Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1039.462.292ON70470433580.0
Suva_9.1082.292ON72271523140.0
Smik_9.882.292ON72471723130.0
YIL091C (UTP25)2.292ON72171822990.0
NCAS0B062302.292ON72372122900.0
Skud_9.822.292ON72271322740.0
NDAI0B035302.292ON73972522530.0
TDEL0G022202.292ON71071422490.0
KAFR0J013402.292ON72872722490.0
TPHA0D015202.292ON71671822250.0
SAKL0E07546g2.292ON71871222080.0
TBLA0B059702.292ON71971121940.0
KNAG0A054002.292ON72172421910.0
KLLA0E08229g2.292ON70470921520.0
ZYRO0A02002g2.292ON70971421160.0
CAGL0D04180g2.292ON70070221120.0
KLTH0G10494g2.292ON74756620960.0
Kwal_27.115032.292ON72772420800.0
Ecym_33312.292ON70870720530.0
ADL209C2.292ON70469820190.0
Ecym_83588.124ON56996830.24
CAGL0G02497g5.702ON1780150790.85
ZYRO0E02530g8.124ON55695761.8
YJL127C (SPT10)1.227ON640101743.0
Kwal_47.193133.578ON1071131724.8
Skud_4.5058.469ON604151707.4
KAFR0G022206.121ON52785708.1
TBLA0G022902.539ON131255708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1039.46
         (704 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...  1298   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   895   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   895   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   890   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   886   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   880   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   872   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   870   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   870   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   861   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   855   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   849   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   848   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   833   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   819   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   818   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   811   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   805   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   795   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   782   0.0  
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...    37   0.24 
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    35   0.85 
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...    34   1.8  
YJL127C Chr10 complement(182298..184220) [1923 bp, 640 aa] {ON} ...    33   3.0  
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    32   4.8  
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    32   7.4  
KAFR0G02220 Chr7 (463161..464744) [1584 bp, 527 aa] {ON} Anc_6.1...    32   8.1  
TBLA0G02290 Chr7 complement(591028..594966) [3939 bp, 1312 aa] {...    32   8.3  

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score = 1298 bits (3358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/704 (92%), Positives = 649/704 (92%)

Query: 1   MARHSGTSEGPKKRGRTELRSIRRPNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQA 60
           MARHSGTSEGPKKRGRTELRSIRRPNRSQHSKHDQQVVH                 IAQA
Sbjct: 1   MARHSGTSEGPKKRGRTELRSIRRPNRSQHSKHDQQVVHESENEDSLESSSDDDEDIAQA 60

Query: 61  EAENSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVKEIDEQEEIEQGMAXXXXXXXXX 120
           EAENSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVKEIDEQEEIEQGMA         
Sbjct: 61  EAENSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVKEIDEQEEIEQGMASESEEEDEE 120

Query: 121 XXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKK 180
                           PTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKK
Sbjct: 121 NDEEESNEGDEEEEEEPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKK 180

Query: 181 ESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDP 240
           ESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDP
Sbjct: 181 ESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDP 240

Query: 241 MFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGF 300
           MFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGF
Sbjct: 241 MFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGF 300

Query: 301 TRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSKPKSFRHVFK 360
           TRPKVLIVVPTRDTAYQVVETIIEKSGLDQI             SLPPTSKPKSFRHVFK
Sbjct: 301 TRPKVLIVVPTRDTAYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFK 360

Query: 361 GNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVM 420
           GNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVM
Sbjct: 361 GNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVM 420

Query: 421 IVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYI 480
           IVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYI
Sbjct: 421 IVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYI 480

Query: 481 SPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYR 540
           SPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYR
Sbjct: 481 SPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYR 540

Query: 541 FKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLD 600
           FKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLD
Sbjct: 541 FKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLD 600

Query: 601 SNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLG 660
           SNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLG
Sbjct: 601 SNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLG 660

Query: 661 KSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           KSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK
Sbjct: 661 KSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/715 (61%), Positives = 542/715 (75%), Gaps = 27/715 (3%)

Query: 10  GPKKRGRTELRSIRRPNRSQHSKHD-QQVVHXXXXXXXXXXXXXXXXXIAQAE---AENS 65
           G +KRGR E+R I+R    +    D  +V H                  ++++    +  
Sbjct: 15  GHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAISDAGSESDLDIGDEE 74

Query: 66  DRKEKVYGALLTILNSEHPERKKHKSHSTDFVKE---------------IDEQEEIEQGM 110
           +++EKVY ALLTIL SEHPE K+ K+ +T    E               +D+Q EIE G+
Sbjct: 75  EKQEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVNENTDSEPVDDQLEIENGL 134

Query: 111 AXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKY 170
                                       D+ D FESHFN VS+  VDD+S  FK   IKY
Sbjct: 135 LSDQEDDSDDDGDENEQDEVDSE-----DEQDPFESHFNQVSEKYVDDVSNAFKANNIKY 189

Query: 171 KSMKYSLDKKESAIFGKPLLLTQQDET-IDNPVLTSSYDSYFIKQRLKIQNDLLDSSKEN 229
           KS+K  L   ES I+ KP++    DET ++ P  +SS  SYF+KQRLKIQN LLD   + 
Sbjct: 190 KSVKSPLGDDESCIYSKPVV--NGDETPVERPYKSSSIYSYFLKQRLKIQNGLLDKKIDP 247

Query: 230 LTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQE 289
           LT L+KKL+DPMFQYKD+L EY +YE DE EYR+LY+LH LNHIYKTRD+ILK+NQRLQ+
Sbjct: 248 LTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRILKNNQRLQD 307

Query: 290 NDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPT 349
           N D E LDQGFTRPKVLIVVPTRD AY VV+ II+KSG+DQ+             SLPP+
Sbjct: 308 NPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLPPS 367

Query: 350 SKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKR 409
           SKPKSF+H+F+GNT+DFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQMILENTDKKKR
Sbjct: 368 SKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKR 427

Query: 410 QDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKF 469
           QDDFLSSIE+M++DQLHSIEYQNISH++TI +HINKIP QQ EADFSRIRMWYIN+QAK 
Sbjct: 428 QDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKL 487

Query: 470 LRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLV 529
           LRQTM+FT+YISP AN++ING+C N+AGRWKN+++I SE SSIGQLG+KI+QIFQRFD++
Sbjct: 488 LRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIRQIFQRFDII 547

Query: 530 GGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSE 589
           G ++++E DYRFK+FTSV++ +IVKSTGYEDGIL+YIP+YTD++R+RNYMKEKTTILF +
Sbjct: 548 GNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGD 607

Query: 590 INEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEV 649
           INEYS+QKQL++NRS+FQQGR KVLLYTERLHHYRRYE+KG+K+VIFYKPP NPEFYNE 
Sbjct: 608 INEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPPNNPEFYNET 667

Query: 650 IRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           +R+  KNAFLG +D+NIST+R VYSKLDGL+L+RIVG+KRA +L H Q E Y+FK
Sbjct: 668 VRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/717 (61%), Positives = 540/717 (75%), Gaps = 29/717 (4%)

Query: 10  GPKKRGRTELRSIRRPNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAEAENSD--- 66
           G +KRGR ELR I+R +  +        V                  I  +E +N D   
Sbjct: 15  GYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIG-SEEDNLDVED 73

Query: 67  ---RKEKVYGALLTILNSEHPERKKHKSHSTDFVKE----------------IDEQEEIE 107
              +KEKVY ALLTIL SEHPE K+ K+ + +  K                 +DEQ EIE
Sbjct: 74  EEGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQLEIE 133

Query: 108 QGMAXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQ 167
            G+                            D+ D FESHFN VS+  VDD+S  FK K 
Sbjct: 134 NGLLGDREDDNDDDSNENEKDDMDSE-----DEQDPFESHFNQVSEKYVDDLSNAFKSKS 188

Query: 168 IKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSK 227
           IKYKS+K SL   ES I+ KP ++ ++   +++P  +SS  SYF+KQRLK+QN LLD   
Sbjct: 189 IKYKSVKASLGDDESYIYAKPFMVGEE-ALVESPYRSSSIYSYFLKQRLKVQNGLLDKKI 247

