Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1039.332.284ON70170134350.0
KAFR0J013702.284ON78078613231e-172
TDEL0G021502.284ON66131612441e-162
TPHA0C033802.284ON69732412461e-162
NCAS0B062602.284ON72338012371e-160
NDAI0B035602.284ON75632212101e-155
KLTH0G10318g2.284ON79031512111e-155
SAKL0E07722g2.284ON79131512091e-155
KLLA0E08405g2.284ON77739112031e-154
ZYRO0A01848g2.284ON70438011961e-154
Kwal_27.115422.284ON79131511961e-153
NDAI0G006402.284ON62131511781e-152
Smik_9.842.284ON80837011921e-152
Kpol_1003.352.284ON71332111811e-152
Suva_9.1042.284ON80536411871e-152
NCAS0G038102.284ON66131111681e-150
YIL095W (PRK1)2.284ON81032211691e-149
Skud_9.782.284ON80931511591e-147
KAFR0H033302.284ON36935811111e-146
Ecym_33232.284ON74831611441e-146
Skud_14.3092.284ON63931411311e-145
CAGL0G02607g2.284ON68832011271e-144
Suva_14.3272.284ON63232911151e-143
YNL020C (ARK1)2.284ON63831411151e-143
TBLA0B059302.284ON71733511161e-142
KNAG0H020202.284ON59231910971e-141
Smik_14.3112.284ON63731410921e-139
TBLA0B069402.284ON144331711381e-138
ADL217W2.284ON75031610931e-138
CAGL0J03432g2.284ON62231110701e-136
TPHA0D015402.284ON70734510711e-135
KNAG0A054302.284ON78831710631e-133
Kpol_251.43.273ON8383457372e-85
KAFR0A010403.273ON9123247376e-85
KNAG0J008203.273ON10913137211e-81
TPHA0M011203.273ON7883467044e-81
KNAG0H012203.273ON9133537104e-81
SAKL0D03234g3.273ON8583096943e-79
ZYRO0E06864g3.273ON11153127044e-79
CAGL0K11990g3.273ON9913136978e-79
Ecym_26503.273ON8943066939e-79
Kwal_27.109453.273ON9353056932e-78
TBLA0E025903.273ON10613166972e-78
YBR059C (AKL1)3.273ON11083476973e-78
Kpol_1052.223.273ON11013036956e-78
KLLA0F18612g3.273ON8143136836e-78
KLTH0C07260g3.273ON9013056851e-77
CAGL0H10208g3.273ON10273096892e-77
TDEL0D035203.273ON10493366892e-77
Smik_2.1913.273ON11083476903e-77
NCAS0A105903.273ON10953136842e-76
Skud_2.1793.273ON10903116823e-76
Suva_4.2973.273ON11073476762e-75
KAFR0C004303.273ON9493146703e-75
NDAI0A057003.273ON11573236711e-74
AGR027C3.273ON9612966633e-74
TPHA0A040303.273ON10543156638e-74
TBLA0I019303.273ON13613156609e-73
SAKL0A03344g6.262ON3643532795e-26
TDEL0A067506.262ON3723532663e-24
Kwal_56.242746.262ON3463382592e-23
KLTH0H03080g6.262ON3463322564e-23
Kpol_1037.206.31ON7043402573e-22
Suva_16.706.262ON3643472477e-22
Smik_6.4416.262ON3643412461e-21
Kwal_33.131121.24ON5053002482e-21
TDEL0G043806.31ON7222832503e-21
Skud_16.426.262ON3643342397e-21
KNAG0E008506.31ON7112822468e-21
TPHA0J004206.31ON7072832468e-21
YPL236C (ENV7)6.262ON3643342389e-21
Suva_13.1636.31ON7053582441e-20
Smik_13.1596.31ON7052832413e-20
Kpol_1023.266.31ON7392852413e-20
NCAS0D021006.31ON7262832413e-20
Suva_6.1691.271ON14842592424e-20
Kwal_47.183075.591ON6212772394e-20
KAFR0A050906.31ON6682962395e-20
Kpol_1072.198.668ON8962982397e-20
Suva_16.1608.668ON9182972397e-20
ZYRO0C07480g6.31ON7742832388e-20
Skud_13.1546.31ON7052832361e-19
CAGL0J11638g6.31ON7462842361e-19
Ecym_21536.262ON3633032291e-19
YMR001C (CDC5)6.31ON7052832361e-19
Ecym_10301.24ON4402772312e-19
KNAG0F001701.24ON5432022322e-19
YJL095W (BCK1)1.271ON14782592353e-19
SAKL0H06754g8.668ON8843112343e-19
KLTH0C10912g6.31ON6972862333e-19
ZYRO0E07876g6.262ON3692992255e-19
KAFR0G026906.31ON7132832307e-19
NDAI0C026806.31ON7502822307e-19
CAGL0L03520g1.271ON14472822317e-19
Smik_10.1471.271ON14783052318e-19
KLTH0F16676g5.406ON8782782291e-18
Skud_10.1191.271ON14812592301e-18
SAKL0C00946g1.24ON5642712271e-18
YPL150W8.668ON9012972291e-18
Skud_16.1328.668ON9242972281e-18
CAGL0M02299g8.668ON8932942272e-18
TBLA0B004906.31ON7872852272e-18
TDEL0D014001.271ON14292522273e-18
Ecym_30356.31ON7402722253e-18
NCAS0A002801.24ON5352802233e-18
TBLA0C029401.271ON16432872263e-18
TPHA0F024306.31ON7982762244e-18
KLTH0D11044g8.668ON8492002244e-18
ACL006W6.31ON7082722234e-18
NCAS0A094701.271ON15152592254e-18
Kpol_1072.298.654ON8932032235e-18
Smik_6.3478.668ON9172972236e-18
Kwal_55.215455.406ON8652782226e-18
AFR724C1.24ON4402772187e-18
Kpol_2002.241.24ON4872742197e-18
KAFR0G012001.24ON5072362181e-17
ZYRO0F07194g8.668ON9382972211e-17
Kwal_56.224766.31ON6972852191e-17
SAKL0H07084g8.654ON9192362201e-17
TPHA0I009201.271ON14342392211e-17
SAKL0E01584g6.31ON6952862191e-17
NDAI0F045201.24ON4891992162e-17
Kpol_463.81.271ON14472372202e-17
ZYRO0F18062g1.24ON4712932162e-17
KLLA0E21693g5.406ON10162342182e-17
NDAI0G054701.271ON15552592192e-17
KNAG0B017801.271ON15802932182e-17
KLTH0G05214g5.591ON6532152153e-17
YDR523C (SPS1)1.24ON4901972143e-17
KLTH0F00946g1.24ON5122742144e-17
KLLA0E03587g5.591ON6472832154e-17
KAFR0B028008.279ON10952262164e-17
CAGL0K08514g2.479ON14891952164e-17
Suva_15.2975.406ON10741942164e-17
KLTH0D10714g8.654ON8722042155e-17
ABL034W2.479ON14251962156e-17
KLLA0C12485g3.92ON9252892146e-17
CAGL0I07513g3.92ON10763522147e-17
KLLA0C06138g6.31ON7083752137e-17
TPHA0E038501.24ON4821942117e-17
Smik_1.793.177ON9742712147e-17
ZYRO0G03366g2.479ON16162262148e-17
Smik_4.8031.24ON4901972118e-17
NCAS0G012106.262ON3673492078e-17
NCAS0C041008.141ON9053292139e-17
Kwal_26.77882.479ON12671992139e-17
KLLA0F14190g1.271ON13382832139e-17
TPHA0G016308.668ON8713012131e-16
KLTH0D05566g2.479ON11281992131e-16
KAFR0A014201.271ON13982592131e-16
ZYRO0G15290g1.271ON14872582131e-16
Skud_8.1635.406ON10762292121e-16
Skud_1.723.177ON9742702121e-16
NDAI0E023908.668ON8831952111e-16
TBLA0A047207.86ON12623042121e-16
KLLA0C00979g1.24ON4832842082e-16
KNAG0H031408.279ON9362632102e-16
Kpol_431.92.479ON15521972112e-16
TDEL0A061408.668ON8612952102e-16
ZYRO0C06776g5.591ON8902742102e-16
NDAI0E012908.654ON7292312092e-16
KLLA0F11319g8.668ON8433012093e-16
NDAI0E023208.654ON9323312083e-16
Suva_2.7031.24ON4851452063e-16
Ecym_73922.479ON14342002093e-16
Suva_11.1232.479ON15261982093e-16
TBLA0A074601.24ON5162672063e-16
Smik_8.1805.406ON10732292083e-16
Kwal_26.87518.668ON8482002083e-16
YAR019C (CDC15)3.177ON9742712084e-16
NCAS0C016708.668ON8962842084e-16
NCAS0A057702.479ON14611882084e-16
TDEL0C067801.24ON4682852045e-16
KAFR0H025108.668ON8793122065e-16
TDEL0A025502.479ON13691882076e-16
Ecym_21946.222ON3662832016e-16
AFL101C6.222ON3672712016e-16
ACL104C5.406ON9472012066e-16
Skud_4.7971.24ON4851932037e-16
KAFR0D032002.479ON14481952067e-16
TBLA0A035705.406ON9751952067e-16
Ecym_55055.406ON10031942057e-16
SAKL0E02860g2.479ON13771942068e-16
NCAS0B037408.279ON10492242058e-16
ACR133C8.668ON8511952058e-16
KAFR0D049505.406ON10082712058e-16
TBLA0I011502.479ON17451972069e-16
Kpol_1012.68.654ON6282582039e-16
SAKL0D05522g1.271ON14742362051e-15
KAFR0C014403.92ON10952712041e-15
YHR102W (KIC1)5.406ON10802682041e-15
KLTH0D03454g1.271ON14332362051e-15
KNAG0D008306.262ON3873001991e-15
KNAG0D002106.371ON8332882031e-15
ZYRO0D06776g8.279ON12042182041e-15
Kwal_56.237178.279ON8582022031e-15
KNAG0J016708.668ON10093012031e-15
Kpol_1072.318.652ON5262542011e-15
TBLA0H016605.406ON9962792031e-15
KNAG0J015908.654ON8052812021e-15
Kpol_1065.36.222ON3762871982e-15
TPHA0H016305.406ON10361942032e-15
YKL101W (HSL1)2.479ON15181902032e-15
CAGL0J03872g8.654ON6612002022e-15
NDAI0F013406.262ON4061591982e-15
KLLA0C04191g3.177ON7973102022e-15
TDEL0F040608.279ON11262382022e-15
ZYRO0F06842g8.654ON8432452022e-15
CAGL0L11550g5.406ON10722022022e-15
Suva_7.828.141ON9003252012e-15
NCAS0H019405.406ON10152452012e-15
KLLA0F13552g2.479ON12672002022e-15
CAGL0M11396g8.279ON11922382013e-15
Ecym_52513.177ON8932702003e-15
SAKL0G01848g5.406ON8851972003e-15
Smik_11.1392.479ON15341902013e-15
SAKL0H16632g8.279ON10622302003e-15
NDAI0J012508.279ON11762002003e-15
TBLA0D022308.141ON11543082003e-15
TBLA0C046008.279ON13152382003e-15
Kwal_26.87098.654ON8292602003e-15
TPHA0G017108.654ON8052001993e-15
Kwal_23.63256.341ON15422842003e-15
Kpol_1031.105.406ON11271942003e-15
KLTH0G13288g8.279ON11422322004e-15
TDEL0B063201.374ON4443141964e-15
NDAI0G034508.141ON9483182004e-15
Smik_7.3191.374ON4462811964e-15
TDEL0A060008.654ON7902771994e-15
Ecym_83398.654ON9202671994e-15
TBLA0B082503.92ON13472182004e-15
KLLA0F19536g8.279ON11042111994e-15
Ecym_42918.279ON11452021994e-15
TPHA0D011408.654ON6222451984e-15
KNAG0B053502.496ON8362791985e-15
NDAI0B020708.279ON12582331995e-15
TBLA0B038608.668ON9883031995e-15
Smik_4.3678.279ON10662301985e-15
CAGL0G04609g3.92ON9652921986e-15
AGR058W8.279ON10712021986e-15
Suva_16.1698.654ON8582361986e-15
KAFR0K007007.86ON13811921987e-15
Skud_7.918.141ON8973151977e-15
YDR122W (KIN1)8.279ON10642201977e-15
Kwal_26.71547.86ON12131951987e-15
CAGL0M02519g8.654ON7562001977e-15
TBLA0B039708.654ON12081861977e-15
Suva_2.2838.279ON10892301978e-15
Kpol_1054.23.92ON10962901978e-15
AFR092W1.271ON14232701978e-15
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1039.33
         (701 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...  1327   0.0  
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   514   e-172
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   483   e-162
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   484   e-162
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   481   e-160
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   470   e-155
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   471   e-155
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   470   e-155
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   468   e-154
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   465   e-154
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   465   e-153
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    458   e-152
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   463   e-152
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   459   e-152
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   461   e-152
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   454   e-150
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   454   e-149
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   451   e-147
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   432   e-146
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   445   e-146
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   440   e-145
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   438   e-144
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   434   e-143
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   434   e-143
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   434   e-142
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   427   e-141
