Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1039.452.288ON96895547680.0
NDAI0G006702.288ON96889928690.0
Suva_14.3242.288ON96890127640.0
TPHA0D015302.288ON96289727540.0
Smik_14.3082.288ON96589727310.0
YNL023C (FAP1)2.288ON96590027290.0
NCAS0G037802.288ON95789527160.0
Skud_14.3062.288ON97090026990.0
TDEL0G021902.288ON93689326660.0
TBLA0B059502.288ON99589826660.0
KNAG0H019902.288ON97390426250.0
KAFR0H033002.288ON96689926200.0
ZYRO0A01936g2.288ON95389825620.0
KLTH0G10406g2.288ON96388725250.0
CAGL0M06919g2.288ON95690125130.0
SAKL0E07634g2.288ON97489224950.0
Kwal_27.115182.288ON95388823870.0
KLLA0E08317g2.288ON92189123070.0
Ecym_33272.288ON92689022670.0
ADL213W2.288ON90889421120.0
KLTH0E08866g4.151ON31089752.4
TPHA0K002805.576ON332399736.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1039.45
         (968 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1841   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1109   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1069   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...  1065   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1056   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1055   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1050   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1044   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1031   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1031   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1015   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1013   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...   991   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   977   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...   972   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   965   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   924   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   893   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   877   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   818   0.0  
KLTH0E08866g Chr5 complement(808794..809726) [933 bp, 310 aa] {O...    33   2.4  
TPHA0K00280 Chr11 complement(47253..57224) [9972 bp, 3323 aa] {O...    33   6.1  

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1841 bits (4768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 906/955 (94%), Positives = 906/955 (94%)

Query: 1   MTENTSVEASSVDETSHLKGTDHLVTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MTENTSVEASSVDETSHLKGTDHLVTA                                 
Sbjct: 1   MTENTSVEASSVDETSHLKGTDHLVTASETSNSGSVYTSSSDDCDDDNSESDSDDSEYES 60

Query: 61  XXXXXLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSS 120
                LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSS
Sbjct: 61  SDNEDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSS 120

Query: 121 QKSLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCS 180
           QKSLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCS
Sbjct: 121 QKSLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCS 180

Query: 181 HFCHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKC 240
           HFCHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKC
Sbjct: 181 HFCHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKC 240

Query: 241 SRVCHSGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKC 300
           SRVCHSGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKC
Sbjct: 241 SRVCHSGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKC 300

Query: 301 NKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTD 360
           NKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTD
Sbjct: 301 NKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTD 360

Query: 361 PISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRC 420
           PISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRC
Sbjct: 361 PISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRC 420

Query: 421 NMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLS 480
           NMKCESLMS           SGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLS
Sbjct: 421 NMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLS 480

Query: 481 CGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSY 540
           CGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSY
Sbjct: 481 CGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSY 540

Query: 541 PCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCH 600
           PCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCH
Sbjct: 541 PCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCH 600

Query: 601 HYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRR 660
           HYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRR
Sbjct: 601 HYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRR 660

Query: 661 KELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIV 720
           KELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIV
Sbjct: 661 KELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIV 720

Query: 721 EKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFI 780
           EKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFI
Sbjct: 721 EKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFI 780

Query: 781 HALVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKVQSFE 840
           HALVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKVQSFE
Sbjct: 781 HALVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKVQSFE 840

Query: 841 SKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSI 900
           SKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSI
Sbjct: 841 SKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSI 900

Query: 901 LPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQ 955
           LPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQ
Sbjct: 901 LPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQ 955

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1109 bits (2869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/899 (59%), Positives = 650/899 (72%), Gaps = 13/899 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           + +YER I++IAKGD Y CMICT+E+D T +MYAC  CYRVFDYDCIREWAVKS++K++D
Sbjct: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           ++WKCPNC H + K+P +NR TCWCGK VNP+ NP  PNSCGQTCNAK C+H C++ CHL
Sbjct: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C R  +I C CGKHTKD+FCY     K  N KF C ++C + LSCGIHKC R CH
Sbjct: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKG-NSKFQCKDECGLPLSCGIHKCKRKCH 236

Query: 246 SGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299
           SG CG CPE +         + CYCGS T   ++C ++KI +S K S D EGN WIGVF 
Sbjct: 237 SGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFA 296

Query: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359
           C +IRTV+Y C  HSF E C +PPT+S  K CPYSPKLLKTCPCGKT L      R  CT
Sbjct: 297 CKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCT 356

Query: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419
           DPI TCE+ C+KPLKCGKHKCPF CH G CMDPC QIE RKCSC  + F VPCQF   P 
Sbjct: 357 DPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPH 416

Query: 420 CNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479
           CN+KCESLMS           SG+P A+KRKK LF   DL+DE+LVEAEHICLK+CNL L
Sbjct: 417 CNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLL 476

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           SCGIH C RKCH GKCPPCLESDS+DLVCPCGKT+VEAPVRCGTKLP C F CIK +   
Sbjct: 477 SCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNE 536

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
           YPCGH P  H CHP D PCPPCT  VFKPCKCGK ++ + LCFQ   SCGK+C   L  C
Sbjct: 537 YPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDC 596

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
            H C  +CH+PG+CQ KC QIC KRR+NC HTC + CHG++ CPD+PC V  +V C CGR
Sbjct: 597 PHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGR 656

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMK---SSSEDPESELERL 716
           R+  + CGA S   S   T +L CD+ C   +R  +L+ AFG+K   SSS D   E ERL
Sbjct: 657 RETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTD--LEFERL 714

Query: 717 KKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQ 776
           K IV    ++EEL+LPF+E  LS++S+Q  WC QIEE+INKF++DK++PSLHFKPM  PQ
Sbjct: 715 KDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQ 774

Query: 777 RNFIHALVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKV 836
           R+FIH L +AY +Y ESQD EPKRSV++KKN  +  P+ SL + LPLYQ++K++EKERK+
Sbjct: 775 RHFIHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKL 834

Query: 837 QSFESKKNVTYLNYQPPERSLTPDV-KYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKD 895
           Q FE++ +   +N + PE      + + NGFLIK ++ GTT +DL  +FG +LK TLIK+
Sbjct: 835 QEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKN 894

Query: 896 AQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954
            QY +L DGKS ++YP+DY TI+ NVERD +SL GHFD + K+  + E VE+C I D+L
Sbjct: 895 PQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVL 953

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1069 bits (2764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/901 (56%), Positives = 636/901 (70%), Gaps = 17/901 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           + +YERAI++IAKGD Y CMICT+E+D T +M+AC  CYRVFDY CIREWA+KS++K++D
Sbjct: 54  MQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 113

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           K+WKCPNC H   K+P +NRPTCWCGK VNPD NP  PNSCGQTCNA +C+H CS  CHL
Sbjct: 114 KIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICHL 173

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C RT  I C CGKH+K +FCY     K   K F+C E+C + LSCGIHKC + CH
Sbjct: 174 GPHPECTRTVEIKCRCGKHSKSIFCY---QSKAMKKHFDCQEECGLPLSCGIHKCKKKCH 230

Query: 246 SGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299
           SG CGPCPELI  +      + CYCG  + D I+C  V    SG+ SKD+ GN WIGVF 
Sbjct: 231 SGLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFA 290

Query: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359
           C  IRTV+YAC  HSF E C SPPT++G K CP+ P LLKTCPCG+T L++    R+ CT
Sbjct: 291 CKDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCT 350

Query: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419
           DPI TC +RC KPLKCGKH CPF CH+G CMDPC Q +  KC+C    F VPC F EKP 
Sbjct: 351 DPIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPH 410

Query: 420 CNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479
           CN+KCESLMS           SG+P A +RKK +F   DL+DESLVEA+HICLK CNL L
Sbjct: 411 CNIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTL 470

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           SCGIH C RKCH GKCPPCLESDS+DLVCPCGKTV+ APVRCGTKLP C + CIK + G 
Sbjct: 471 SCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGE 530

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
             CGHKP  H CHP D+ CPPCTE VFKPCKCGK+ K + +CFQ   SCG  C K L GC
Sbjct: 531 SECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGC 590

