Sbjct: 495 REAVDKWKQ----GGIH-LILLDLQLPILSGIEATKEIR 528

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 69/147 (46%), Gaps = 33/147 (22%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +GQEAV   KE    G  + L+ MD+Q+P 
Sbjct: 495  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE----GGLH-LIFMDLQLPV 548

Query: 979  VDGITATKIIRQELK----------------YDKP-----------IVALTAFADDSNIQ 1011
            + GI A K IR   K                +DK            IVALTA     + +
Sbjct: 549  LSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMDKR 608

Query: 1012 ACYKSGMDGFLAKPIKREQLKGILTEF 1038
                SG + +L KP+    L   +TE+
Sbjct: 609  KALLSGCNDYLTKPVNLHWLSKKITEW 635

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 71/152 (46%), Gaps = 34/152 (22%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +GQEAV   KE    G  + L+ MD+Q+P 
Sbjct: 506  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE----GGLH-LIFMDLQLPV 559

Query: 979  VDGITATKIIRQELKYD-------------------------KP--IVALTAFADDSNIQ 1011
            + GI A K IR   K +                          P  IVALTA     + +
Sbjct: 560  LSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKR 619

Query: 1012 ACYKSGMDGFLAKPIKREQLKGILTEF-CPKA 1042
                SG + +L KP+    L   +TE+ C +A
Sbjct: 620  KALLSGCNDYLTKPVNLHWLSKKITEWGCMQA 651

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 71/152 (46%), Gaps = 34/152 (22%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +GQEAV   KE    G  + L+ MD+Q+P 
Sbjct: 505  VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE----GGLH-LIFMDLQLPV 558

Query: 979  VDGITATKIIRQ----------------ELKYDKP-----------IVALTAFADDSNIQ 1011
            + GI A K IR                    ++K            IVALTA     + +
Sbjct: 559  LSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMDKR 618

Query: 1012 ACYKSGMDGFLAKPIKREQLKGILTEF-CPKA 1042
                SG + +L KP+    L   +TE+ C +A
Sbjct: 619  KALLSGCNDYLTKPVNLHWLSKKITEWGCMQA 650

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 70/153 (45%), Gaps = 42/153 (27%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I  + +A +G+EAV+K KE    G  + L+ MD+Q+P 
Sbjct: 567  ILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKE----GGIH-LIFMDLQLPV 620

Query: 979  VDGITATKIIRQELKYDKP---------------------------------IVALTAFA 1005
            + G  A K IRQ   Y+K                                  IVA TA  
Sbjct: 621  LSGTDAAKEIRQ---YEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASN 677

Query: 1006 DDSNIQACYKSGMDGFLAKPIKREQLKGILTEF 1038
              ++ +A   +G + +L KP+    L   +TE+
Sbjct: 678  SLADKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 72/148 (48%), Gaps = 30/148 (20%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I ++ +A +G+EAV+  KE    G  + L+ MD+Q+P 
Sbjct: 672  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE----GGLH-LIFMDLQLPV 725

Query: 979  VDGITATKIIR----------QELKYDKP-------------IVALTAFADDSNIQACYK 1015
            + GI A + IR          QE    +              IVALTA     + +    
Sbjct: 726  LSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKALL 785

Query: 1016 SGMDGFLAKPIKREQLKGILTEF-CPKA 1042
            SG + +L KP+    L   +TE+ C +A
Sbjct: 786  SGCNDYLTKPVNLHWLSKKITEWGCMQA 813

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 72/151 (47%), Gaps = 33/151 (21%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +LIVEDN +NQ ++   L+   I  + +A +GQEA++  +E    G  + L+ MD+Q+P 
Sbjct: 567  VLIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAIDVWRE----GGIH-LIFMDLQLPV 620

Query: 979  VDGITATKIIRQ------------------------ELKYDKP--IVALTAFADDSNIQA 1012
            + GI A K IR+                        + + + P  IVA TA    S+ + 
Sbjct: 621  LSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKE 680

Query: 1013 CYKSGMDGFLAKPIKREQLKGILTEF-CPKA 1042
               SG + +L KP+    L   + E+ C +A
Sbjct: 681  ALISGCNDYLTKPVNLHWLSNKINEWGCMQA 711