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   425   e-139
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   442   e-138
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   425   e-138
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   416   e-136
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   417   e-135
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   414   e-133
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   288   2e-85
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   288   6e-85
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   282   1e-81
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   275   4e-81
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   278   4e-81
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   271   3e-79
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   275   4e-79
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   273   8e-79
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   271   9e-79
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   271   2e-78
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   273   2e-78
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   273   3e-78
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   272   6e-78
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   267   6e-78
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   268   1e-77
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   270   2e-77
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   270   2e-77
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   270   3e-77
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   268   2e-76
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   267   3e-76
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   265   2e-75
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   262   3e-75
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   263   1e-74
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   259   3e-74
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   259   8e-74
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   258   9e-73
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...   112   5e-26
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...   107   3e-24
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...   104   2e-23
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...   103   4e-23
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   103   3e-22
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...   100   7e-22
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    99   1e-21
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   100   2e-21
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   100   3e-21
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    97   7e-21
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    99   8e-21
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    99   8e-21
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    96   9e-21
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    99   1e-20
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    97   3e-20
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    97   3e-20
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      97   3e-20
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    98   4e-20
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    97   4e-20
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             97   5e-20
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    97   7e-20
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    97   7e-20
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    96   8e-20
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    96   1e-19
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    96   1e-19
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    93   1e-19
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    96   1e-19
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    94   2e-19
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    94   2e-19
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    95   3e-19
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    95   3e-19
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    94   3e-19
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    91   5e-19
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    93   7e-19
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    93   7e-19
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    94   7e-19
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    94   8e-19
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    93   1e-18
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    93   1e-18
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    92   1e-18
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    93   1e-18
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    92   1e-18
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    92   2e-18
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    92   2e-18
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    92   3e-18
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    91   3e-18
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        91   3e-18
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    92   3e-18
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    91   4e-18
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    91   4e-18
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    91   4e-18
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    91   4e-18
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    91   5e-18
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    91   6e-18
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    90   6e-18
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    89   7e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    89   7e-18
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    89   1e-17
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    90   1e-17
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    89   1e-17
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    89   1e-17
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    90   1e-17
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    89   1e-17
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    88   2e-17
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    89   2e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    88   2e-17
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    89   2e-17
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    89   2e-17
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    89   2e-17
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    87   3e-17
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    87   3e-17
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    87   4e-17
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    87   4e-17
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    88   4e-17
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    88   4e-17
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    88   4e-17
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    87   5e-17
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    87   6e-17
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    87   6e-17
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    87   7e-17
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    87   7e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    86   7e-17
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    87   7e-17
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    87   8e-17
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    86   8e-17
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    84   8e-17
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     87   9e-17
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    87   9e-17
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    87   9e-17
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    87   1e-16
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    87   1e-16
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    87   1e-16
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    87   1e-16
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    86   1e-16
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    86   1e-16
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    86   1e-16
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    86   1e-16
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    85   2e-16
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    86   2e-16
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    86   2e-16
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    86   2e-16
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    86   2e-16
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    85   2e-16
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    85   3e-16
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               85   3e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    84   3e-16
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    85   3e-16
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    85   3e-16
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    84   3e-16
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    85   3e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    85   3e-16
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    85   4e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    85   4e-16
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    85   4e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    83   5e-16
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    84   5e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    84   6e-16
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    82   6e-16