Query: 228 ENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRL 287
           + LT ++KKL+DPMFQYKD+L EY +YE DE EYR+LY+LHVLNHIYKTRD+ILK+NQRL
Sbjct: 248 DPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRILKNNQRL 307

Query: 288 QENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLP 347
           Q+N D E LDQGFTRPKVLIVVPTR+ AY+VV+ II KSG+DQ+             SLP
Sbjct: 308 QDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLP 367

Query: 348 PTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKK 407
           P SKPKSF+H+FKGNT+DFFV+G+KFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKK
Sbjct: 368 PESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKK 427

Query: 408 KRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQA 467
           KRQDDFLSSIE+M++DQLHSIEYQNISH++TI +HINKIP QQ EADFSRIRMWYIN+QA
Sbjct: 428 KRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQA 487

Query: 468 KFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFD 527
           K  RQTM+FT+YISP AN++ING+C NMAGRWKN+++I SE SSIGQLG+K++QIFQRFD
Sbjct: 488 KLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFD 547

Query: 528 LVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILF 587
           ++G ++++E DYRFK+FTSV++ +IVKS GYEDGILVYIP+YTD++R+RNYMKEKTTILF
Sbjct: 548 IIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTILF 607

Query: 588 SEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYN 647
            +INEYS Q+QL++NRS+FQQGR KV+LYTERLHHYRRYE+KG+KSV+FYKPP NPEFYN
Sbjct: 608 GDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYN 667

Query: 648 EVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           E +RF  KNAFLG +D+NIST+R +YSKLDGL+L+RIVG+KRAA+L H Q E Y+FK
Sbjct: 668 ETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/718 (60%), Positives = 541/718 (75%), Gaps = 34/718 (4%)

Query: 10  GPKKRGRTELRSIRRPN-RSQHSKHD------QQVVHXXXXXXXXXXXXXXXXXIAQAEA 62
           G +KRGR ELR I+R + R++    +      + + H                 I   E 
Sbjct: 15  GYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDIEDEEG 74

Query: 63  ENSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVKE----------------IDEQEEI 106
               +KEKVY ALLTIL SEHPE K+ +  + +  K                 +D+Q EI
Sbjct: 75  ----KKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEI 130

Query: 107 EQGMAXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDK 166
           E G+                            D+ D FESHFN V +  VD +S  FK K
Sbjct: 131 ENGLLGNHEDDNDDDSSGDEKDIDSE------DEQDPFESHFNQVPEKFVDKLSNAFKTK 184

Query: 167 QIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSS 226
            +KYKS+K SL   ES I+ KP+++ ++   +++P  +SS  SYF+KQRLK+QN LLD  
Sbjct: 185 SVKYKSVKGSLSDSESYIYAKPVVIGEE-ALVESPYRSSSIYSYFLKQRLKVQNGLLDKK 243

Query: 227 KENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQR 286
            + LT L+KKL+DPMFQYKD+L EY +YE DE EYR+LY+LHVLNHIYKTRD+ILK+NQR
Sbjct: 244 TDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQR 303

Query: 287 LQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSL 346
           LQ+N D E LDQGFTRPKVLIVVPTR+ AY+VV+ II KSG+DQ+             SL
Sbjct: 304 LQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSL 363

Query: 347 PPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDK 406
           PP SKPKSF+H+F+GNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQMILENTDK
Sbjct: 364 PPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDK 423

Query: 407 KKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQ 466
           KKRQDDFLSSIE+M++DQLHSIEYQNISH++TI +H+NKIP QQ EADFSRIRMWYIN+Q
Sbjct: 424 KKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQ 483

Query: 467 AKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRF 526
           AK  RQTM+FT+YISP AN++ING+C NMAGRWKN+++I SE+SSIGQ G+KI+QIFQRF
Sbjct: 484 AKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRF 543

Query: 527 DLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTIL 586
           D++G ++++E DYRFK+FTSV++  IVKSTGYEDGIL+YIP+YTD++R+RNYMKEKTTIL
Sbjct: 544 DIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTIL 603

Query: 587 FSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFY 646
           F +INEYS+Q+QL++NRS+FQQGR KV+LYTERLHHYRRYE+KG+KSV+FYKPP NPEFY
Sbjct: 604 FGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFY 663

Query: 647 NEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           NEV+RF  KNAFLG +D+NIST+R +YSKLDGL+L+RIVG+KRAA+L H Q E Y+FK
Sbjct: 664 NEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/721 (59%), Positives = 539/721 (74%), Gaps = 23/721 (3%)

Query: 4   HSGTSE-GPKKRGRTELRSIRRPNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAEA 62
           H G+   G KKRGR ELR+IRR   ++ S   Q+V +                   + + 
Sbjct: 6   HEGSQHAGSKKRGRQELRTIRRSAGAKVSS--QEVFNSSIVDDEEQELNESNESEQEEDI 63

Query: 63  ENSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVK-----------------EIDEQEE 105
           +  ++K KVYGALLTIL SEHPE KK K    D  K                 EIDE ++
Sbjct: 64  DEEEKKNKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDGKDDEIDEAQQ 123

Query: 106 IEQGMAXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKD 165
           IE G+A                           D+ D FESHFN VS+   DD++  F  
Sbjct: 124 IEDGLARGSDGQPSDDEEDNDAHSNVEDIDS-EDEQDPFESHFNQVSEKTADDLNTAFNT 182

Query: 166 KQIKYKSMKYSLDKKESAIFGKPLLLTQQ--DETIDNPVLTSSYDSYFIKQRLKIQNDLL 223
             +KYKS K  +   ++ I   P ++ ++  +E  D+   +SS  SYF+KQRL++ ND+L
Sbjct: 183 GSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDML 242

Query: 224 DSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKD 283
           DS K+ L PL+K+L+DPMFQY+D+LCEY++YE DE EYR+LY+LH LNH+YKTRD+ILKD
Sbjct: 243 DSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKD 302

Query: 284 NQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXX 343
           N RLQ+N D E  DQGFTRPKVLIVVPTRDTAY+V+  II KSGLDQ+            
Sbjct: 303 NGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHD 362

Query: 344 XSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILEN 403
            +LPP+SKPKSF+H+FKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+QMI+EN
Sbjct: 363 ETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVEN 422

Query: 404 TDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYI 463
           TDKK RQDDFLSSIEV+I+DQLHSIEYQN++HV+TI +H+NKIP+QQ EADFSRIRMWYI
Sbjct: 423 TDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYI 482

Query: 464 NDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIF 523
           NDQA+  RQTM+FT+Y++P ANA+IN +C N AGRWKN++II  E S+I QLG+K+KQ F
Sbjct: 483 NDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTF 542

Query: 524 QRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKT 583
           QRFD++GG+V+DE DYRFK+F+SV++ +IVKST Y DGIL+YIP+YTDY+R+RNY+KEKT
Sbjct: 543 QRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKT 602

Query: 584 TILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNP 643
           T+LF +INEYS Q++L+SNRS+FQQGR KVLLYTERLHHYRRYELKG+KSV+FYKPPTNP
Sbjct: 603 TLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNP 662

Query: 644 EFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDF 703
           EFYNEV+R+  K+AFLG +D+NIST+RT+Y KLDGL+L+RIVGSKRA ILCH QNE Y+F
Sbjct: 663 EFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEF 722

Query: 704 K 704
           +
Sbjct: 723 Q 723

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/713 (60%), Positives = 537/713 (75%), Gaps = 23/713 (3%)

Query: 10  GPKKRGRTELRSIRRPNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAE----AENS 65
           G +KRGR ELR I+R +  +    D   +                  +   +     +  
Sbjct: 15  GHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLDVGDED 74

Query: 66  DRKEKVYGALLTILNSEHPERKKHKS---HSTDFVKE-----------IDEQEEIEQGMA 111
           ++K+KVY ALLTIL SEHPE K+ K+    S+D   +           +D+Q EIE G+ 
Sbjct: 75  EKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIENGLL 134

Query: 112 XXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYK 171
                                      D+ D FESHFN V +  VDD+S  FK K I+YK
Sbjct: 135 GDREDESEDDGSEDEKHDDVDSE----DEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYK 190