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 947  ACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQ--ELKYDKPIVALTAF 1004
            A +G+E V +     + G  + L++  +++PK+  I   K+IR    +    PIVALT +
Sbjct: 1468 AGNGEELVRR----ATTGVKFDLIITAMKLPKLGAIDIAKLIRHTNSVNCTTPIVALTVY 1523

Query: 1005 ADDSNIQACYKSGMDGFLAKPIKREQLKGILTEFC 1039
              D+     +    D  L KP+  EQL+ +++++ 
Sbjct: 1524 YHDAKESKVF----DDVLEKPVSVEQLRKLVSKYA 1554

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 916  NFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQ 975
            N  +L+ E   +++  + R L+  G     +   G E V +     + G  + L++  ++
Sbjct: 1437 NMDVLLCEPIPIHRYRLTRDLESLGCSVVAVGT-GDEIVRRA----TSGVRFDLIITTLK 1491

Query: 976  MPKVDGITATKIIRQ--ELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKG 1033
            +PK+  +  T+++RQ   +    PIVA+T    D+          D  L +PI  EQL+ 
Sbjct: 1492 LPKIGAVDITRLLRQTTSINCTTPIVAVTVNYHDAGTHI-----FDDVLERPIGTEQLRK 1546

Query: 1034 ILTEFC 1039
            +++++ 
Sbjct: 1547 LVSKYA 1552

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 754 ISVEVEDTGPGIEPSLQKSVFE-------------PFVQGDQTLSR--QYGGTGLGLSIC 798
           +S+ V D G GI P  +  + +             P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 799 RQLANLMHGTMKLESEVGVGS 819
           R  A L  G++ ++S  G+G+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 754 ISVEVEDTGPGIEPSLQKSVFEPFV------QGDQTLS---------RQYGGTGLGLSIC 798
           + + + D G GI+P ++  VF+         + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 799 RQLANLMHGTMKLESEVGVGS 819
           +    L +GT+ ++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>CAGL0B00792g Chr2 complement(70860..72197) [1338 bp, 445 aa] {ON}
           similar to uniprot|P25567 Saccharomyces cerevisiae
           YCL037c SRO9 La motif-containing proteins that modulate
           mRNA translation
          Length = 445

 Score = 35.8 bits (81), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 20/102 (19%)

Query: 581 LEKTHFCVIDLALQIESIFG------------KISKDQHVKLSIFILPNKLRSMVLWGDQ 628
           L+     + ++A QIE  F             K+SKD +  L +     +L +M   GDQ
Sbjct: 258 LQPAMMAINNVARQIEYYFSADNMNKDEFLKTKLSKDGYAPLELISKFYRLVNMSFGGDQ 317

Query: 629 NRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAE 670
           N IL  +  +V+NA        + TV + + GE   +   AE
Sbjct: 318 NIILAALREIVNNA--------EATVEVAIAGEQSSETEQAE 351

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 63/128 (49%), Gaps = 11/128 (8%)

Query: 916  NFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQ 975
            +  +L+ E   +++  V + L+  G    ++   G E V +     + G  + L++  ++
Sbjct: 1634 HMDVLVCEPIPIHRYRVTKDLENLGCTVVSVGA-GDELVSRA----TSGVSFDLIMTALK 1688

Query: 976  MPKVDGITATKIIRQELKYDK--PIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKG 1033
            +PK+  I   ++++Q    +   PIVA+T +  ++     +    D  L KP+K ++LK 
Sbjct: 1689 LPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAATSRVF----DDVLEKPVKLDELKK 1744

Query: 1034 ILTEFCPK 1041
            ++ ++  K
Sbjct: 1745 LVAKYALK 1752

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 11/125 (8%)

Query: 919  LLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPK 978
            +L+ E   +++  V R L+  G    ++   G E V +     + G  + L++  +++PK
Sbjct: 1544 ILVCEPIPIHRYRVTRDLESVGCTVVSVGA-GDELVSRA----NSGVKFDLIVTALKLPK 1598

Query: 979  VDGITATKIIRQE--LKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036
            +  I   K+I+    +    PI+A+T F      +A      D  L KPI  ++++ ++ 
Sbjct: 1599 LGAIDIVKLIKHTNGINSRTPIIAITNFYH----EAISAKVFDDVLEKPIMLDEIRHLVA 1654