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    82   6e-16
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    84   6e-16
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    83   7e-16
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    84   7e-16
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    84   7e-16
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    84   7e-16
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    84   8e-16
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    84   8e-16
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    84   8e-16
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    84   8e-16
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    84   9e-16
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    83   9e-16
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    84   1e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    83   1e-15
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    83   1e-15
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    84   1e-15
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    81   1e-15
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    83   1e-15
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    83   1e-15
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    83   1e-15
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    83   1e-15
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    82   1e-15
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    83   1e-15
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    82   1e-15
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    81   2e-15
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    83   2e-15
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    83   2e-15
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    82   2e-15
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    81   2e-15
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    82   2e-15
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    82   2e-15
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    82   2e-15
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    82   2e-15
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    82   2e-15
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    82   2e-15
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    82   2e-15
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    82   3e-15
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    82   3e-15
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    82   3e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    82   3e-15
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    82   3e-15
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    82   3e-15
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    82   3e-15
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    82   3e-15
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    82   3e-15
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    81   3e-15
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    82   3e-15
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    82   3e-15
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    82   4e-15
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    80   4e-15
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     82   4e-15
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    80   4e-15
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    81   4e-15
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    81   4e-15
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    82   4e-15
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    81   4e-15
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    81   4e-15
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    81   4e-15
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    81   5e-15
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              81   5e-15
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    81   5e-15
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    81   5e-15
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    81   6e-15
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    81   6e-15
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    81   6e-15
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    81   7e-15
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    80   7e-15
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    80   7e-15
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    81   7e-15
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    80   7e-15
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    80   7e-15
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    80   8e-15
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    80   8e-15
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    80   8e-15
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    80   9e-15
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    80   9e-15
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    80   1e-14
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    80   1e-14
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              80   1e-14
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    80   1e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    80   1e-14
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    80   1e-14
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    80   1e-14
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    80   1e-14
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    80   1e-14
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    80   1e-14
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    80   1e-14
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    80   1e-14
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    80   1e-14
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    80   1e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    80   1e-14
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    79   1e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    80   1e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    80   1e-14
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    80   1e-14
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    77   2e-14
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    80   2e-14
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    79   2e-14
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    78   2e-14
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    79   2e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    79   2e-14
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    79   2e-14
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    79   2e-14
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    79   2e-14
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    79   2e-14
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    79   2e-14
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    79   2e-14
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    79   2e-14
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    79   2e-14
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    79   2e-14
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    79   2e-14
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    79   3e-14
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    79   3e-14
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    79   3e-14
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    79   3e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    79   3e-14
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    78   3e-14
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    79   3e-14
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    79   3e-14
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    78   3e-14
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    78   3e-14
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    78   4e-14
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    78   4e-14
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    78   4e-14
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    78   4e-14
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    77   4e-14
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    77   4e-14
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    78   4e-14
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     78   4e-14
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    78   5e-14
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    78   5e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    78   5e-14
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    78   5e-14
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    78   5e-14
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     77   5e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    78   6e-14
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    77   6e-14
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    78   6e-14
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    77   6e-14
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    78   6e-14
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    78   6e-14
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               77   6e-14
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    77   7e-14
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    77   7e-14
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    76   7e-14
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    77   7e-14
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    76   8e-14
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    77   8e-14
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    77   8e-14
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    77   8e-14