Query: 172 SMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLT 231
           S+K  L+  ES I+ +P+++ ++  ++++P  +SS  SYF+KQRLKIQN L D   + L 
Sbjct: 191 SVKAPLNGDESYIYAQPVVVGEE-SSVESPYKSSSIYSYFLKQRLKIQNGLQDKKIDPLN 249

Query: 232 PLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQEND 291
            L++KL+DPMFQYKD+L EY +YE DE EYR+LY+LHVLNHIYKTRD+ILK+NQRLQ+N 
Sbjct: 250 ALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQDNP 309

Query: 292 DLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSK 351
           D E LDQGFTRPKVLIVVPTRD AY+VV+ II KSG+DQ+             SLPP SK
Sbjct: 310 DTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSK 369

Query: 352 PKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQD 411
           P+SF+H+FKGNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQMILENTDKKKRQD
Sbjct: 370 PRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQD 429

Query: 412 DFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLR 471
           DFLSSIE+M++DQLHSIEYQNISH+ TI +H+NKIP QQ EADFSRIRMWYIN+QAKF R
Sbjct: 430 DFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFR 489

Query: 472 QTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGG 531
           QTM+FT+YISPT N++ING+C NMAGRWKN++ I  E SSIGQLG+KI+QIFQRFD +G 
Sbjct: 490 QTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGN 549

Query: 532 TVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEIN 591
           ++V+E DYRFK+FTSV++ +IVKSTGYEDGIL+YIP+YTD++R+RNYMKEKTTILF +IN
Sbjct: 550 SIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDIN 609

Query: 592 EYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIR 651
           EYS+Q+QL++NRS+FQQGR KV+LYTERLHHYRRY++KG+KSVIFYKPP NPEFY+E +R
Sbjct: 610 EYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVR 669

Query: 652 FTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           F  KNAF G +D+NIST+R +YSKLDG++L+RIVG+KRAA+L H Q E Y+FK
Sbjct: 670 FIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/725 (59%), Positives = 537/725 (74%), Gaps = 42/725 (5%)

Query: 12  KKRGRTELRSIRRPNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAE------AENS 65
           +KRGR ELR+IRR + ++ S++D  V                     + +       +  
Sbjct: 25  RKRGRQELRTIRR-SAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEEVDED 83

Query: 66  DRKEKVYGALLTILNSEHPERKKHKSH----------------------STDFVKEIDEQ 103
           +RK KVYGALLTIL +EHPE  KHK                        + D + E DE 
Sbjct: 84  ERKGKVYGALLTILETEHPE-PKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEEDET 142

Query: 104 EEIEQGMAXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGF 163
           E+IE G+                            D+ D FESHFN  ++  VD + A F
Sbjct: 143 EQIENGLLDRDDEQSDDDQLNDSNDVES------DDEQDPFESHFNKPTEQFVDKLHAAF 196

Query: 164 KDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYD----SYFIKQRLKIQ 219
           + ++IKYK+ K  +D   S I  KP +  ++ ET  N + +S +     SYFIKQRLKIQ
Sbjct: 197 ESREIKYKATKIVIDDSHSVISSKPTIFGEELET--NRLSSSKHGQSIFSYFIKQRLKIQ 254

Query: 220 NDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDK 279
           N+LL+   + LTPL+K+LLDPMFQYKD+L EY +Y  DE EYR+LY+LH LNH+YKTRD+
Sbjct: 255 NNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDR 314

Query: 280 ILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXX 339
           ILK+NQRLQ+N D E LDQGFTRPKVLIVVPTRDTAY+V + II+KSGLDQ+        
Sbjct: 315 ILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYD 374

Query: 340 XXXXXSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQM 399
                SLPP+SKPKSF+ +FKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+QM
Sbjct: 375 QFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQM 434

Query: 400 ILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIR 459
           I+ENTDKKKRQDDFLSSIE++IVDQLHS+EYQN++H++TI +H+NKIP +Q +ADFSRIR
Sbjct: 435 IVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIR 494

Query: 460 MWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKI 519
           MWYINDQAK  RQTM+FT+Y+SP ANAIIN +C N  GRWKN++I++ E SSIG+LG+KI
Sbjct: 495 MWYINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKI 554

Query: 520 KQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYM 579
           KQIFQRFD++GG++VDE DYRFK+FTSV++ +IVKST Y+DGIL+YIP+YTDY+R+RNY+
Sbjct: 555 KQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYL 614

Query: 580 KEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKP 639
           KEKT ILF +INEYS Q++L+SNRS+ QQGR KVLLYTERLHHYRRYE+KG+KSV+FYKP
Sbjct: 615 KEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKP 674

Query: 640 PTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNE 699
           PTNPEFYNEV+RF  KNAFLG +D+NIST+RTVY KLDGL+L+RIVG+KRA ILCH QNE
Sbjct: 675 PTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNE 734

Query: 700 SYDFK 704
            Y+FK
Sbjct: 735 VYEFK 739

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/714 (60%), Positives = 532/714 (74%), Gaps = 25/714 (3%)

Query: 2   ARHSGTSEGPKKRGRTELRSIRRPNRSQ-HSKHDQQVVHXXXXXXXXXXXXXXXXXIAQA 60
           AR +GT     KRGR ELRSIRRP R++ H + +                      IA  
Sbjct: 11  ARRNGTL----KRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHNEEIANV 66

Query: 61  EAENSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVKE----------IDEQEEIEQGM 110
           E +  +++ KVYGALLTILNSEHP+ K  +  +    KE           DE E++E  +
Sbjct: 67  EEDEENKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKEDSESDVEEDERDEVEQLEDNL 126

Query: 111 AXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKY 170
           A                              DTF+SHFN V +++VD + A FK++Q+KY
Sbjct: 127 ARVDENPSEDDLSEDADEESDDEQ-------DTFDSHFNQVPENVVDKLDAAFKERQLKY 179

Query: 171 KSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENL 230
           KS K  + + ES ++ KPLLL  Q + ++ P    S  SY  KQRLKIQNDL     ENL
Sbjct: 180 KSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL---EHENL 236

Query: 231 TPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQEN 290
           T  ++ L+DPM QY D+L EY +YE DE EYR+LY+LHVLNH+YKTRDKILK+NQR+ +N
Sbjct: 237 TSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDN 296

Query: 291 DDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTS 350
            D + LDQGFTRPKVLIVVPTRDTAYQV+E II+KSG+DQI             SLPP+S
Sbjct: 297 PDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSS 356

Query: 351 KPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQ 410
           KPKSF+HVFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDIIICSPLGIQ+ILENTDKKKRQ
Sbjct: 357 KPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQ 416

Query: 411 DDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFL 470
           DDFLSSIE+ I DQLHSIEYQN+SHV TI +H+N IPQ+Q + DF R+R+WYIN+QAK  
Sbjct: 417 DDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLF 476

Query: 471 RQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVG 530
           RQTM+FT+Y+SPTANA+IN KC NM GRWKN+  I    SSIG+LG+K++QIFQR DL  
Sbjct: 477 RQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGA 536

Query: 531 GTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEI 590
            ++++ESD+RFK+FTSV++ +I+KSTGYEDGILVYIP+Y D++R+RNYMKEKTTI+F +I
Sbjct: 537 ASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDI 596

Query: 591 NEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVI 650
           NEYS QKQL+SNR++FQQGR KVLLYTERLHH+RRYE+KG+KSV+FY+PPTNPEFY+EV+
Sbjct: 597 NEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVV 656

Query: 651 RFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           RF AK+A LG +D+NIST+RT+YSKLDG++L+RIVG+KRAAIL HGQNE Y+FK
Sbjct: 657 RFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/727 (59%), Positives = 538/727 (74%), Gaps = 25/727 (3%)

Query: 3   RHSGTS----EGPKKRGRTELRSIRR-----PNRSQHSKHDQQVVHXXXXXXXXXXXXXX 53
           + SGT     +G +KRGR ELR+IRR     P  +Q + +   V                
Sbjct: 2   KRSGTGADGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAAN 61