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
           HH CQ  CHLP  CQK C QIC ++R NC H C + CHG S CPD+PC    ++ C CGR
Sbjct: 591 HHTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGR 650

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGM-KSSSEDPESELERLKK 718
            ++ + CGA S   SV     L C++ C   +RL+ELR AFG+ + S+E   +EL+ LKK
Sbjct: 651 IEKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKK 710

Query: 719 IVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRN 778
           +V   T++EEL+LPF+ETVLSVY+KQ  WC QIE ++NK ++DK + SLHFKPM  PQR+
Sbjct: 711 LVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRH 770

Query: 779 FIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERKV 836
           FI  L +AY +YSESQDREP RSV++KK  N  +  P +SL EA PLY+S+K+++KERK+
Sbjct: 771 FIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKI 830

Query: 837 QSFESKKNVTYLNYQPPERSLTPDV---KYNGFLIKGITFGTTTDDLNTLFGVHLKPTLI 893
           Q F+++     +N++   R   P V   K NGFL++ +  G   DDL   F  HLK TL+
Sbjct: 831 QEFQARTTAKLINFE--VRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLV 888

Query: 894 KDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDI 953
              QY I+ DGK+A+VYP++Y  +S N ERD++ L GHFD+M KEA L +S+ +C+I + 
Sbjct: 889 VKPQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEE 948

Query: 954 L 954
           L
Sbjct: 949 L 949

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/897 (56%), Positives = 647/897 (72%), Gaps = 16/897 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           L++YE+ I+DI+KGD YTCMICTIE+D T KMYAC  CYRVFDY+CI+EWA KS+ K++D
Sbjct: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           KVWKCPNC+H+S +IPL+NRPTCWCGK +NPDPN   PNSCGQTCN K+C+H C +FCHL
Sbjct: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPH +C   TT+ C+CG++ KD+FC+ L    N+N  + C E C + L+CG+HKC RVCH
Sbjct: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKS-NKNNVYQCNEVCQLPLACGVHKCKRVCH 223

Query: 246 SGSCGPCPELIT------------KKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNT 293
           SG CG CPE+++            +K  CYCG  + ++I C  + I  +G  SK+ EG+ 
Sbjct: 224 SGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAI--TGTFSKNSEGDK 281

Query: 294 WIGVFKCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFEN 353
           WIG F C   R V YAC  HSF E C +  +ISG KICPY+PKLL +CPCGKT+L     
Sbjct: 282 WIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQ 341

Query: 354 KRQKCTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQ 413
           KR+KCTDPI TCENRC K LKCGKH CP+ CHNG CMDPC Q+E+  CSC  K F VPC 
Sbjct: 342 KRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCN 401

Query: 414 FHEKPRCNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLK 473
           F + P+C  KCESLMS           +GKP ADKRKKML ++ +L DESLVEA HICLK
Sbjct: 402 FEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLK 461

Query: 474 DCNLKLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCI 533
           +CNLKLSCGIH+CTRKCH G+CP CL SDS+DLVCPCGKTV+EAPVRCG+KLP C F CI
Sbjct: 462 ECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECI 521

Query: 534 KYIEGSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCE 593
           K IE SYPCGHKP  H CHP+  PCPPCT VV +PCKCGK    KA+CFQE  SCG++C 
Sbjct: 522 KVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICN 581

Query: 594 KKLDGCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEV 653
           K+L+ CHH CQ KCH  G+CQK C Q+CNK R NC+H C  KCHG S CPD+PC    +V
Sbjct: 582 KELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKV 641

Query: 654 YCGCGRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESEL 713
            C CGR++E   C AT    S  + ++LPCD+ C  + R  +LR+AFG  SS +     +
Sbjct: 642 SCKCGRKQEYRKCYATLDNSSASI-ELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNI 700

Query: 714 ERLKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMP 773
           + ++ ++EKV++YEEL LP+ ++V+S YSKQ  WC+QIE+++ KFV DK K +LHFKPM 
Sbjct: 701 QDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760

Query: 774 APQRNFIHALVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKE 833
             QR+F+  L  ++ +YSESQD EPKRSV++K+   TRIPNISLEE LPL+  +KK+EKE
Sbjct: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKE 820

Query: 834 RKVQSFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLI 893
           RK+Q FES     Y+NY+P E  +      NGF IK I+ G T +DL+ +FG  LK TLI
Sbjct: 821 RKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLI 880

Query: 894 KDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNI 950
           K+  Y ILP+   AI+YP+ Y +I+E+V +D+E L GHFD++ KEA++ +S+ +CN+
Sbjct: 881 KNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/897 (56%), Positives = 630/897 (70%), Gaps = 13/897 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           + +YER+I++I+KGD Y CMICT+E+D T +M+AC  CYRVFDY CIREWA+KS++K++D
Sbjct: 50  MQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVD 109

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           ++WKCPNC H   K+P  NRPTCWCGK VNPDPNP  PNSCGQTC+A  CIH CS  CHL
Sbjct: 110 RIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCHL 169

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C R   I C CGKH++ +FCY     K   K F C E+C + LSC +H C R CH
Sbjct: 170 GPHPECTRMVEIMCHCGKHSQSIFCY---QSKAMKKNFKCQEECGLPLSCSVHNCKRKCH 226

Query: 246 SGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299
           +G CGPCPELIT K      + CYCG+ +   I+CS  +   SG+ SKD  GN WIGVF 
Sbjct: 227 TGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFA 286

Query: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359
           C  IRTV+++C+ HSF E C SPP+++G K+CP+ P LLKTCPCG+T LD+    R+ C 
Sbjct: 287 CTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCD 346

Query: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419
           DPI TC +RC KPLKCGKH CPF CH+  CMDPC QI+  KC+C    FSVPC F  +PR
Sbjct: 347 DPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPR 406

Query: 420 CNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479
           CN+KCESLMS           SG+P A KR+K  F   DLLDESLVEA+HICLK CNL L
Sbjct: 407 CNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTL 466

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           SCGIH C RKCH GKCPPCLESDS+DL+CPCGKTVV APVRCGT+LP C  PCIK + G 
Sbjct: 467 SCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGE 526

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
             CGHKP  H CHP  +PCPPCTE VFKPCKCGK+ K + +CFQ+  SCG  C   L  C
Sbjct: 527 SSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFC 586

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
            H CQ  CHLPG CQK C QIC   R++C HTC + CHG + CPD+PC    ++ C CGR
Sbjct: 587 RHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGR 646

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPES-ELERLKK 718
            ++ + C A S       + VL CD+ C   +RL+ELR AFG+K  S +  S EL+ LKK
Sbjct: 647 NEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKK 706

Query: 719 IVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRN 778
           +V   T++EEL LPF+ET LSVYSKQ  WC+QIE ++NK ++DK + SLHFKPM  PQR+
Sbjct: 707 LVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRH 766

Query: 779 FIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERKV 836
           FI  L +AY +YSESQDREP RSV++KK  N  +  P +SL EALPLY+S+K+++KERKV
Sbjct: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKV 826

Query: 837 QSFESKKNVTYLNYQPPERSLTPDV-KYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKD 895
           Q F+S+     +N++  +     +V K NGFL++ +  G T +DL   F  HLK TL+ +
Sbjct: 827 QEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVN 886

Query: 896 AQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITD 952
            QY IL DGK+A+VYP++Y T S N ERD+E L GHFD+M KEA L +S+ +C+  +
Sbjct: 887 PQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDE 943

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1055 bits (2729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/900 (56%), Positives = 636/900 (70%), Gaps = 13/900 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           + +YERAI++I+ GD Y CMICT+E+D T +M+AC  CYRVFDY CIREWA+KS++K++D
Sbjct: 50  MQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVD 109

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           ++WKCPNC + S ++P++NRPTCWCGK VNPDPNP  PNSCGQTCNA +C+H CS  CHL
Sbjct: 110 RIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHL 169

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C R   I C CGKH+K +FCY     K   K FNC E C + LSC IH C + CH
Sbjct: 170 GPHPECTRMVEIMCHCGKHSKSIFCY---QSKVMKKNFNCQEVCGLPLSCSIHTCKKKCH 226