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    77   8e-14
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    77   8e-14
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    75   8e-14
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    77   8e-14
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     75   9e-14
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    77   9e-14
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    77   9e-14
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    77   9e-14
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    77   9e-14
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    77   9e-14
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    77   9e-14
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    77   1e-13
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    77   1e-13
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    77   1e-13
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    77   1e-13
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    77   1e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    77   1e-13
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    77   1e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    76   1e-13
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    77   1e-13
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    76   1e-13
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    77   1e-13
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    77   1e-13
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    77   1e-13
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    76   1e-13
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    77   1e-13
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    75   1e-13
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    76   1e-13
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    76   1e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    76   1e-13
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    77   1e-13
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    77   1e-13
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    76   1e-13
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    77   2e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    76   2e-13
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    76   2e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    76   2e-13
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    76   2e-13
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    76   2e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    76   2e-13
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    76   2e-13
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    76   2e-13
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    75   2e-13
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    75   2e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    76   2e-13
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    76   2e-13
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    76   2e-13
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    76   2e-13
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    75   2e-13
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    76   2e-13
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    76   2e-13
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    76   2e-13
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    76   2e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    76   2e-13
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    75   2e-13
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    75   2e-13
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    75   2e-13
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    75   2e-13
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    75   3e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    75   3e-13
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    75   3e-13
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    75   3e-13
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    75   3e-13
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    75   3e-13
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    75   3e-13
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    74   3e-13
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    75   3e-13
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     75   3e-13
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    75   4e-13
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    75   4e-13
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    75   4e-13
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    75   4e-13
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    75   4e-13
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    74   4e-13
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    75   4e-13
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    75   4e-13
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    75   4e-13
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    75   5e-13
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    73   5e-13
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    75   5e-13
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    75   6e-13
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    73   6e-13
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    75   6e-13
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    74   6e-13
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    75   6e-13
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     74   7e-13
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     74   7e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    74   7e-13
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    74   7e-13
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    73   7e-13
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    74   8e-13
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    74   8e-13
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    74   8e-13
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    74   8e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    74   8e-13
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    74   8e-13
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    74   8e-13
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    74   9e-13
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    72   9e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    74   9e-13
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    74   9e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    74   9e-13
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    73   1e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    74   1e-12
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    73   1e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    72   1e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    72   1e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    74   1e-12
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    73   1e-12
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    73   1e-12
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    71   1e-12
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    74   1e-12
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    71   1e-12
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    73   1e-12
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    74   1e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    72   1e-12
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    73   1e-12
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    73   1e-12
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    73   1e-12
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    73   2e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    73   2e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    73   2e-12
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    73   2e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    73   2e-12
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    73   2e-12
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    73   2e-12
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    73   2e-12
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    73   2e-12
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    72   2e-12
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    73   2e-12
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    72   2e-12
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    73   2e-12
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    73   2e-12
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    73   2e-12
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    73   2e-12
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    71   2e-12
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    72   2e-12
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    73   2e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    72   2e-12
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    72   2e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    72   2e-12
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    73   2e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    72   2e-12
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    72   2e-12
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    73   2e-12
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    72   2e-12
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              72   2e-12
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    71   2e-12
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    72   2e-12
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    72   2e-12
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    72   3e-12
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    71   3e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    72   3e-12