Query: 54  XXXIA-----QAEAENSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVKEIDEQEEIE- 107
              +      +A  +  + K++VYGALLTIL SEHPE KK K    + V   +EQ++   
Sbjct: 62  GDDVGDEVGDEASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESD 121

Query: 108 ---------QGMAXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDD 158
                    Q +                            ++ D FE+HFN V +   D 
Sbjct: 122 ASEEEEDETQQIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDK 181

Query: 159 ISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDET-IDNPVLTSSYDSYFIKQRLK 217
           +   FK+  IKYKS K  + + E AIF KP++ + + E+ ++  V  SS  SYF+KQRLK
Sbjct: 182 LDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLK 241

Query: 218 IQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTR 277
           +QN+L+D   + LTPL+K+L+DPMFQYKD+L +Y +Y  DE EYR+LYSLHVLNH+YKTR
Sbjct: 242 MQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTR 301

Query: 278 DKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXX 337
           DKILK+NQRLQ+N+D ECLDQGFTRPKVLIVVPTRDTAYQV+E II KSG+DQ+      
Sbjct: 302 DKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKF 361

Query: 338 XXXXXXXSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGI 397
                  SLPP+SKPKSF+ +FKGNTNDFFVLG+KFTRKAIKLYSNFYQSDIIICSPLGI
Sbjct: 362 KDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGI 421

Query: 398 QMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSR 457
           QMILENTDKKKRQDDFLSSIE+MI+DQLHSIEYQNISH++TI  HINKIPQ+Q +ADFSR
Sbjct: 422 QMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSR 481

Query: 458 IRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGI 517
           +RMWYINDQAK  RQTMLFT+YISP AN+++NGKC N +GRWKN+++IS+  SSI ++GI
Sbjct: 482 VRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGI 541

Query: 518 KIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRN 577
           KI+QIFQRF+ V G+VVDE DYRFK+FTSV + NIVK+TGYEDG L+YIPEYTDY+R+RN
Sbjct: 542 KIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRN 601

Query: 578 YMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFY 637
           Y+K+KTTILF +INEYS QKQL+SNRS+FQQGR KVLLYTERLHHYRRYE+KG+K+V+FY
Sbjct: 602 YLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFY 661

Query: 638 KPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQ 697
           +PP NPEFY EV+R+  KNAFLG +D+NIST+R +YSKLD L+L+ IVGSKRA +LCH Q
Sbjct: 662 QPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQ 721

Query: 698 NESYDFK 704
           NE Y+FK
Sbjct: 722 NEVYEFK 728

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/718 (60%), Positives = 539/718 (75%), Gaps = 34/718 (4%)

Query: 12  KKRGRTELRSIRRPN----RSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAEAENSDR 67
           KKRGR++LR+I+R      R+    +D    H                   +AE+E+ D 
Sbjct: 8   KKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSG-----EEAESESDDA 62

Query: 68  KE---------KVYGALLTILNSEHPERKKHKS----------HSTDFVKEIDEQEEIEQ 108
           K+         +VYGALLTIL SEHPE+KK K           +++D    + +++EIE 
Sbjct: 63  KDEEDVGKKRNQVYGALLTILKSEHPEKKKQKKKFNQEKEDAYNASDDEYNVSDKQEIEN 122

Query: 109 GMAXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQI 168
           G+                            D  D F+ HFN V +++VD IS GF +K+I
Sbjct: 123 GLEDQQDDNEDENENDMENMENDDES---DDDTDLFDIHFNQVPENVVDKISNGFDNKKI 179

Query: 169 KYKSMKYSL--DKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSS 226
           KY S K  L   +K+  I+ KP++       +++P+  SS DSYFIK+RL+I N+LLD  
Sbjct: 180 KYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLD-G 238

Query: 227 KENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQR 286
           K+NLT L+K L+DPMFQY D+L EY NY +DE+EYRELY+LH+LNH+YKTRDK+LKDNQR
Sbjct: 239 KDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQR 298

Query: 287 LQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSL 346
           LQEN++ E LDQGFTRPKVLIVVPTRDTAY VVETII KSGLDQ+             SL
Sbjct: 299 LQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSL 358

Query: 347 PPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDK 406
           PP+SKPKSF+ +FKGNTNDFFVLG+KFTRKA+KLYSNFYQSD+IICSPLG+ MI ENTDK
Sbjct: 359 PPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDK 418

Query: 407 KKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQ 466
           KK+QDDFLSSIE+ I+DQLHS+EYQNISH+  I EH+NKIP++Q +ADFSRIRMWYINDQ
Sbjct: 419 KKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQ 478

Query: 467 AKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRF 526
           A+  RQTM+FT+Y+SPTANA+INGKC N+AGRW+N   ++SE+SS+G+LG+KI+QIFQRF
Sbjct: 479 ARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRF 538

Query: 527 DLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTIL 586
           DLVGGT+ DE D+RFK+F SVVM +I+KSTGYEDGILVYIP Y+DYMR+RNYMKEKTT+L
Sbjct: 539 DLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLL 598

Query: 587 FSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFY 646
           F +INEYS Q++L+SNRS+FQQGR KVLLYTERLHHYRRYE+KG+KSVIFY PPTNPEFY
Sbjct: 599 FGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFY 658

Query: 647 NEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           NEV+RF  KNAFLG  DINI+T+R VYSKLD L+L+RIVG++RAA+L   +NE Y+FK
Sbjct: 659 NEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/712 (58%), Positives = 525/712 (73%), Gaps = 21/712 (2%)

Query: 6   GTSEGPKKRGRTELRSIRRPN-RSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAEAEN 64
           G  +  KK GR ELR+I R N R  +   D                        + E + 
Sbjct: 15  GGYKKAKKTGRKELRTITRANARHANESKDDFENEPDMSSEEEELADNKPRSDEEEEEDI 74

Query: 65  SDRKEKVYGALLTILNSEHPERKKHKS------------HSTDFVKEIDEQEEIEQGMAX 112
             +K+KVY ALLT+L SEHP +K  K+               +   + DE+E IE  +  
Sbjct: 75  ETKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAIENALVE 134

Query: 113 XXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKS 172
                                     D+ D+FE HFN+VS+     +++ F+DK+I+YKS
Sbjct: 135 TNDDEDDVGSDINGDEDDE-------DKADSFELHFNNVSELQATKLASAFRDKKIRYKS 187

Query: 173 MKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTP 232
           +K  +++ E  I+ +P +  +   ++  P    S  SYFIKQ+LKIQN+LLD  KE L P
Sbjct: 188 VKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAP 247

Query: 233 LKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDD 292
           L+K L+DPMFQY+D+L EY +YE +E EYR+LY+LHVLNH+YKTRD+IL+++Q+LQ+N D
Sbjct: 248 LQKNLVDPMFQYQDLLYEYRSYEQEE-EYRDLYALHVLNHVYKTRDRILRNSQKLQDNSD 306

Query: 293 LECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSKP 352
            E LDQGFTRPKVLIVVPTRD AYQ+V  IIEKSGLDQ+             SLPP+SKP
Sbjct: 307 QELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLPPSSKP 366

Query: 353 KSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDD 412
           KSF+H+FKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLGIQ+ILENTDKKKRQDD
Sbjct: 367 KSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDD 426

Query: 413 FLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQ 472
           FLSSIE+M++DQLHSIEYQN+SH+ TI +HINKIPQQQ +ADFSRIRMWYIN+QA   RQ
Sbjct: 427 FLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQ 486

Query: 473 TMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGT 532
           TM+FT+Y SP AN++INGKC N AGRWKN+ I+  E SSI QLG+K++QIFQRFDLVGG+
Sbjct: 487 TMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGS 546

Query: 533 VVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINE 592
            +DE DYRFK+FTSV++ +I+KSTGYEDGIL+YIP+YTDY+R+RN+++EKTT+LF +INE
Sbjct: 547 AMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINE 606

Query: 593 YSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRF 652
           YS QKQL SNR++FQQG+ KVLLYTERLHH+RRYE+KG+KSVIFYKPPTNPEFY EV+R+
Sbjct: 607 YSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRY 666