Query: 246 SGSCGPCPELIT------KKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299
            G CGPCPE+I       K++ CYCG+ T   I+CS  K   SGK SKD+ GN WIGVF 
Sbjct: 227 PGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFA 286

Query: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359
           C   R V+Y+C+ HSF E+C SPPTI+G K CP+ P  LKTCPCG+T L++    R+ C 
Sbjct: 287 CADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCD 346

Query: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419
           DPI TC++RC KPLKCGKH CPFTCH+  CM+PC QI+  KC+C    FSVPC F  +PR
Sbjct: 347 DPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPR 406

Query: 420 CNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479
           CN+KCESLMS           SG+P A +RKK LF   DLLDESLVEA+HICLK CNL L
Sbjct: 407 CNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTL 466

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           SCGIH C RKCH GKCPPCLESDS+DLVCPCG TVV APVRCGTKLP C  PCIK + G 
Sbjct: 467 SCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGE 526

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
             CGHKP  H CH  D+ CPPCTE VFKPCKCGK+ K + +CFQ   SCG  C   L  C
Sbjct: 527 STCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYC 586

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
           +H CQ  CHLPG CQK C Q C ++R+NC+H C + CHG + CPD+PC    ++YC CGR
Sbjct: 587 YHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGR 646

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPES-ELERLKK 718
            K+ + CGA S   SV  + VL C++ C   +RL+EL+ AFG+K  + +  S EL+ LKK
Sbjct: 647 IKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKK 706

Query: 719 IVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRN 778
           +V   T++EEL+LPF+E  LSVYSKQ  WC+QIE ++NK ++DK + SLHFKPM  PQR+
Sbjct: 707 LVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRH 766

Query: 779 FIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERKV 836
           FI  L +AY +YSESQDREP RSV++KK  N  +  P +SL EA PLY+S+K+++KERK 
Sbjct: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKA 826

Query: 837 QSFESKKNVTYLNYQPPERSLTPDV-KYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKD 895
           Q F+++     +N++  +     +V K NGFL++ +  G T +DL   F  HLK TL+ +
Sbjct: 827 QEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVN 886

Query: 896 AQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQ 955
            QY IL DGK+A+VYP++Y T S N ERD+E L GHFD+M KEA L +S+ +C+  + L+
Sbjct: 887 PQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELE 946

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1050 bits (2716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/895 (56%), Positives = 652/895 (72%), Gaps = 13/895 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           + +YERAI++IAKGD Y CMICT+E+D T +MYAC  CYRVFDY+CIREWA+KS++K++D
Sbjct: 50  MHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVD 109

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           ++WKCPNC H + K+P +NRPTCWCGK VNP+PNP  PNSCGQTCNA +C+H CS  CHL
Sbjct: 110 RIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHL 169

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYL--LDHGKNRNKKFNCGEKCNMTLSCGIHKCSRV 243
           GPHP+C R  TI C CGKHTKD+ CY   L  GK+   KF C E C + L+CG+H+C + 
Sbjct: 170 GPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKD---KFQCDEPCGLPLACGLHRCQKK 226

Query: 244 CHSGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGV 297
           CHSG CG CPE++  K      + CYCGS   D I+C +V +  S   S++ +G  W+GV
Sbjct: 227 CHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGV 286

Query: 298 FKCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQK 357
           FKC+ IR V+Y C  HSF E C +PPTI GTK CP+SPKLLKTCPCGKT L +    R+K
Sbjct: 287 FKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKK 346

Query: 358 CTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEK 417
           CTDPI TC++RC KPLKCG+H CPF CH GPCMDPC QI+ +KCSCN + F VPCQFH+ 
Sbjct: 347 CTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQD 406

Query: 418 PRCNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNL 477
           P+C  KCESLMS           +G+P A+ RKK LF   DL+DESLVE +HICLK+CNL
Sbjct: 407 PQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNL 466

Query: 478 KLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIE 537
            LSCG H C RKCH GKCPPCLESDS+DLVCPCG+T++EAPVRCGTKLP C +PCIK + 
Sbjct: 467 MLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVR 526

Query: 538 GSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLD 597
           G YPCGH P  H CHP + PCPPCT  VFKPCKCGK  K + LCFQ   SCGK+C   L+
Sbjct: 527 GEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLE 586

Query: 598 GCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGC 657
            C+H CQ +CHL GECQK C QIC K+R+NC HTC + CHG ++CPDIPC V  ++ C C
Sbjct: 587 NCNHTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCEC 646

Query: 658 GRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLK 717
           GR++  + CGATST  S      + CD+ C   +R  +L+ AFG+  S+     E+E+LK
Sbjct: 647 GRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLK 706

Query: 718 KIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQR 777
            + +  T++EEL+LP++ET LS+Y+KQ  WC+QIEE++NK ++DK +PSLHFKPM  PQR
Sbjct: 707 DLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQR 766

Query: 778 NFIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERK 835
           +FI    +++ +Y+E+QDREPKRSV++KK  +  +  P ISL +ALPLYQ++K++EKERK
Sbjct: 767 HFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERK 826

Query: 836 VQSFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKD 895
           ++ FE++     +N + P+       KY+GFLIK I+ GTT +DL  +FG  L  TLI +
Sbjct: 827 LKEFEARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVN 886

Query: 896 AQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNI 950
            QY I+ DGK A++YP++Y  +S  VERD+E+L GHFD+++KE  + + VE+C++
Sbjct: 887 PQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDV 941

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/900 (55%), Positives = 631/900 (70%), Gaps = 19/900 (2%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           L +YERAI++IAKGD Y CMICT+E+D T +M+AC  CYRVFDY CIREWA+KS++K++D
Sbjct: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           K+WKCPNC H   K+P +NRPTCWCG  VNPDPN   PNSCGQTCNA +C+H C   CHL
Sbjct: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C R   I C CG+H+K +FCY     K   ++FNC E+C ++LSCG+HKC + CH
Sbjct: 175 GPHPECTRMVEIKCHCGRHSKTIFCY---QSKAMRRRFNCQEECGLSLSCGVHKCKKKCH 231

Query: 246 SGSCGPCPELIT------KKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299
           SG CG CPE I       K++ CYCG+   + I+CS  +   SG+ SKD+ GN W GVF 
Sbjct: 232 SGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFA 291

Query: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359
           C  IRTV+YAC  HSF E C SPPTISG K CP+ P LLKTCPCG+T L++    R+ C 
Sbjct: 292 CADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCH 351

Query: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419
           DPI TC +RC KPLKCGKH CPFTCH+G CMDPC QI+   CSC    FS+PC F E PR
Sbjct: 352 DPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPR 411

Query: 420 CNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479
           CN+KCESLMS           SG+P A +RKK  F   DLLDESLVEA+HICLK CNL L
Sbjct: 412 CNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTL 471

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           SCG+H C RKCH GKCPPCLESDS+DL+C CGKTVV APVRCGTKLP C  PCIK + G 
Sbjct: 472 SCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGE 531

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
             CGHKP  H CHP++I CPPCTE VFKPC+CGK+ K + +CFQ   SCG  C   L GC
Sbjct: 532 SWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGC 591

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
           +H CQ  CHL G+CQK C QIC ++R++C HTC + CHG + CPD+PC    ++ C CGR
Sbjct: 592 YHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGR 651

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDP----ESELER 715
            K+ + C A   T SV  + +L C++ C   +RL+ELR AFG+   SE P     +EL+ 
Sbjct: 652 IKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGV---SEGPNNVIRNELDA 708

Query: 716 LKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAP 775
           L ++V    ++EEL+LPF+E  LSVYSKQ  WC QIE ++NK ++ + + SLHFKPM  P
Sbjct: 709 LSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPP 768

Query: 776 QRNFIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKE 833
           QR+FIH + +AY +Y+ESQDREP RSV++KK  N  ++ P +SL EA PLY+S+K+ +KE
Sbjct: 769 QRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKE 828

Query: 834 RKVQSFESKKNVTYLNYQPPE-RSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTL 892
           RK+Q F+++     +N++  +  S     K NGFL++ +  G T +DL   F  HLK TL
Sbjct: 829 RKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTL 888