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    72   3e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    72   3e-12
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    72   3e-12
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    72   3e-12
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    72   3e-12
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    72   3e-12
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    72   3e-12
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    72   3e-12
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    72   3e-12
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    72   3e-12
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    72   3e-12
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    72   3e-12
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    72   3e-12
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    72   3e-12
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    72   4e-12
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               71   4e-12
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    72   4e-12
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    71   4e-12
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    71   4e-12
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    70   4e-12
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    72   4e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    72   4e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    72   4e-12
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    71   4e-12
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    70   4e-12
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               70   4e-12
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    71   4e-12
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    72   4e-12
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    72   4e-12
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    72   4e-12
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    72   5e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    72   5e-12
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    72   5e-12
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    71   5e-12
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    71   5e-12
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    72   5e-12
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    70   5e-12
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    71   5e-12
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    71   6e-12
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    71   6e-12
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    71   6e-12
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    70   6e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    70   6e-12
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    71   6e-12
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    71   6e-12
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    71   6e-12
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    70   6e-12
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    70   6e-12
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    71   6e-12
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    71   6e-12
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    71   7e-12
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    71   7e-12
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    70   7e-12
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    70   7e-12
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    70   7e-12
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    71   7e-12
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    71   7e-12
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    71   7e-12
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    70   7e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    71   7e-12
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    70   8e-12
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    71   8e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    69   8e-12
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    69   8e-12
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    71   8e-12
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    70   8e-12
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    70   8e-12
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    70   8e-12
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    70   9e-12
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    70   9e-12
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    69   9e-12
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    69   9e-12
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    70   9e-12
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    71   9e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    70   9e-12
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    69   9e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    70   9e-12
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    70   1e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    70   1e-11
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    70   1e-11
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    70   1e-11
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    69   1e-11
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     69   1e-11
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    70   1e-11
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    70   1e-11
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    70   1e-11
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    70   1e-11
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    70   1e-11
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    69   1e-11
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    70   1e-11
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    70   1e-11
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    70   1e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    70   1e-11
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    70   1e-11
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    70   1e-11
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    70   1e-11
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    70   1e-11
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    69   1e-11
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    70   1e-11
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    70   1e-11
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      70   1e-11
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    70   1e-11
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    70   1e-11
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    70   1e-11
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    70   1e-11
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    70   1e-11
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    70   1e-11
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    70   1e-11
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    70   1e-11
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    70   1e-11
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    69   1e-11
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    70   1e-11
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    70   2e-11
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    69   2e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     69   2e-11
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    68   2e-11
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    70   2e-11
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    69   2e-11
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    70   2e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    70   2e-11
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    69   2e-11
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    70   2e-11
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    68   2e-11
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    69   2e-11
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    70   2e-11
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    69   2e-11
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               69   2e-11
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    69   2e-11
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    69   2e-11
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    69   2e-11
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    69   2e-11
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    69   2e-11
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    69   2e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    69   2e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    69   2e-11
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    69   2e-11
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    69   2e-11
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    70   2e-11
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    69   2e-11
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    69   2e-11
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    69   2e-11
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    69   2e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    69   2e-11
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    69   2e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    69   2e-11
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              69   2e-11
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    69   2e-11
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    69   2e-11
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    69   2e-11
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    69   2e-11