Query: 653 TAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
             K+AFLG +D+NIST+R VY KLDGL+L+R+VG+KRAA+L HGQNE Y+FK
Sbjct: 667 IGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/711 (57%), Positives = 532/711 (74%), Gaps = 16/711 (2%)

Query: 8   SEGPKKRGRTELRSIRRPNRSQHSK-HDQQVVHXXXXXXXXXXXXXXXXXIAQAEA-ENS 65
           SEG  KRGR++ RSI++ + ++  K  D ++V                    +AE  E+ 
Sbjct: 11  SEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDL 70

Query: 66  DRKEKVYGALLTILNSEHPERK--------KHKSHSTDFVKEIDEQEEIEQGMAXXXXXX 117
           ++K++VY AL+TIL SEH E K          + H TD  +++DE E+ E          
Sbjct: 71  EKKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTD--EDLDEDEKFETEEQEIENNL 128

Query: 118 XXXXXXXXXXXXXXXXXXXPTDQLDT----FESHFNDVSQDLVDDISAGFKDKQIKYKSM 173
                                D+ D     F+SHFN  ++   +  +  FK+KQIKY+S+
Sbjct: 129 LSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSI 188

Query: 174 KYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPL 233
           KY +++ ES+I+ +P +L  +   + +PVL SS  SY +K+RLKI NDLLD +  NLT +
Sbjct: 189 KYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTI 248

Query: 234 KKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDL 293
           +K+L+DPMFQYKD+L EY NY  DE+EYR LY LHVLNHIYKTRD+ILK+N ++Q+N D 
Sbjct: 249 QKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDA 308

Query: 294 ECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSKPK 353
           E LDQGFTRPKVLIV PTRD  Y +V  II+KSG+DQI             SL P SKPK
Sbjct: 309 EFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPK 368

Query: 354 SFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDF 413
           SF+ VFKGN+ND+FVLG+KFTRKAIKLYSNFYQSDII+CSPLG+ MILENTDKKKRQDDF
Sbjct: 369 SFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDF 428

Query: 414 LSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQT 473
           LSSIE+MI+DQLHS+E+QNISHV +I EHINKIP++Q + DFSRI+MWYINDQAK  RQT
Sbjct: 429 LSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQT 488

Query: 474 MLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTV 533
           M+FT+YISP+AN  +NGKC N +GRWKN+++I+  +SSIGQLG+++KQ+F RFD++GG++
Sbjct: 489 MIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSI 548

Query: 534 VDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEY 593
           VDE DYRFKYFTSV++Q+I KST YEDG+L+YI +YTDY+R+RNY+KEKTTILF +INEY
Sbjct: 549 VDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEY 608

Query: 594 STQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFT 653
           S QKQ++SNR++FQQ R KVLLYTERLHH+RRYE+KG+K+++FYK PTNPEFYNEV+R+ 
Sbjct: 609 SDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYI 668

Query: 654 AKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
            KNAF G +DINIS +RT+YSKLDGLAL+RI+G+KRAA+L HGQNE+Y+FK
Sbjct: 669 GKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/724 (58%), Positives = 522/724 (72%), Gaps = 41/724 (5%)

Query: 13  KRGRTELRSIRR---------PNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAEAE 63
           KRGR ELR ++R         P R      D  V                    + AEA 
Sbjct: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDAEA- 65

Query: 64  NSDRKEKVYGALLTILNSEHPERKKHKSHSTDFVKEIDE----------------QEEIE 107
              RK KVYGALLTIL SEHPE KK K+  +    E+D+                +E+I+
Sbjct: 66  ---RKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQID 122

Query: 108 QGMAXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQ 167
             +                            D+ D FESHFN   +  ++ + A FK KQ
Sbjct: 123 NAILDNRTQSDSEDEQDVAAEEFDSE-----DEQDPFESHFNQFPETEINTLDAAFKSKQ 177

Query: 168 IKYKSMKYSLDK-----KESAIFGKPLLLT--QQDETIDNPVLTSSYDSYFIKQRLKIQN 220
           ++Y+S+K    K      E  I+ +P +    Q  + +       S  SYF+K+RLKIQN
Sbjct: 178 LQYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQN 237

Query: 221 DLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKI 280
           DLL++  +NL  ++K+L+DPMFQYKD+L EY NY   E EYR+LY+LH LNH+YKTRD+I
Sbjct: 238 DLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRI 297

Query: 281 LKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXX 340
           LK+NQRLQEN D ECLDQGFTRPKVLI+ PTRDTAY +V TII KSG+DQ+         
Sbjct: 298 LKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQ 357

Query: 341 XXXXSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMI 400
               SLPP+SKPKSF+ +FKGNTNDFFVLGMKFTRKAIKLYSNFYQSDII+CSPLG+QMI
Sbjct: 358 FYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMI 417

Query: 401 LENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRM 460
           +ENTDKKKRQDDFLSSIE+ I+DQLHSIEYQNISH+YTI EH+N IP +Q +ADFSRIRM
Sbjct: 418 VENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRM 477

Query: 461 WYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIK 520
           WYINDQA+F RQTM+FT+YISPTAN+IINGKC N +GRWKN++I+S+E S IG+L ++++
Sbjct: 478 WYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVR 537

Query: 521 QIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMK 580
           QIFQRF++ GG++VDE DYRFK+FTSV++  I+KSTGYEDGIL+YIPEYTDY+R+RNY+K
Sbjct: 538 QIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLK 597

Query: 581 EKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPP 640
           EKT ILF +INEYS+QKQL +NRS+FQQGR KVLLYTERLHHYRRYE+KG+KSVIFYKPP
Sbjct: 598 EKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPP 657

Query: 641 TNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNES 700
           ++PEFY EV+R   +NAFLG +D+NIST+R +YSKLD LAL+ +VG++RA +LCHGQNE 
Sbjct: 658 SDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEI 717

Query: 701 YDFK 704
           Y+FK
Sbjct: 718 YEFK 721

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/709 (59%), Positives = 512/709 (72%), Gaps = 25/709 (3%)

Query: 10  GPKKRGRTELRSIRRPNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAEAENSDRKE 69
           GPK  GR +LR I R  + +    D+  V                   A+ E     R +
Sbjct: 7   GPKS-GRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQHRGQ 65

Query: 70  KVYGALLTILNSEHPER--------------KKHKSHSTDFVKEIDEQEEIEQGMAXXXX 115
             Y ALLT+L SEHPER               +  S   D +   DEQ+ IE  +     
Sbjct: 66  -AYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENALDDVSG 124

Query: 116 XXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKY 175
                                  D+ D FESHF+  S+  +     GFKDK +KYKS K 
Sbjct: 125 GVVDEEDMEDSLSDVDESE----DESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKT 180

Query: 176 SLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKK 235
            + ++ES I+ KP L    DE +       +  SYFIKQ+LK+ ND  ++    LT ++K
Sbjct: 181 DVSEEESLIYSKPCL---DDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGLP-LTEIQK 236

Query: 236 KLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLEC 295
           +L+DPMFQYKD+L EY +Y  DE +YR+LYSLH LNH+YKTRD+ILK+NQ+LQEN+D E 
Sbjct: 237 ELVDPMFQYKDMLYEYDDYA-DEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEEL 295

Query: 296 LDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSKPKSF 355
           LDQGFTRPKVLIVVPTRD A+++V  I+EKSGLDQ              SLPPTSKPKSF
Sbjct: 296 LDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSF 355

Query: 356 RHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLS 415
           +H+F+GNTNDFFVLG+KFTRK++K+YSNFYQSDIIICSPLGIQ+ILENTDKKKRQDDFLS
Sbjct: 356 QHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLS 415

Query: 416 SIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTML 475
           SIEVMI+DQLHSIEYQN  HV TI +HINKIP+QQREADFSRIRMWYIN+QAKF RQT++
Sbjct: 416 SIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIV 475

Query: 476 FTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVD 535
           FT+YISP AN+I+NGKC N+AGRWKN++ I  E SSIGQLG+K++QIFQRFDL GGT +D
Sbjct: 476 FTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALD 535