Query: 893 IKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITD 952
           + + QY IL D +SA++YP++Y T S N ERD+E L GHFD+M KEA L +S+ +C++ +
Sbjct: 889 VANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDE 948

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/893 (54%), Positives = 631/893 (70%), Gaps = 11/893 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           + +YERA+++IA GD Y CMICT+E+D T KMYAC  CYRVFDY+CIREWA+KS++K+LD
Sbjct: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           +VWKCPNC   + ++P +NRPTCWCGKTVNPDPNP  PNSCGQTC+A  C H CS  CHL
Sbjct: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP C RT T  C+CGKHT++ FCY     K +++ F C E C + L+CGIHKC R+CH
Sbjct: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQ-FQCNEVCGLPLACGIHKCERLCH 216

Query: 246 SGSCGPCPELITKKVN-----CYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKC 300
           SG CGPCP ++  K N     CYCG    D  +C +V++  +   SKD +G++WIG F C
Sbjct: 217 SGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDSWIGAFGC 274

Query: 301 NKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTD 360
           + IR +EYAC+ HSF E C   P+ISG   CP+SPKLLKTCPCG+T+L      R+ CT 
Sbjct: 275 SGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTS 334

Query: 361 PISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRC 420
           PI  C++ C K L CG+H CPFTCH+GPCMDPC QIE  +CSC+   +SVPCQF E+PRC
Sbjct: 335 PIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRC 394

Query: 421 NMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLS 480
           + KCESLMS            G+P A++R+K   S  +L+DES VE+EHICLKDCNL LS
Sbjct: 395 DTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLS 454

Query: 481 CGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSY 540
           CG H C RKCH GKCPPCLESDS+DLVCPCGKTVVEAPVRCGT+LP C +PCI+ I+ +Y
Sbjct: 455 CGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAY 514

Query: 541 PCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCH 600
            CGHKP  H CHP + PCP CT  VFKPCKCGK+ K + LCFQ   SCG  C K LD C 
Sbjct: 515 KCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCP 574

Query: 601 HYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRR 660
           H CQ  CH+PGECQKKC QICN++R+ C H C   CHG+  CPDIPC +  ++ C C  +
Sbjct: 575 HMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVK 634

Query: 661 KELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDP-ESELERLKKI 719
           +  + CGA S T S   T +LPCD+ C +++R  +LR AFG+ + S++P  S+   L+ +
Sbjct: 635 ESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENL 694

Query: 720 VEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNF 779
                S+EELELPFSE  L  ++KQ  WC QIE ++N F++++ K SLHFKPM   QR+F
Sbjct: 695 AAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHF 754

Query: 780 IHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERKVQ 837
           IH L ++Y +Y ESQDREPKRSV++KK  N  +  P I L+++LP+YQ +K+ EKE+K Q
Sbjct: 755 IHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQ 814

Query: 838 SFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQ 897
            FE++    ++N+ P E       K N F +K ++ GTT +DL  +F  HLKPTL+K+ Q
Sbjct: 815 RFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQ 874

Query: 898 YSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNI 950
           + I    K+ ++YP+DY  IS NVERD+E+L GHFDY+ KE+ +G+ +E+C+I
Sbjct: 875 FKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHI 927

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/898 (55%), Positives = 635/898 (70%), Gaps = 12/898 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           LM+YERA+++IAKGD Y CMICT+E+D T KMYAC HCYRVFDYDCIREWA+KS+QK++D
Sbjct: 69  LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTVD 128

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           K WKCPNC H+S K+PL++RPTCWCGK VNPDPNP  PNSCGQTCNA  C H+C   CHL
Sbjct: 129 KTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQCHL 188

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           G HP+C +   I C CG+ TKD++C+     + +   F+C ++C +TL CGIHKC R CH
Sbjct: 189 GSHPECTQLLKITCRCGRETKDIYCH---ESRRQKSIFHCDQECGLTLPCGIHKCRRKCH 245

Query: 246 SGSCGPCPEL-----ITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKC 300
           SG CG CPEL     ++ K+ CYCG  ++ ++ C +V    SGK S++QE   W+G+F C
Sbjct: 246 SGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDC 305

Query: 301 NKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTD 360
            ++R+V Y C  H F E C +PPT+  T +CP+SP LLKTCPCGKT L D + +R KCTD
Sbjct: 306 KEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTD 365

Query: 361 PISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRC 420
           PI TC+N C+K LKCGKH+CPFTCH G CMDPC QI+   C+C  + F VPCQF  KP C
Sbjct: 366 PIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVC 425

Query: 421 NMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLS 480
             KCESLMS           SG+P A++RKK +   +D  DE+LVEAEH+CLKDCNLKLS
Sbjct: 426 KFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLS 485

Query: 481 CGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSY 540
           CGIH C RKCH G CPPCLESDS+DLVCPCGKTV+ APVRCGT LP C +PCIK I G  
Sbjct: 486 CGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGES 545

Query: 541 PCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCH 600
            CGHKP  H CH  D PCP CT  VFKPCKCGK+ K + +CFQE  SCG  C   L  C+
Sbjct: 546 DCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCY 605

Query: 601 HYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRR 660
           H CQ +CHLPGECQ  C QICN +R NCSH C Q+CH ++ CPDIPC V   V C CGRR
Sbjct: 606 HKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRR 665

Query: 661 KELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESE--LERLKK 718
           K +  C +TST  SV +T  L CD+ C+   R  EL+ AFG+ +   D ++   +ER++ 
Sbjct: 666 KLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIERIQN 725

Query: 719 IVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRN 778
            +    +YEELELPF E VL+VY+KQ  WC+QIE ++NKF+++K K SLHFK M APQR+
Sbjct: 726 RISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRS 785

Query: 779 FIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERKV 836
           F+H L +AY++YSESQD EP RSV++KK  N  +  P ++LEEALPLY+S+K+++KE+K 
Sbjct: 786 FVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKKK 845

Query: 837 QSFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDA 896
           Q +E++ + T +N +   ++     KYNGFLIK +  GTT +DL  +FG  LKPTL+KD 
Sbjct: 846 QEYEARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKDP 905

Query: 897 QYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954
           QY ++ +     + P DY  IS NVERD+E L G FD + KE  +G+ VE+CNI + L
Sbjct: 906 QYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEAL 963

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/904 (54%), Positives = 624/904 (69%), Gaps = 18/904 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           L +YERA+++IAKGD YTCMICT+E+D T KM+AC  CYRVFDYDC+REWA+KS+ K++D
Sbjct: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           ++WKCPNC   + K+P +NRPTCWCGK VNP+PNP  PNSCGQTC+AK CIH CS  CHL
Sbjct: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C RTT++ C CGK TK++ C+     + RN  F C E CN  L CGIH+C ++CH
Sbjct: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNL-FQCNEPCNSLLPCGIHRCQKICH 229

Query: 246 SGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299
           SG CG CPE +T K      ++CYCG  T + I+C +V +  +G+KSK+  G+ WIGV+ 
Sbjct: 230 SGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYA 287

Query: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359
           C  IR+VEY+C+ HSFFE C +PPT++GTK CP+SPK LKTC CGKT L      R++C 
Sbjct: 288 CKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCI 347

Query: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419
           DPI  CE+RCDK LKCGKH CPF CH+GPCMDPC QI+  KC+C    F VPC F   P 
Sbjct: 348 DPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPH 407

Query: 420 CNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479
           C +KCESL+S           SG+P A++R+K      D+ DE+L+EAEH+CLK CNL L
Sbjct: 408 CQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTL 467

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           SCG H C RKCH GKCPPCLESDS+DLVCPCGKT+V APVRCGTKLP C  PCIK +EG 
Sbjct: 468 SCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGI 527

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
             CGHKP  H CHP D PCPPCT  VFKPCKCGK  + + +CFQ+  SCG+ C K L  C
Sbjct: 528 SECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNC 587

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
           HH+CQ  CHLPG+CQ  C Q+CNK  VNC+H C + CHG   CPDI C    ++ C CGR
Sbjct: 588 HHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGR 647