Query: 1037 EFCPK 1041
            ++  K
Sbjct: 1655 KYALK 1659

>KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8.34
            YFL033C
          Length = 1450

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 967  YGLVLMDIQMPKVDGITATKIIRQE--LKYDKPIVALTAFADDSNIQACYKSGMDGFLAK 1024
            + L++  +++P V      K++++   +  D PIVA T +  D    A      D  + K
Sbjct: 1358 FDLIVTTLRLPNVYATDIIKLVKRANCVNSDTPIVAATNYYQD----AVNTKFFDDVVEK 1413

Query: 1025 PIKREQLKGILTEFCPK 1041
            P+ RE+L+ +++++  K
Sbjct: 1414 PLSREKLRKLVSKYALK 1430

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 61/128 (47%), Gaps = 11/128 (8%)

Query: 916  NFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQ 975
            +  +L+ E   +++  V + L+  G    ++   G E V +     + G  + L++  ++
Sbjct: 1617 HMDVLVCEPIPIHRYRVAKDLENLGCTVVSVGA-GDELVSRA----TSGVSFDLIMTALK 1671

Query: 976  MPKVDGITATKIIRQE--LKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKG 1033
            +PK+  I   ++++Q   +    PIV++T +      +A      D  L KP+  ++LK 
Sbjct: 1672 LPKLGAIDIVQLLKQTNGVNSTTPIVSITNYFQ----EAIASKAFDDVLEKPVNLDELKR 1727

Query: 1034 ILTEFCPK 1041
            ++ ++  K
Sbjct: 1728 LVAKYALK 1735

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 11/124 (8%)

Query: 920  LIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKV 979
            L+ E   +++  V + L+  G    ++   G E V +     + G  + L++  +++PK+
Sbjct: 1626 LVCEPIPIHRYRVAKDLENLGCTVVSVGA-GDELVSRA----TSGVSFDLIMTALKLPKL 1680

Query: 980  DGITATKIIRQELKYDK--PIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTE 1037
              I   +++RQ    +   PIVA+T +      +A      D  L KP+  ++LK ++ +
Sbjct: 1681 GAIDIVQLLRQTNGANSTTPIVAITNYFQ----EAITSKVFDDVLEKPVNLDELKKLVAK 1736

Query: 1038 FCPK 1041
            +  K
Sbjct: 1737 YALK 1740

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 967  YGLVLMDIQMPKVDGITATKIIRQE--LKYDKPIVALTAFADDSNIQACYKSGMDGFLAK 1024
            + L++  +++PK+D +   K+I+Q   +    PI+A T +  ++  + C+    +  + K
Sbjct: 1884 FDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQEA--ETCH--VFNDIMEK 1939

Query: 1025 PIKREQLKGILTEFC 1039
            PI+ + L+ +++ + 
Sbjct: 1940 PIQLDILRRVVSRYA 1954

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 61/128 (47%), Gaps = 11/128 (8%)

Query: 916  NFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQ 975
            +  +L+ E   +++  V + L+  G    ++   G E V +     + G  + L++  ++
Sbjct: 1624 HMDVLVCEPIPIHRYRVTKDLENLGCTVVSVGA-GDELVSRA----TSGVSFDLIMTALK 1678

Query: 976  MPKVDGITATKIIRQELKYDK--PIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKG 1033
            +PK+  I   ++++Q    +   PIVA+T +      +A      D  L KP+  ++LK 
Sbjct: 1679 LPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQ----EAITSKVFDDVLEKPVNLDELKK 1734

Query: 1034 ILTEFCPK 1041
            ++ ++  K
Sbjct: 1735 LVAKYALK 1742

>NCAS0D01280 Chr4 complement(232270..233472) [1203 bp, 400 aa] {ON}
           Anc_5.58
          Length = 400

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 398 KDG-RHNSSSYNLYEDVEKYTEIGKANKSTESLSKENITDY 437
           +DG R++S+S N+Y D E+     KAN     L+KE I +Y
Sbjct: 130 RDGLRYDSASDNVYMDAEQEERAKKANNPQHGLTKEEIKEY 170