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    69   2e-11
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    69   2e-11
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    69   3e-11
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    69   3e-11
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    68   3e-11
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    69   3e-11
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    69   3e-11
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    69   3e-11
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    69   3e-11
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    69   3e-11
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    69   3e-11
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    69   3e-11
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    68   3e-11
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    67   3e-11
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     68   3e-11
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    69   3e-11
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    68   3e-11
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    69   3e-11
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    68   4e-11
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    67   4e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    69   4e-11
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              69   4e-11
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    67   4e-11
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    67   4e-11
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    69   4e-11
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    68   4e-11
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    68   4e-11
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    68   4e-11
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    67   4e-11
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    68   4e-11
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               67   4e-11
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               68   4e-11
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    68   5e-11
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    68   5e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    68   5e-11
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    69   5e-11
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    67   5e-11
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    68   5e-11
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    68   5e-11
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    68   5e-11
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    66   5e-11
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    67   5e-11
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    66   5e-11
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    68   5e-11
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    68   5e-11
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    67   5e-11
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    68   5e-11
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    68   5e-11
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    68   5e-11
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    67   6e-11
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    64   6e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    67   6e-11
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    67   6e-11
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    67   6e-11
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    68   6e-11
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    68   6e-11
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    67   6e-11
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    67   6e-11
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     67   6e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    67   6e-11
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    67   6e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    68   7e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    67   7e-11
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    66   7e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    68   7e-11
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    67   7e-11
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    67   7e-11
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    67   7e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    67   7e-11
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    68   7e-11
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    68   8e-11
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    67   8e-11
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    67   8e-11
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    67   8e-11
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    67   8e-11
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    68   8e-11
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    67   8e-11
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    67   8e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    67   8e-11
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    66   8e-11
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    67   8e-11
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              67   9e-11
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    67   9e-11
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    66   9e-11
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    67   9e-11
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    66   9e-11
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               66   9e-11
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    65   9e-11
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    67   9e-11
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    67   9e-11
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    67   1e-10
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    67   1e-10
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    67   1e-10
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    67   1e-10
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    66   1e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    66   1e-10
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              65   1e-10
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    67   1e-10
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    65   1e-10
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    67   1e-10
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    67   1e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    67   1e-10
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    67   1e-10
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    66   1e-10
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    65   1e-10
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    67   1e-10
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    67   1e-10
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    67   1e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    66   1e-10
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    67   1e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       66   1e-10
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    67   1e-10
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    66   1e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    65   1e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    67   1e-10
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    65   1e-10
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    66   1e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    66   1e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    67   1e-10
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    67   1e-10
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    66   1e-10
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    66   1e-10
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    67   2e-10
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    66   2e-10
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    65   2e-10
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    66   2e-10
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    66   2e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    65   2e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    66   2e-10
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    65   2e-10
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    64   2e-10
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    66   2e-10
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    65   2e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    65   2e-10
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    65   2e-10
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    66   2e-10
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    66   2e-10
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    66   2e-10
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               66   2e-10
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    66   2e-10
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     66   2e-10
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    65   2e-10
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    65   2e-10
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    65   2e-10
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    66   2e-10
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    65   2e-10
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    65   2e-10
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    64   2e-10
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    64   2e-10
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    66   2e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    66   2e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    65   2e-10