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGM----KSSSEDPESELER 715
           ++  + CGATST  S   T+ L CD+ C  Y R  +L+ AFG+     + S   E E  R
Sbjct: 648 KEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTR 707

Query: 716 LKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAP 775
           L+ +  K T++EEL+ PF+E+ +S Y +Q  WC +IEE +N F++++ K SLHFKPM  P
Sbjct: 708 LEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPP 767

Query: 776 QRNFIHALVEAYEMYSESQDREPKRSVYLKKNK--YTRIPNISLEEALPLYQSYKKIEKE 833
           QR FI  L +AY +YSE+QD EPKRSV++KKN    +  P  SL E  PLYQS+K +EKE
Sbjct: 768 QRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKE 827

Query: 834 RKVQSFESKKNVTYLNYQPPERSLTP---DVKYNGFLIKGITFGTTTDDLNTLFGVHLKP 890
           RK+Q F +K     +N +  +   T      + N FLIK I+ GTT  DL  LFG +++ 
Sbjct: 828 RKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEK 887

Query: 891 TLIKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNI 950
           TLI++ QY  LP+  SAIVYP+DY TIS N   D+E+L GH +++  +A L +S E+C+ 
Sbjct: 888 TLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDA 947

Query: 951 TDIL 954
           +  L
Sbjct: 948 SSKL 951

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/899 (54%), Positives = 623/899 (69%), Gaps = 15/899 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           +M+YERAI++IA GD Y CMICT+E+D T KMYAC  C R+FDYDCIREWA+KS++K+ +
Sbjct: 53  MMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKE 112

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           ++WKCPNC H + K+P +NR TCWCGK VNP+ NP  PNSCGQTCNA  CIH CS  CHL
Sbjct: 113 RIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHL 172

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C RT T+ C+CGKH + + C+       R  +F+C E+C + LSCGIH C + CH
Sbjct: 173 GPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCH 232

Query: 246 SGSCGPCPELIT------KKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299
           SG CG CPEL+         + CYCG  T     C +VK   +   S+D EGN W+GVF 
Sbjct: 233 SGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVGVFS 290

Query: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359
           CNKIR VEY+C+ HSF E+C +PPT+SGTK CP+SP LLKTCPCG+T L+     R KCT
Sbjct: 291 CNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCT 350

Query: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419
           DP+ TCE  C+KPLKCGKH+CPFTCHNGPCMDPC QI+ + CSC+   F  PCQF  +P 
Sbjct: 351 DPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPH 410

Query: 420 CNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479
           CN+KCESLMS           SG+P+A+KRKK LF  +D+ DE+LVEA+H+CLK+CNL L
Sbjct: 411 CNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLML 470

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           SCG H C RKCH GKCPPCLESDS+DLVCPCGKTVVEAPVRCGTKL  C+FPCIK I   
Sbjct: 471 SCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNE 530

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
             CGH P  H CHP D PCPPCT  VFKPCKCGK  K + +CFQ+  SCGK+C   L  C
Sbjct: 531 SVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTC 590

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
           HH CQ  CH  GECQ KC Q+C K+RVNC H C + CHG + C D PC V  ++ C CGR
Sbjct: 591 HHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCGR 650

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKI 719
           R+  + C ATST  S  L   L C++ C   +R  ELR AFG+    E      ERL+  
Sbjct: 651 RESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSF 710

Query: 720 VEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNF 779
            +  T+Y++L+LP++E  L  Y+KQ NWC QIEEL+ KF++D ++PSLHFKPM  PQR F
Sbjct: 711 AQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYF 770

Query: 780 IHALVEAYEMYSESQDREPKRSVYLKKNK--YTRIPNISLEEALPLYQSYKKIEKERKVQ 837
           IH + +A+ +Y+ESQDREPKRSV+LKKN    +  P + L + LP+YQ++KK+EKERK +
Sbjct: 771 IHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAK 830

Query: 838 SFESKKNVTYLNYQPPERSLTPDVKY--NGFLIKGITFGTTTDDLNTLFGVHLKPTLIKD 895
            FE++     +N    + +L    K+  NG +IK ++ G T + L+  F    K TLIK+
Sbjct: 831 QFEARTTARLMNIT-LDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKN 889

Query: 896 AQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954
            QY I+ +  + ++YP+ +  I++ V  D++ L GHF+ + KE ++G+SVEMCNI + L
Sbjct: 890 PQYLIIEN--NGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENEL 946

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/898 (52%), Positives = 613/898 (68%), Gaps = 16/898 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           +M+YERA+K+IA+GD Y CMICT+E+D T KM+ACS CYRVFDYDCIREWA+KS+ +++D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           K WKCPNC   SNK+P ++RPTCWCGK VNPDPNP  PNSCGQTC+A  C H CS  CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C R  +I C+CG+HT+DV C  +  G  RN++F C E C + L CG+HKCS+ CH
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEV--GSGRNQQFTCEESCGLLLPCGVHKCSKKCH 233

Query: 246 SGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299
           SG CG C E +  K      + CYCG      IRC +V++ D  + S D +GN WIGVF+
Sbjct: 234 SGLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVAD--RDSVDDQGNGWIGVFR 291

Query: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359
           C  +R VEYAC  HSF E+C   P++     CP+SP +L++CPCG+T L+     R KCT
Sbjct: 292 CKDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCT 351

Query: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419
           D I TCE++C K L CGKH CP+ CH G CMDPC Q E   C C  + F VPCQF E PR
Sbjct: 352 DHIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPR 411

Query: 420 CNMKCESLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479
           CN KCESLMS           SGKP A++RKK  F+  +LLDESLVEAEH+CLK CNL L
Sbjct: 412 CNTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTL 471

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           +CG H C RKCH G+CPPCLESD +DLVCPCGKTVVEAPVRCGTKLP C + CI  +   
Sbjct: 472 TCGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDG 531

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
           YPCGH P  H CHP +  CPPCT  V KPCKCGK+   + LCFQ+  SCG++C K L  C
Sbjct: 532 YPCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSC 591

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
            H CQ KCH  G CQ KC QIC K+RVNC H C + CHG   CPD PC     + C CGR
Sbjct: 592 RHTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGR 650

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKI 719
           ++    CG  S T S  +T+ L CD+ C + +R  +L++A G+K   E+ +S +E     
Sbjct: 651 KESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLK---ENGDSSVENTVSN 707

Query: 720 VEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNF 779
               +++EEL LPF ETVL++YS+Q  +C+ IE ++N F++D+ K SLHFKPM   QR+F
Sbjct: 708 ALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767

Query: 780 IHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERKVQ 837
           +H L +AY++YSESQD EPKRSVY+KK  N  +  P+I+L+EALP+YQ++K+ EKE K++
Sbjct: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827

Query: 838 SFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQ 897
            +E +     +N+ P         KYNGFLI+ +T GT  +DL  ++G HLKPTL+++  
Sbjct: 828 RYEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPV 887

Query: 898 YSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQ 955
           Y  LPD   A+++P+ Y  ++ N E D+E L GHFD++ KE  +G+ VE+C + + LQ
Sbjct: 888 YKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQ 945

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/887 (53%), Positives = 589/887 (66%), Gaps = 8/887 (0%)

Query: 68  HYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLDKV 127
           +YE+ IK+IAKGD Y CMICT+E+D T  MYAC  CYRVFDY+CIREWAVKS+QKS+ K 
Sbjct: 63  YYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTKT 122

Query: 128 WKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHLGP 187
           WKCPNC      +PL+NRPTCWCGK ++P+PNP  PNSCGQTC+A  C+H CS  CHLGP
Sbjct: 123 WKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLGP 182

Query: 188 HPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCHSG 247
           HP C R     C CGK +KDVFC      +   + F CG  C +TL CG+HKC R CH+G
Sbjct: 183 HPTCMRMVQTKCRCGKKSKDVFC---SEARKHQELFRCGNPCGLTLPCGVHKCQRECHNG 239