>Suva_15.379 Chr15 (668836..670038) [1203 bp, 400 aa] {ON} YHR179W
           (REAL)
          Length = 400

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 398 KDG-RHNSSSYNLYEDVEKYTEIGKANKSTESLSKENITDY 437
           +DG R++S+S N+Y D E+  +  KAN    SL+K+ I  Y
Sbjct: 130 RDGLRYDSASDNVYMDAEQEAKAKKANNPQHSLTKDEIKQY 170

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 8/124 (6%)

Query: 912  YDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVL 971
            YD K F +LI++    + + + R   +  +E + I  D  +   K KE +   + Y LV+
Sbjct: 488  YD-KGFHILIID---ADPMFIERCKTV--LEQYRITVDIMQDWPKTKE-KILNKCYDLVI 540

Query: 972  MDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQL 1031
            +D  + K   +   + +   ++Y  PI+ +T+  +D  +    + G++  L KP    +L
Sbjct: 541  IDAHV-KFLNVPILESMLSSIQYHPPIILMTSSLNDQQLIFYLQHGINSILEKPFHSHKL 599

Query: 1032 KGIL 1035
               L
Sbjct: 600  LKFL 603

>KNAG0F03140 Chr6 (593032..594933) [1902 bp, 633 aa] {ON} Anc_6.86
           YLR289W
          Length = 633

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 69/158 (43%), Gaps = 25/158 (15%)

Query: 648 VDGKITVNIKLLGEYDKDRSAAENYKDVY-----MKEIRNSNGDKIKPLMTLISSKDTMS 702
           VDG I V  K++  + K +  A+    +Y       ++++     I P M  I  KD + 
Sbjct: 244 VDGTIAVGDKIVSAHTKKKYDAKKIGIMYPNQTPTGQLKSGQVGYIVPGMKNI--KDAL- 300

Query: 703 VADNISNKSVASDTE-----RSTNNTIYSNKF-KNGSNFQDTDDAIGVPLDKKRKWVISV 756
           + D + ++   +DTE       +   ++   F  +GSNF+D DD IG  +   R   +S 
Sbjct: 301 LGDTLVHEKFENDTEVLPGFEESKPMVFVGAFPADGSNFKDMDDDIGRLVLNDRSVSLSR 360

Query: 757 EVEDTGP-----GIEPSLQKSVFEPFVQGDQTLSRQYG 789
           E  +        G   SL  SVF+      + L ++YG
Sbjct: 361 ETSNAFGQGWRLGFLGSLHASVFK------ERLEKEYG 392

>Kpol_478.21 s478 complement(66004..67323) [1320 bp, 439 aa] {ON}
           complement(66004..67323) [1320 nt, 440 aa]
          Length = 439

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 33/81 (40%), Gaps = 15/81 (18%)

Query: 754 ISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 798
           + + + D G GI P ++ ++F+      +   +  G               G G GL +C
Sbjct: 344 LEIRIRDFGGGIAPQVEANMFDYSYSTVEESKKDNGVEACMIPGEVINNVCGMGFGLPLC 403

Query: 799 RQLANLMHGTMKLESEVGVGS 819
           R    L  G + ++S  G G+
Sbjct: 404 RAYMELFEGRLDIQSLYGWGT 424

>Smik_10.78 Chr10 complement(124678..126777) [2100 bp, 699 aa] {ON}
           YJL156C (REAL)
          Length = 699

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 9/68 (13%)

Query: 424 KSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRR-----FVKDELSELTETYKLMT 478
           K  ESL  +N +D+S S SSA+    NL +  +  SRR     +V+  LSEL E    + 
Sbjct: 130 KEEESLDAQNTSDFSPSASSALATPVNLRENAL-GSRRTITLEYVQKSLSELEEN---LV 185

Query: 479 DALDEHSQ 486
           D +D+  Q
Sbjct: 186 DIMDDIHQ 193

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,584,892
Number of extensions: 4323837
Number of successful extensions: 19088
Number of sequences better than 10.0: 137
Number of HSP's gapped: 19851
Number of HSP's successfully gapped: 171
Length of query: 1042
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 922
Effective length of database: 39,721,479
Effective search space: 36623203638
Effective search space used: 36623203638
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)