Query: 536 ESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYST 595
           E DYRFK+FTSV++ +IVKSTGYEDGIL+YIP+YTD++R+RNY+KEKTTI+F EINEYS 
Sbjct: 536 EPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSN 595

Query: 596 QKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAK 655
           QKQL SNR+ FQ G+ KVLLYTERLHH+RRYE+K +KSVIFYKPP NPEFY+EV+R   K
Sbjct: 596 QKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGK 655

Query: 656 NAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           N FLG  DINIST+R +YSK+DGL+L+R+VGSKRAA+L HGQNE Y+FK
Sbjct: 656 NVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/714 (57%), Positives = 517/714 (72%), Gaps = 15/714 (2%)

Query: 1   MARHSGTS----EGPKKRGRTELRSIRRPNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXX 56
           M + +G      +G +KRGR +LRSIRR    +    + ++                   
Sbjct: 1   MVKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSEDSEEDAT 60

Query: 57  IAQAEAENSDRKEKVYGALLTILNSEHPE-----RKKHKSHSTDFVKEIDEQEEIEQG-M 110
               E E+S  KEK YGALLTIL SEHPE     R+K K    D     DE  E E+G +
Sbjct: 61  NEVQEQEDS--KEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDDELSEDEKGEV 118

Query: 111 AXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKY 170
                                       D+ D FESHFN +  + +D +   +K K+I  
Sbjct: 119 EANLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFN-MQSESIDSLDEAWKQKKIVN 177

Query: 171 KSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENL 230
           KS K  +D  ES I+ K L    Q+   + P       SY +K++LKIQN+LL+S  + L
Sbjct: 178 KSGKIRVDDDESLIYTKTLAGKGQE--FELPSHKGHLSSYPLKRKLKIQNNLLESQDDVL 235

Query: 231 TPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQEN 290
           TPL++K++DP+FQY+D+L EY +YE DE EYR+LY LHVLNHIYKTRD+ILKDNQRL  N
Sbjct: 236 TPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATN 295

Query: 291 DDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTS 350
            D E LDQGFTRPKVLIV PTRDTAYQ+V  +IEKSGLDQ+              LPP+S
Sbjct: 296 PDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSS 355

Query: 351 KPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQ 410
           KPKSFRH FKGNTNDFFVLG+KFTRKAI+LYSNFYQSD+I+CSPLG+Q+ILENTD+KKRQ
Sbjct: 356 KPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQ 415

Query: 411 DDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFL 470
           DDFLSSIE+MI+DQL+SIE+QN+SH++TI  H+NKIP++Q + DF R+RMWYIN+QAK L
Sbjct: 416 DDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLL 475

Query: 471 RQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVG 530
           RQT++FTRY++PTAN ++NGKC N+ GRWKN+  I+ E SS+ +LG +++QIFQR DL G
Sbjct: 476 RQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGG 535

Query: 531 GTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEI 590
            +VVDE DYRF++FTSV++ +I KSTGYEDGIL+YIP+Y D++R+RNY+K+KTTILF +I
Sbjct: 536 ASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDI 595

Query: 591 NEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVI 650
           NEYS  +QL S RS+FQQGR KVLLYTERLHH+RRYE+KG+KSVIFY+PP+NPEFYNEV+
Sbjct: 596 NEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVV 655

Query: 651 RFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           R+  K+AFLG +D+NIST+R VYSKLDGLAL+RIV SKRAA+L HGQNE Y+FK
Sbjct: 656 RYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/702 (56%), Positives = 516/702 (73%), Gaps = 14/702 (1%)

Query: 13  KRGRTELRSIRRPNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAEAENSDRKEKVY 72
           KRGR ELRSIRR  R++        V                    Q + E  D KE+VY
Sbjct: 3   KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAVEEK---VQDDGEKEDDKEQVY 59

Query: 73  GALLTILNSEHPERK--KHKSHSTDFVKEIDEQEEIEQ-GMAXXXXXXXXXXXXXXXXXX 129
            ALLTIL SEH E K   H+ H  +  +  +E++  +Q   A                  
Sbjct: 60  NALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQYNDAFADGESDDEDDDEDEQAQ 119

Query: 130 XXXXXXXPTDQLDTFESHFN-DVSQDLVDDISAGFKDKQIKYKSMKYSLDK------KES 182
                    ++ D F++HFN + +    + +    KD +++YKS+K  +        +E 
Sbjct: 120 EQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQED 179

Query: 183 AIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMF 242
           AIF  P +  +  + I++P L  S  SYF+K+RL+IQN+LLD+    LT L++K++DPM 
Sbjct: 180 AIFSVPYIEGETPK-IEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMM 238

Query: 243 QYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTR 302
           QYKD+L EY  Y  DE EYR+LY+LHVLNH+YKTRDKI+K+NQ+LQ+N D E LDQGFTR
Sbjct: 239 QYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTR 298

Query: 303 PKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSKPKSFRHVFKGN 362
           PKVLI+ PTRD+AYQ+V  +IEKSGLDQ+             S PP+SKPKSF+H+FKGN
Sbjct: 299 PKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGN 358

Query: 363 TNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIV 422
           TND+FVLG+KFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKKRQDDFLSS+EV I+
Sbjct: 359 TNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTII 418

Query: 423 DQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISP 482
           DQ HSIEYQN +H++TI +H+NKIPQ+Q +ADFSRIRMWYINDQAKF RQTM+FT+YISP
Sbjct: 419 DQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISP 478

Query: 483 TANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFK 542
            AN+++N KC N+ GRWKN++I+SSEDSS+G +G+K++QIFQRF+++G +V DE DYRFK
Sbjct: 479 VANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFK 538

Query: 543 YFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSN 602
           +FTSVV+ NI KSTGY+DG L+YIPEY+DY+R+RNYMKEKT+ILF +INEYS Q+ L SN
Sbjct: 539 FFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSN 598

Query: 603 RSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKS 662
           R++F QGR KVLLYTERLHH+RRYELKG+K+V+FYKPP++PEFY EV+R+  K  FLG +
Sbjct: 599 RTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDA 658

Query: 663 DINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           D+NIST+R  YSKLDGLAL++IVG+KR  +L HGQNE+Y+FK
Sbjct: 659 DLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/566 (66%), Positives = 471/566 (83%), Gaps = 2/566 (0%)

Query: 139 DQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETI 198
           D+ DT E HFN VS+   + + A FK K+++Y+S K  +DK +  I+ +P L+ +    +
Sbjct: 184 DKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAV 243

Query: 199 DNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDE 258
             P  + S +SYFIKQRLKIQNDLLDS ++ LTPL+K+++DPMFQY+D+L EY +Y+  E
Sbjct: 244 SAPDGSQSLNSYFIKQRLKIQNDLLDS-QDKLTPLQKQIVDPMFQYQDLLYEYEDYDK-E 301

Query: 259 KEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQV 318
            EYR+LY+LHVLNHIYKTRD+ILK+NQRLQEN D E LDQGFTRPKVLIV PTRD AY +
Sbjct: 302 TEYRDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDI 361

Query: 319 VETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAI 378
           +  II+KSGLDQ+             +LPP+ KPKSF+ +FKGNTNDFFVLG KFTRK I
Sbjct: 362 LSKIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTI 421

Query: 379 KLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYT 438
           KLYSNFYQSDIIICSPLGIQ+ILENTDKKKRQDDFLSSIE+++VDQLHSIE+QN+ H+ +
Sbjct: 422 KLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTS 481

Query: 439 ILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGR 498
           I EHINKIPQQQ +ADFSRI+MWYINDQAK  RQT++FT++ SP AN++INGKC N AGR
Sbjct: 482 IFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGR 541

Query: 499 WKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGY 558
           WKN+++I  E+SS+GQLG++ + IFQRFDLVG +V +E D RFK+F SV++ NIVKSTGY
Sbjct: 542 WKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGY 601

Query: 559 EDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTE 618
           EDGIL+YIP+YTD++R+RNY++EKTTILF +INEYS Q+QL SNR+MFQQGR KVLLYTE
Sbjct: 602 EDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTE 661