Query: 248 SCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRTVE 307
            CG CPE I K++NCYCG  ++  I+C +VKI     KS+D  G  WIG F C++IRTVE
Sbjct: 240 VCGECPETIAKEINCYCGLESLPSIKCQDVKIQS---KSQDGSGKKWIGAFACSRIRTVE 296

Query: 308 YACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPISTCEN 367
           Y+C+ HSF E C +PP+I+G   CPYSPK LKTCPCG+T L++ E  R KCTDPI TC+ 
Sbjct: 297 YSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTCDA 356

Query: 368 RCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKCESL 427
            C K L CG+H+CPF CH G CM+ CT  +  KCSCN + F VPC+F   PRCN KCESL
Sbjct: 357 TCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCESL 416

Query: 428 MSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGIHNCT 487
           MS            G+ +A  R+K +F   D LDESLVEA+HICLK CNLKLSCG H C 
Sbjct: 417 MSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCGRHFCQ 476

Query: 488 RKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGHKPG 547
           RKCH G CPPCLESDS+DLVCPCGKTV  APVRCGT LP C  PCIK ++G   CGH P 
Sbjct: 477 RKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHPPM 536

Query: 548 NHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCHHYCQLKC 607
            H CH  D PCP CT  VFK CKCGK +K + LCFQ   SCG++C K+L  CHH C   C
Sbjct: 537 PHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHSCTKTC 596

Query: 608 HLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKELLLCG 667
           H  GECQ  C Q+C   R NCSH C  KCH  S CPD+PC V  EV CGCG R     C 
Sbjct: 597 HREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFATCA 656

Query: 668 ATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEKVTSYE 727
           A       +  + L C + C   +R  EL  AFGM + +  P   +  L  + EKVT+++
Sbjct: 657 AHEGQDPAD-QRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDLAALAEKVTTFQ 715

Query: 728 ELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHALVEAY 787
           EL LPF+E  LS+++KQ+NWC+QIEE +N+ ++D +KPSLHFKPM  PQR+FIH L +AY
Sbjct: 716 ELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQAY 775

Query: 788 EMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKVQSFESKKNVTY 847
           ++Y ESQD+EPKRSVY+KK   +R P++SL+EALPLYQS+K  +KERK++  E       
Sbjct: 776 KLYCESQDKEPKRSVYVKKTVDSRKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTRI 835

Query: 848 LNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSILPDGKSA 907
           LNY     S  P  + NG LI+ +  GT    +   F  +LK TLIKD  Y  L D    
Sbjct: 836 LNYTSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKL-DSGDV 894

Query: 908 IVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954
           +V+ ++Y T S NVERDI  + GH D + K++ L E V +C +  ++
Sbjct: 895 MVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVM 941

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/901 (53%), Positives = 616/901 (68%), Gaps = 17/901 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           + +YE+A+++I KGD Y+C+ICT+ELD T K+YAC  CYRV+DY+CIREWA KS+ K  D
Sbjct: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           K+W CPNC +T   IP +NRPTCWCG+ VNP+PNP  PNSCGQTCNAK C H CS  CHL
Sbjct: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPH +C R  +I C CGK TKD+ C+     +  +K FNC   C+  L CGIHKC+R CH
Sbjct: 179 GPHQECTRMMSIKCSCGKVTKDIVCF---QRRLYSKGFNCETVCDKLLPCGIHKCNRKCH 235

Query: 246 SGSCGPCPELITKK-----VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKC 300
           +G CG CPE I  K     + CYCG T+ DKI+C +V+   +   SKD +G  WIGVF C
Sbjct: 236 TGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMC 295

Query: 301 NKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTD 360
           +KIR V Y C  HSF+E C +PP+ISG  IC +SPK LKTCPCGK  L D    R KCTD
Sbjct: 296 DKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTD 355

Query: 361 PISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRC 420
            I TC   C K LKCGKHKCPF CH G CMDPCTQIE  +C+C  K+F++PC F++  RC
Sbjct: 356 AIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARC 415

Query: 421 NMKCESLMSXXXXXXXXXXXSGKPMADKRKK-MLFSQADLLDESLVEAEHICLKDCNLKL 479
           N+KCESLMS           +G+P+A++R+K M  +  DL DES +E  HICLKDCNL L
Sbjct: 416 NLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTL 475

Query: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539
           SCGIH C RKCHAGKCPPCLESDS+DLVCPCGKT+VEAPVRCGTKLP C +PCI+ + G 
Sbjct: 476 SCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGE 535

Query: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599
             CGH P  H CHP DIPCP CT  VFKPCKCGKEQ+ + +CF +  SCGK+C ++L  C
Sbjct: 536 TDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTC 595

Query: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659
           +H CQ KCH PG CQ  C Q CN  R+ C+H C + CH    CPDIPC    ++ C CGR
Sbjct: 596 YHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGR 655

Query: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPES-ELERLKK 718
            ++ + CG  S  +  + +  + CD+ C   QR  +L+ AFG+    ++  + E+ RL++
Sbjct: 656 IEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQ 715

Query: 719 IVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRN 778
           ++   +++ +L+LPF+E V++ Y +  NWC  IE  +NK ++D N+ SLHFKPM  PQR 
Sbjct: 716 VISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRY 775

Query: 779 FIHALVEAYEMYSESQDREPKRSVYLKKN--KYTRIPNISLEEALPLYQSYKKIEKERKV 836
           FI  L +AY +YSESQD EP RSV++KKN    +  P +S+ EA PLYQSYKK+EKE+K 
Sbjct: 776 FIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQ 835

Query: 837 QSFESKKNVTYLNYQP---PERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLI 893
            +FES      +N+ P   PE  L    ++NGFL+  +   T+TDDL  LF  +LK TL+
Sbjct: 836 ANFESMTTTRLINFTPEMSPE--LESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLV 893

Query: 894 KDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDI 953
            + Q+ ILP+ K A++YP  Y  IS NVERD+E+L  HFD++ KE++L   VE+CNI ++
Sbjct: 894 VEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENV 953

Query: 954 L 954
           L
Sbjct: 954 L 954

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/892 (54%), Positives = 606/892 (67%), Gaps = 12/892 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           L +YE+ I +I KGD Y CMICT+E+D T  MYAC  CYRV+D++CIREWA+KSSQKSLD
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           K WKCPNC + +++IP++NR TCWCGK V+P+ NP  PNSCGQTCNA  C H CS  CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C RTT + C CGKHTKD+FCY     +     + CGE CN+ L CG+HKC R CH
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCY---QSEEEKASYQCGEPCNLLLPCGVHKCQRKCH 224

Query: 246 SGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRT 305
           SG CG C E I+ K+ CYCG  T ++I C +VK   S  KSK++ G  WIGVF C  +R+
Sbjct: 225 SGPCGNCEETISGKIMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAHLRS 281

Query: 306 VEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPISTC 365
           VEY+C +HSF E+CT+PPT SG   CP+SP+LLKTCPCG T L   E  R+KCTDPI TC
Sbjct: 282 VEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTC 341

Query: 366 ENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKCE 425
           ENRC+KPLKCGKH CPF CH+GPCMDPC  ++   CSC+ K F VPCQFH++  CN KCE
Sbjct: 342 ENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCE 401

Query: 426 SLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGIHN 485
           SLMS           SG+ +A KR+K +F   D LDESLVEA+HICLK CNLKLSCGIH 
Sbjct: 402 SLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHY 461

Query: 486 CTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGHK 545
           C RKCH GKC PCLESDS+DL CPCGKTVV APVRCGTKLP C  PCIK ++    CGH 
Sbjct: 462 CRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHP 521

Query: 546 PGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCHHYCQL 605
           P  H CH  + PCP CT  ++K CKC K +K + LCFQ   SCGK+C   L  C H C+ 
Sbjct: 522 PMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKR 581

Query: 606 KCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKELLL 665
            CH PG+CQ  C QIC   R  C H C  +CH   +CPD  C+VK +V C CGR++ +L 
Sbjct: 582 TCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILP 641

Query: 666 CGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEKVTS 725
           C A +   S +L   LPCDD C + +R   L  AFG+K     P   +E L+ +VE   S
Sbjct: 642 CDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAP---VEELRDLVESAKS 698