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    65   2e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    66   2e-10
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    65   3e-10
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    65   3e-10
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    66   3e-10
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    65   3e-10
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    66   3e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    65   3e-10
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    66   3e-10
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    65   3e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    65   3e-10
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    65   3e-10
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    66   3e-10
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    65   3e-10
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    65   3e-10
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    65   3e-10
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    65   3e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    65   3e-10
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    65   3e-10
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    65   3e-10
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    65   3e-10
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    64   3e-10
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    65   3e-10
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    65   3e-10
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    65   3e-10
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    65   4e-10
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    65   4e-10
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    65   4e-10
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               65   4e-10
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    65   4e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    65   4e-10
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    65   4e-10
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    65   4e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     65   4e-10
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    65   4e-10
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    65   4e-10
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    65   4e-10
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    65   4e-10
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    65   4e-10
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    64   4e-10
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    65   4e-10
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    64   5e-10
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    65   5e-10
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    65   5e-10
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    65   5e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    65   5e-10
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     65   5e-10
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    64   5e-10
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       65   5e-10
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    65   5e-10
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    64   5e-10
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    64   5e-10
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    64   5e-10
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    63   5e-10
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    64   5e-10
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    64   5e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    64   5e-10
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    64   5e-10
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    64   5e-10
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    64   5e-10
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    64   6e-10
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    65   6e-10
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    65   6e-10
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    64   6e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    64   6e-10
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    64   6e-10
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              64   6e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    65   6e-10
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    63   6e-10
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    65   6e-10
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    64   7e-10
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    63   7e-10
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    64   7e-10
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    64   7e-10
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    64   7e-10
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    64   7e-10
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    64   8e-10
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    64   8e-10
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    64   8e-10
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    64   8e-10
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    64   8e-10
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    64   8e-10
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    64   8e-10
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    64   8e-10
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    64   9e-10
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    64   9e-10
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    64   9e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    64   9e-10
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    64   9e-10
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    63   9e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    64   9e-10
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    64   9e-10
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    64   1e-09
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    63   1e-09
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    64   1e-09
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    63   1e-09
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    64   1e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    64   1e-09
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    64   1e-09
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    64   1e-09
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    62   1e-09
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    63   1e-09
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    63   1e-09
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    64   1e-09
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    63   1e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   1e-09
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    63   1e-09
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    64   1e-09
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    63   1e-09
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    64   1e-09
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               63   1e-09
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    62   1e-09
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    64   1e-09
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    63   1e-09
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    63   1e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    63   1e-09
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    63   1e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    62   1e-09
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    62   1e-09
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    63   2e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    62   2e-09
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    62   2e-09
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    63   2e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    63   2e-09
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    62   2e-09
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    63   2e-09
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    63   2e-09
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    62   2e-09
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    63   2e-09
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    62   2e-09
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    63   2e-09
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    63   2e-09
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    62   2e-09
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    63   2e-09
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    63   2e-09
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    62   2e-09
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    63   2e-09
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    63   2e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    62   2e-09
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    62   2e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     62   2e-09
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    62   2e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    62   2e-09
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    63   2e-09
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    61   2e-09
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    61   2e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     62   2e-09
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    62   2e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    63   2e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    62   2e-09