Query: 619 RLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDG 678
           RLHH+RRYE+KG+K+VIFYKPPTNPEF+ EV R+  K+AFLG +D+NIS +R ++SKLDG
Sbjct: 662 RLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDG 721

Query: 679 LALQRIVGSKRAAILCHGQNESYDFK 704
           L+L+RIVG++RAA+L HG NE+Y+FK
Sbjct: 722 LSLERIVGTERAAVLTHGPNETYEFK 747

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/724 (55%), Positives = 509/724 (70%), Gaps = 31/724 (4%)

Query: 3   RHSGTSEGPKKRGRTELRSIRRPNRSQHSK-HDQQVVHXXXXXXXXXXXXXXXXXIAQAE 61
           RH G  E   K GR +LRSIR+ +R    K  D+ V                   +++ +
Sbjct: 13  RHDG--EKFTKGGRKQLRSIRKASRYDSKKPEDEPVETPEEEINEVEDVHEERTEVSRKQ 70

Query: 62  AENSDRKEKVYGALLTILNSEHPERKKH-------KSHSTDFVKEIDEQE---------- 104
             N +     Y ALLT+L +EH   KK        +      + EI  +           
Sbjct: 71  ESNGE----AYAALLTLLKAEHGTGKKKVKAGPQGEGSGESQISEISPEAEQDEEEEEEE 126

Query: 105 ----EIEQGMAXXXXXXXXXXXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDIS 160
                IE G+A                           +  D  E+HFN V +   D + 
Sbjct: 127 EEETAIENGLAEHLDSDGDEAAEIGDEEDDNNGDQD-ENASDPLEAHFNSVPEKDTDALD 185

Query: 161 AGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQN 220
             FK KQ++Y+S K  + K E  I+ +P L  +    I  P  T S   YFIKQRLKIQN
Sbjct: 186 QAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQSLSPYFIKQRLKIQN 245

Query: 221 DLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKI 280
           DLLDS K NLTPL+KK++DP+FQY+D+L EY NY+  E EYR+LY+LH L+HIYKTRD+I
Sbjct: 246 DLLDS-KNNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEYRDLYALHALDHIYKTRDRI 303

Query: 281 LKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXX 340
           LK+NQRLQ+N D E LDQGFTRPKVLIVVPTRD AY V+  IIEKSGLDQ+         
Sbjct: 304 LKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQVDKKSKFRDQ 363

Query: 341 XXXXSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMI 400
               SLPP  KPKSF+ VFKGNTNDFFVLG KFTRK IKLYSNFYQSDII+CSPLGIQ+I
Sbjct: 364 FYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIVCSPLGIQLI 423

Query: 401 LENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRM 460
           LENTDKKKRQDDFLSSIE++++DQLHSIE+QN+ H+ +I EHINKIPQQQ +ADFSRI+M
Sbjct: 424 LENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQHDADFSRIKM 483

Query: 461 WYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIK 520
           WYINDQAK  RQT++FTR+ +P AN++INGKC N AGRWKN+ I+ +E SS+ QLG++ +
Sbjct: 484 WYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGMRTR 543

Query: 521 QIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMK 580
            +FQRFD+ GG   DE D+RFK+F SV++ NIV+STGYEDGIL+YIP+YTD++R+RNY++
Sbjct: 544 LVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRNYLR 603

Query: 581 EKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPP 640
           EKTTILF +I+EYS Q+QL +NR++FQQGR KVLLYTERLHH+RRYE+KG+K+VIFYKPP
Sbjct: 604 EKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPP 663

Query: 641 TNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNES 700
           TNPEF+ E +R+ AK+AFLG +D+NIS +R +YSKLDGLAL+RIVG++RAAIL HG NE+
Sbjct: 664 TNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERAAILTHGPNET 723

Query: 701 YDFK 704
           Y+FK
Sbjct: 724 YEFK 727

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/707 (56%), Positives = 508/707 (71%), Gaps = 17/707 (2%)

Query: 13  KRGRTELRSIRR--PNRSQHSKHDQQVVHXXXXXXXXXXXXXXXXXIAQAEAENSDRKEK 70
           KRGR +LR I R   NRS+   +   +                      A+ +  +R   
Sbjct: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERTAH 63

Query: 71  VYGALLTILNSEHPE--RKKHK-SHSTDFVKEID-------EQEEIEQGMAXXXXXXXXX 120
           VYGALL+ILNS HPE  RK+ K   +TD V E         E +E+   ++         
Sbjct: 64  VYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVAT-ISASLDDSVDK 122

Query: 121 XXXXXXXXXXXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYS-LDK 179
                             D+ D FE HFN +S+   + + A FK+K ++Y+S K   +  
Sbjct: 123 DEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYMHD 182

Query: 180 KESAIFGKPLL--LTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKL 237
            E  IF KP++  L   D   D PV   +  SYF+K++LK+ N LLD  K+ LTPL K L
Sbjct: 183 NEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTPLSKTL 242

Query: 238 LDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLD 297
           +DP+FQY+D+L EY ++ + E EYR+LY+LH+LNHIYKTRD+ILK+N +LQENDD E LD
Sbjct: 243 VDPIFQYRDLLFEYEDF-SQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELLD 301

Query: 298 QGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSKPKSFRH 357
           QGFTRPKVL+V PTR+TAY ++E II+KSGLDQ+             SLPPTSKPKSF+H
Sbjct: 302 QGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQH 361

Query: 358 VFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSI 417
           VFKGNTNDFFVLGMKFTRK +KLYSNFYQSD+I+CSPLGIQ+ILENTDKKKRQDDFLSSI
Sbjct: 362 VFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSSI 421

Query: 418 EVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFT 477
           E+++VDQLHS+E+QN +HV +I +HINKIPQ+Q ++DFSRIRMWYINDQA+  RQT++FT
Sbjct: 422 EMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIFT 481

Query: 478 RYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDES 537
           +Y+SP AN++INGKC N +GR+KN + IS E S+I QLG+K++Q+F RFDL  G+ VDE 
Sbjct: 482 KYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDEP 541

Query: 538 DYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQK 597
           DYRFK+FTSV +  I KSTGYEDGIL+YIP+YTD++R+RNY K++T ILF EI EYS Q+
Sbjct: 542 DYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQR 601

Query: 598 QLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNA 657
           Q+ SNR++FQQG+ KVLLYTERLHH+RRY++KG+KSVIFYKPP+NPEFY E+IR   KNA
Sbjct: 602 QVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKNA 661

Query: 658 FLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           FLG +D+NIST+R  Y KLD L+L+RIVGSKRAA+L   QNE Y+FK
Sbjct: 662 FLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/698 (55%), Positives = 506/698 (72%), Gaps = 12/698 (1%)

Query: 13  KRGRTELRSIRRPNRSQHSKHDQ---QVVHXXXXXXXXXXXXXXXXXIAQAEAENSDRKE 69
           KRGR +LR+I R  R+ H + D+   +  H                    AE +   R+ 
Sbjct: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGARES 72

Query: 70  KVYGALLTILNSEHPERKKHKSHSTDFVKEIDEQEEIEQGMAXXXXXXXXXXXXXXXXXX 129
           + YGALLT+L++EH +++K +    +       +   +   A                  
Sbjct: 73  QSYGALLTLLSAEHGKQRKKRLRKAEAEAAEAAEAGEDPEEAITAALENSAQDAEDAEDA 132

Query: 130 XXXXXXXPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPL 189
                    +Q D F+ HFN VS   V  + A FK+ + +Y+  K +  ++E  ++ KP+
Sbjct: 133 FDDSGESDEEQ-DHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEE-ILYSKPV 190

Query: 190 LLTQQDETIDNPVLTS--SYDSYFIKQRLKIQNDL-LDSSKENLTPLKKKLLDPMFQYKD 246
             +   E  + PV     S   Y IKQRL++ N L  D  ++ LTP +K LLDPMFQY+D
Sbjct: 191 ASS---EGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQD 247

Query: 247 VLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVL 306
           +L EY  Y+  E+EYRELY+LH+LNH+YKTRD+ILK+NQ+LQ+N D E LDQGFTRPK L
Sbjct: 248 ILYEYEGYDR-EREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKAL 306