Query: 726 YEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHALVE 785
           ++EL LPF+E+ LSVYSKQ  WCNQIE  ++K + D  + SLHFKPM  PQR FIH L  
Sbjct: 699 FDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELAN 758

Query: 786 AYEMYSESQDREPKRSVYLKK-NKYTRIPNISLEEALPLYQSYKKIEKERKVQSFESKKN 844
           AY +YSESQDREPKRSV++KK    + IP + L EALPLY S+K+++KERKV+  E    
Sbjct: 759 AYALYSESQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTT 818

Query: 845 VTYLNYQPPERSLTP-DVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSILPD 903
               NY   + +  P + ++N FL+KG+  G T D+L+     +L+ TLI++  Y  L +
Sbjct: 819 RRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLEN 878

Query: 904 GKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQ 955
           G   ++YP+D+++ISENVE DI+ LA +   + KE  + E V++  I + L+
Sbjct: 879 G-DFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLK 929

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/888 (51%), Positives = 585/888 (65%), Gaps = 9/888 (1%)

Query: 68  HYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLDKV 127
           +YE+ +K+I KGD Y CMICT+E+D T  MYAC  CYRVFD++CIREWA+KS+QKS+ K 
Sbjct: 45  YYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKT 104

Query: 128 WKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHLGP 187
           WKCPNC     ++P++NRPTCWCGK+V P+PNP  PNSCGQTC+A+ C H CS  CHLGP
Sbjct: 105 WKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGP 164

Query: 188 HPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCHSG 247
           HP C R   + C CGK  K VFC+  + GK  +  F C   C +TL CGIHKC R CHSG
Sbjct: 165 HPTCMRMVQVKCNCGKKNKSVFCH--EAGKFVDS-FICDSPCGLTLPCGIHKCQRKCHSG 221

Query: 248 SCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRTVE 307
            CG CPE I   +NCYC   +   ++C+ V+I     +S+D  GN W+G F C  IRTVE
Sbjct: 222 ICGECPESIYGTINCYCKLESKPSLKCTEVRIEG---RSRDSSGNKWVGAFSCENIRTVE 278

Query: 308 YACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPISTCEN 367
           ++CK HSF E C +PP+ISG   CP+SP+ LKTCPCG++ L + +  R +CTDPI TC++
Sbjct: 279 HSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDS 338

Query: 368 RCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKCESL 427
            C K L+CGKHKCPF CH G CM+ C   +  KCSC+ ++F VPC+F EK RCN KCE+L
Sbjct: 339 VCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEAL 398

Query: 428 MSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGIHNCT 487
           MS            G+ +A  R+K +F   D LDESLVEA+HICLK CNLKLSCG H C 
Sbjct: 399 MSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCK 458

Query: 488 RKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGHKPG 547
           RKCH G C PCLESDS+DLVCPCGKTVV APVRCGT LP C+ PCIK ++G  PCGH P 
Sbjct: 459 RKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPM 518

Query: 548 NHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCHHYCQLKC 607
            H CHP + PCP CT  VFK CKC K  K + LCFQ   SCG++C K+L GC H CQ  C
Sbjct: 519 PHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKAC 578

Query: 608 HLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKELLLCG 667
           H  GECQ  C Q C K R NC H C   CH  + CPD PC    ++ C CG R   + CG
Sbjct: 579 HKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCG 638

Query: 668 ATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEKVTSYE 727
           A       E T  L C++ C   +R  EL  AFG+K+ +      LE L+ + EKV++++
Sbjct: 639 ANENRAPAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQ 697

Query: 728 ELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHALVEAY 787
           EL LPFSE  LS++SKQT WC QIEE + + +NDKNKPSLHFKPM  PQR+FIH L +AY
Sbjct: 698 ELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAY 757

Query: 788 EMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKVQSFESKKNVTY 847
            +Y ESQD+EPKRSV++KK   ++ P+ISL+ ALPLY S+K  ++E+K++  E       
Sbjct: 758 HLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRI 817

Query: 848 LNYQPPERSLT-PDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSILPDGKS 906
           +NY   +++ T P  ++NG L++ +  G     +   F  +LK TL+KD  Y +L  G  
Sbjct: 818 INYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASG-D 876

Query: 907 AIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954
            +VY  DY T S NVE DIE + GH D++ KE +L E V    +   L
Sbjct: 877 VLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL 924

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/891 (50%), Positives = 572/891 (64%), Gaps = 13/891 (1%)

Query: 68  HYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLDKV 127
           +YE+ +K+I  GD Y CMICT+ELDST +MYAC  CYRVFDY+C+REWA+KS+ K+LDK 
Sbjct: 34  YYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDKS 93

Query: 128 WKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHLGP 187
           WKCPNC   ++KIP Q R TCWCGK VNPD N   PNSCGQTCNA SC+H CS  CHLGP
Sbjct: 94  WKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGP 153

Query: 188 HPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCHSG 247
           HP+C     I C+CGKH K + C      K     +NCG+ C + L CG H C + CH+G
Sbjct: 154 HPECLIPVQIKCKCGKHCKQIPC---SRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210

Query: 248 SCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRTVE 307
            CGPC  +I  ++ CYCGS     I+CS++++ D    SKD  G  WIGV+ C ++RT+ 
Sbjct: 211 FCGPCESIIKTELPCYCGSDVKSGIQCSDLRVLDY---SKDVSGKKWIGVYSCGEVRTLH 267

Query: 308 YACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPISTCEN 367
           Y+C +H++ E C +P  I  ++ CP+SPK LKTCPCGKT L + +  R+KCTD I TC N
Sbjct: 268 YSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSN 327

Query: 368 RCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKCESL 427
            C K L CGKH CPF+CH G CMDPC  I    C+C+ K F  PCQ H+ PRCN+KCES 
Sbjct: 328 VCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESN 387

Query: 428 MSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGIHNCT 487
           MS           SGKP A KR+K LF + DL +E+LVE EH+CLK CNLKLSCGIH+CT
Sbjct: 388 MSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCT 447

Query: 488 RKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGHKPG 547
            KCH GKCPPCLESD +DLVCPCGKTVV APVRCGTKLP C  PCIK  EG  PCGH+ G
Sbjct: 448 WKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVG 507

Query: 548 NHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCF--QETASCGKLCEKKLDGCHHYCQL 605
            H CHPA   CPPCT  V K C+C K+   + LC       +CG  C   L  CHH CQ 
Sbjct: 508 PHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQK 567

Query: 606 KCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKELLL 665
           KCH+ GEC+ KC + C  +R  C H C +KCHG+S CP+  C  K  + C C RR + + 
Sbjct: 568 KCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVE 627

Query: 666 CGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEKVTS 725
           CGAT  TQS   T+ LPCD+ C K QR  EL  AFGM   +E P++  E+L+ IV     
Sbjct: 628 CGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGM---NEKPKNTKEQLESIVLVAKK 684

Query: 726 YEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHALVE 785
           +++L +P+SE VL+VY KQ NWC+QI  + +KF+ D  K SLH KPM  PQR FI  L  
Sbjct: 685 FDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELAS 744

Query: 786 AYEMYSESQDREPKRSVYLKK-NKYTRIPNISLEEALPLYQSYKKIEKERKVQSFESKKN 844
           AY +YSESQDREP RSVYLKK    ++ P ++L++A  LYQ +K +EKER  + + +K  
Sbjct: 745 AYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVT 804

Query: 845 VTYLNYQPPERSL-TPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSILPD 903
            T +N    E  L  P    N  +I G+   +  D++  L    LK TL+K  QY  L D
Sbjct: 805 KTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKD 864

Query: 904 GKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954
             S +++P++Y  I++N   D+E +        ++ ML   VEMC + + L
Sbjct: 865 LNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/890 (49%), Positives = 561/890 (63%), Gaps = 17/890 (1%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           L +YE+AIKDI  G  Y C+ICT+E+DST +MYACS+CYRV+DY+CI EWA KSS++S D
Sbjct: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
             WKCPNC H+ NK+  + R TCWCGK +NP+ N  YPNSCGQTC A  C H C+  CHL
Sbjct: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPHP+C     + C+CGK T+ + CY     K    K +C   C + L CG+H C ++CH
Sbjct: 148 GPHPKCMVPVGLKCKCGKITEQISCY---QTKAVKPKLSCKLPCGLPLPCGVHTCQKICH 204

Query: 246 SGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRT 305
           SG CG C  +++ K  CYCGS  +D I C +V +    K S+  +   WIGVF C  IR 
Sbjct: 205 SGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAV---TKMSRSGKHKKWIGVFSCKNIRE 261

Query: 306 VEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPISTC 365
           V Y CK HSF E+C   P+      CPYSP + KTC CG T L D + KR+KCTDPI TC
Sbjct: 262 VRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTC 321

Query: 366 ENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKCE 425
           + RC KPL CGKH CP TCH G CMDPC QIE RKCSC  + F  PCQF  KP CN+KCE
Sbjct: 322 DQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCE 381

Query: 426 SLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGIHN 485
           +LMS           SGKP+A  R   +    D  DESL+EAEHIC K+CN KLSCG+H+
Sbjct: 382 NLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLHH 441

Query: 486 CTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGHK 545
           CT KCH GKCPPCLESDS+DLVCPCGK+V+ APVRCGT  P C +PCI  + GS PCGH+
Sbjct: 442 CTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHR 501

Query: 546 PGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCHHYCQL 605
              H CHP+   CPPCT  V+KPCKCGK   A+ +CFQ   SCG+ C  KL  CHH CQ 
Sbjct: 502 APFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLCQK 561

Query: 606 KCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKELLL 665
           +CH PGEC   CT++C  +R  C H C   CHGD  CPD+PC  +  V CGCGRR   + 
Sbjct: 562 QCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVP 621

Query: 666 CGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEKVTS 725
           CGA    +S   T+ L CDD C K Q+ + L        SSE           ++ K TS
Sbjct: 622 CGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTL---RSSESTNKAEHGSSSVINKPTS 678

Query: 726 YEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHALVE 785
           YE+L LP+SE ++ V+SKQ  WC  I++ + + + DK++ SLHFKPM APQR F+H L +
Sbjct: 679 YEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSK 738

Query: 786 AYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKVQSFESKKNV 845
           A+ +YSESQDREPKRSV++K  K ++IP I L EAL LYQ  K  +KER+    E + N 
Sbjct: 739 AFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERR--DLELQHNT 796

Query: 846 TYLNYQPP----ERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSIL 901
           T +    P      S T +   N  LI G+    T +++   F   LK TL+KD Q+ ++
Sbjct: 797 TKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLI 856

Query: 902 PDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNIT 951
               +A +YP ++L IS NVE DI+ L  +F ++ +   +G +V    +T
Sbjct: 857 --NSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLT 904

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/894 (45%), Positives = 553/894 (61%), Gaps = 22/894 (2%)

Query: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125
           + +YE+ + ++  G+ Y C+ICT+E+D++  MYAC  CYRV+DY+CIR WA+K++  ++D
Sbjct: 16  IPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVD 75

Query: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185
           + WKCPNC H + K+P +NR TCWCGK VN DPN   PNSCGQTC A  C H CS  CHL
Sbjct: 76  RTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHL 135

Query: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245
           GPH +C       C CGK T+++ CY     K   + F+C + C + + CGIHKC RVCH
Sbjct: 136 GPHEECMVRIDFKCRCGKLTEEIPCY---EAKAAKRNFSCDQPCGLPMPCGIHKCERVCH 192

Query: 246 SGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIRT 305
           +G CGPC E I   + CYCG TT +K+ CS V +    K SK +   +WIG F C+++R 
Sbjct: 193 NGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYK---SWIGAFACDRMRE 249

Query: 306 VEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPISTC 365
           V Y+C  HSF E C +PP++     CPYSP+   TCPCGKT L +  + R  CTD IS+C
Sbjct: 250 VPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSC 309

Query: 366 ENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKCE 425
              C K L CG H CP TCH+G CMDPC  I  +KC+C  + F VPCQF   P C  KCE
Sbjct: 310 GKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCE 369

Query: 426 SLMSXXXXXXXXXXXSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGIHN 485
           SLMS           SG+P + KR      ++   DES VEA+H+CLKDCN  L CGIH 
Sbjct: 370 SLMSCRRHRCAERCCSGRPHSVKRNSRRRRESP-DDESEVEAQHVCLKDCNRVLLCGIHM 428

Query: 486 CTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGHK 545
           C  KCHAGKCPPCLESDS+DL+CPCGKT+V APVRCGTKLP C  PC   +  ++PCGH 
Sbjct: 429 CNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHS 488

Query: 546 PGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCHHYCQL 605
           P +H CHP D PCPPCT  V K C+CGK +  +  C+ +  SC + C+K L  C+H+CQ+
Sbjct: 489 PPSHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKPLSYCNHFCQV 547

Query: 606 KCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKELLL 665
            CH  G+CQ+ C Q C   R  C H C  KCHG + CP+ PC  K  + C CG +    +
Sbjct: 548 PCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKI 607

Query: 666 CGA-TSTTQSVELTKVLPCDDACLKYQRLEELRNAFGM--KSSSEDPESELERLKKIVEK 722
           C         +  ++ L CD+ C K+QR ++L  AFG+  K++SE+ E+ L     + ++
Sbjct: 608 CSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALL-----LAQR 662

Query: 723 VTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHA 782
             S+++L LPF+E VLSV++KQ+ WC QIE+ + K ++D +  +LHFKPM A QR F+H 
Sbjct: 663 SQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHE 722

Query: 783 LVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKV--QSFE 840
           L  ++ +YSESQD EPKRSVY+KK   +R+P I L +A PLY S+KK+E+E K   +S  
Sbjct: 723 LSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFKANSESAV 782

Query: 841 SKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSI 900
           +KK V+      PE     D   N  L+ G+T   +   L   F  +   TL+   QY +
Sbjct: 783 TKKLVSVHIDDSPESQH--DAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVV 840

Query: 901 LPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954
              G    ++P DYL++S N E+D+  LAG+F  + +E  L   +  C +   L
Sbjct: 841 --RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL 892

>KLTH0E08866g Chr5 complement(808794..809726) [933 bp, 310 aa] {ON}
           similar to uniprot|P53208 Saccharomyces cerevisiae
           YGR015C Hypothetical ORF
          Length = 310

 Score = 33.5 bits (75), Expect = 2.4,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 844 NVTYLNYQPPERSLT--PDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSIL 901
           ++ Y +++ P+ +    P V  +G    G TFG+    L+   G  +    +++      
Sbjct: 18  DLAYTHFKSPDFNTQRPPVVTLHGLFGSGKTFGSVGRKLSKDLGTEVYNLDLRN------ 71

Query: 902 PDGKSAIVYPKDYLTISENVERDIESLAG 930
             GKS I  P DYLT++ +V + +E   G
Sbjct: 72  -HGKSEIAKPYDYLTMARDVAKFLEDKIG 99

>TPHA0K00280 Chr11 complement(47253..57224) [9972 bp, 3323 aa] {ON}
            Anc_5.576 YDR457W
          Length = 3323

 Score = 32.7 bits (73), Expect = 6.1,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 12/99 (12%)

Query: 676  ELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEKVTSYEELELPFSE 735
            E  K++PC  +   Y     ++NAF  K          E  +K+ E +  Y +L   F++
Sbjct: 1287 EPVKIIPCYGSIQSYNDFFNMKNAFVKK----------ELPQKLFETLPIYPKLVNAFAK 1336

Query: 736  TVLSVYSKQTNWCNQ--IEELINKFVNDKNKPSLHFKPM 772
            T+L +YS  +       +  +++K +   N  S    P+
Sbjct: 1337 TLLLIYSSHSESSKTQFMNSVLDKIIETDNNNSSLLSPL 1375

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,469,737
Number of extensions: 4586656
Number of successful extensions: 14330
Number of sequences better than 10.0: 103
Number of HSP's gapped: 13719
Number of HSP's successfully gapped: 110
Length of query: 968
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 849
Effective length of database: 39,836,145
Effective search space: 33820887105
Effective search space used: 33820887105
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)