Query: 307 IVVPTRDTAYQVVETIIEKSGLDQIXXXXXXXXXXXXXSLPPTSKPKSFRHVFKGNTNDF 366
           +VVPTR TAY VV+ ++++SG++Q+             SLPP SKPKSF+HVFKGNTNDF
Sbjct: 307 VVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDF 366

Query: 367 FVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLH 426
           FVLGMKFTRKAI+LYSNFYQSD+I+CSPLG+Q+I+ENTDKKKRQDDFLSSIEVM++DQLH
Sbjct: 367 FVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLH 426

Query: 427 SIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANA 486
           SIE+QNI+HV  I  HINKIPQQQR+ADFSRIRMWYI DQAK  RQTM+FTRYISP ANA
Sbjct: 427 SIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANA 486

Query: 487 IINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTS 546
           ++N KC N AGR K+++++S+E S IGQLG+K++QIFQRF+++GG+ VDE D+RFK+FTS
Sbjct: 487 LLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTS 546

Query: 547 VVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMF 606
           VV+  I K+TGY+ GIL+YIPEYTD++R+RNY+K+KT ILF +INEYS Q+QL SNR++F
Sbjct: 547 VVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALF 606

Query: 607 QQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINI 666
           Q GR KVLLYTERLHH+RR+ELKG+KSVI YKPP+NPEFY E++R+  K+AFLG +D+NI
Sbjct: 607 QLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNI 666

Query: 667 STIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704
           +T+R +YSK+D LAL+RIVG+KRAA+L HGQNE Y+FK
Sbjct: 667 ATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar to
           Ashbya gossypii ADL024C
          Length = 569

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 590 INEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEV 649
           I+   TQ Q D     F+ G    L+ T+ L   R  + KG+  VI Y  P + + Y   
Sbjct: 397 IHAERTQMQRDKIIERFKSGDLWCLICTDVL--ARGVDFKGVNLVINYDIPRSAQAYVHR 454

Query: 650 IRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIV 685
           I  T +    GK+        T+Y+K D +A++ IV
Sbjct: 455 IGRTGRGGMKGKA-------VTLYTKQDAIAIKPIV 483

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 76/150 (50%), Gaps = 4/150 (2%)

Query: 140  QLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETID 199
            QL+ F  + +  S+D + +++A F  K   Y+    +L ++++ I G+  +L QQ E I 
Sbjct: 939  QLEEF-KNLSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIK 997

Query: 200  NPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYEND-E 258
            N +   S ++   ++RL      L  + + +  +KK   + + + ++ L E T Y N+ +
Sbjct: 998  NELTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQ 1057

Query: 259  KEYRELYSLHVLNHIYKTRDKILKDNQRLQ 288
            K Y +    H    + KT  ++ + NQRL+
Sbjct: 1058 KNYEQELQRHA--DVSKTISELREQNQRLK 1085

>ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171W ROK1 ATP-dependent RNA helicase of the DEAD box
           family required for 18S rRNA synthesis
          Length = 556

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 9/95 (9%)

Query: 595 TQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTA 654
           TQ Q D     F+ G    L+ T+ L   R  + KGI  V+ Y  P   + Y   I  T 
Sbjct: 405 TQMQRDKIIERFKTGDLWCLICTDVL--ARGIDFKGINLVVNYDVPQTAQAYVHRIGRTG 462

Query: 655 KNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKR 689
           +N   GK+        T Y++ D LA++ I+   R
Sbjct: 463 RNNRQGKA-------VTYYTRQDSLAIKPIINVMR 490

>YJL127C Chr10 complement(182298..184220) [1923 bp, 640 aa] {ON}
           SPT10Putative histone acetylase with a role in
           transcriptional silencing, sequence-specific activator
           of histone genes, binds specifically and cooperatively
           to pairs of UAS elements in core histone promoters,
           functions at or near the TATA box
          Length = 640

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 147 HFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSS 206
           H+  +   + + IS   K K ++YK     + +++ A+    +L TQ  ETI+NP  +  
Sbjct: 370 HWRGIKSTVSEVISRCQKCK-MRYKDGTGVIIEQKRAVKQAHMLPTQHIETINNPRKSKK 428

Query: 207 YDSYFIKQRLKIQNDLLDSSKENL----TPLKKKLLDPMFQ 243
           +D+  + Q +    +++ S+  ++    TP    ++ P FQ
Sbjct: 429 HDNALLGQAINFPQNIISSTLNDVEGEPTPPDTNIVQPTFQ 469

>Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa]
           {ON} YGL251C (HFM1) - C4 zinc finger DNA-binding protein
           of low sequence specificity in vitro; Probable 119 kD
           DNA/RNA helicase family member [contig 344] FULL
          Length = 1071

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 61/131 (46%), Gaps = 17/131 (12%)

Query: 354 SFRHVFKGNTND-----FFVLGMKFTRKAIKLYSN--------FYQSDIIICSPLGIQMI 400
           SFR ++   T       F +   KF+   +KL ++           ++++I +P    ++
Sbjct: 134 SFRAIYVAPTKTVCNEKFRLWKNKFSNLKVKLITSDTHSLGNVLNDTNLVIMTPEKCDLL 193

Query: 401 LENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRM 460
             N D    Q+ FL ++ +M+VD++HSI+ +  + +  I+  +N +    R    S   +
Sbjct: 194 SRNRDI---QNIFLHTLSLMLVDEVHSIKEERGAILEVIIMRLNLLSNTLRIIAVSGT-I 249

Query: 461 WYINDQAKFLR 471
               D AK+LR
Sbjct: 250 VNAKDLAKWLR 260

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 68/151 (45%), Gaps = 32/151 (21%)

Query: 471 RQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVG 530
           RQT++FT  ++P    I  G        +    + ++     G   + I+QI +      
Sbjct: 388 RQTLMFTATMTPVIEKIAAG--------YMRKPVYATIGVDTGSEPL-IQQIVE------ 432

Query: 531 GTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEK----TTIL 586
               D  + +FK   S+V       T YE  I+++I    +Y +  +++ E+    T + 
Sbjct: 433 --YADNEEQKFKKLKSIV-------TKYEPPIIIFI----NYKQTADWLAERFQKETNMR 479

Query: 587 FSEINEYSTQKQLDSNRSMFQQGRTKVLLYT 617
            + ++   +Q+Q + +  +F+ GR +V++ T
Sbjct: 480 VTILHGSKSQEQREHSLQLFRSGRVQVMIAT 510

>KAFR0G02220 Chr7 (463161..464744) [1584 bp, 527 aa] {ON} Anc_6.121
           YBR223C
          Length = 527

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 8/85 (9%)

Query: 562 ILVYIPEYTDYMR--LRNYMKEKTTILFSEINEYSTQ-----KQLDSNRSMFQQGRTKVL 614
           I +Y+P YT +    + N+ ++K+  +F   N ++       +Q+        QG+T  +
Sbjct: 168 IDIYMPPYTSHHSKMILNFYRDKSVKIFIPSNNFTHHETNLPQQICWCSPSLYQGKTGSV 227

Query: 615 LYTERLHHY-RRYELKGIKSVIFYK 638
           L+ E L  Y + YE K + + I+Y+
Sbjct: 228 LFQENLLSYLKSYEDKTLNTTIYYE 252

>TBLA0G02290 Chr7 complement(591028..594966) [3939 bp, 1312 aa] {ON}
           Anc_2.539 YMR076C
          Length = 1312

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 239 DPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDL 293
           D +   KD++C+   Y ND KE   LY    L  +YKT   + + N    +N+D+
Sbjct: 709 DQLLTLKDIICDPDFYVNDTKEKSALYD--ALKTLYKTSKVLTEQNPLSSDNNDM 761

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,993,006
Number of extensions: 3333047
Number of successful extensions: 11741
Number of sequences better than 10.0: 82
Number of HSP's gapped: 12184
Number of HSP's successfully gapped: 86
Length of query: 704
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 587
Effective length of database: 40,065,477
Effective search space: 23518434999
Effective search space used: 23518434999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)