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    62   2e-09
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    63   2e-09
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    62   2e-09
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    62   2e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    62   3e-09
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    62   3e-09
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    62   3e-09
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    62   3e-09
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    62   3e-09
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    62   3e-09
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    62   3e-09
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    62   3e-09
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    62   3e-09
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    61   3e-09
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    62   3e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    62   3e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    61   3e-09
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    61   3e-09
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    62   3e-09
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    62   3e-09
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    62   3e-09
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    62   3e-09
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    62   3e-09
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    62   3e-09
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    62   3e-09
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    62   3e-09
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    61   3e-09
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    62   4e-09
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    62   4e-09
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    62   4e-09
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    62   4e-09
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    62   4e-09
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    62   4e-09
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    62   4e-09
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    62   4e-09
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    62   4e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    62   4e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    62   4e-09
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    61   4e-09
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    62   4e-09
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    61   4e-09
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    60   4e-09
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    61   4e-09
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    61   4e-09
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    61   5e-09
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    62   5e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    61   5e-09
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    62   5e-09
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    61   5e-09
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    61   5e-09
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    60   5e-09
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    62   5e-09
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    61   6e-09
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    61   6e-09
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    61   6e-09
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    61   6e-09
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    61   6e-09
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    62   6e-09
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    61   6e-09
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    61   6e-09
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    60   6e-09
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    61   7e-09
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    60   7e-09
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    61   7e-09
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    61   7e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    61   7e-09
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    61   7e-09
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    61   7e-09
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    61   7e-09
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    61   7e-09
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    61   8e-09
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    61   8e-09
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    60   8e-09
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    60   8e-09
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    60   8e-09
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    60   8e-09
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    60   8e-09
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     60   9e-09
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    61   9e-09
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    60   9e-09
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   1e-08
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    60   1e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    60   1e-08
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    60   1e-08
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    60   1e-08
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    60   1e-08
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    60   1e-08
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    60   1e-08
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    60   1e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    60   1e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    60   1e-08
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    60   1e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    60   1e-08
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    59   1e-08
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       60   1e-08
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    60   1e-08
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    60   1e-08
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    60   1e-08
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     60   1e-08
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    60   1e-08
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    60   1e-08
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    60   1e-08
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    60   2e-08
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    58   2e-08
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    60   2e-08
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    59   2e-08
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    59   2e-08
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    60   2e-08
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    60   2e-08
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    60   2e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    60   2e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    59   2e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    59   2e-08
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    60   2e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    60   2e-08
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    59   2e-08
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    59   2e-08
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    59   2e-08
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    59   2e-08
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    59   2e-08
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              60   2e-08
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    60   2e-08
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    59   2e-08
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    59   2e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    59   2e-08
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    59   2e-08
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    59   2e-08
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    60   2e-08
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    58   2e-08
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    59   2e-08
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    59   2e-08
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    59   2e-08
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    59   2e-08
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    59   2e-08
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    59   2e-08
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    59   2e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    59   2e-08
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    59   2e-08
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    59   2e-08
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    59   3e-08
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    59   3e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    59   3e-08
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    59   3e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    59   3e-08
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    59   3e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    58   3e-08
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    59   3e-08
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    59   3e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    59   3e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    59   3e-08
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    58   3e-08
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    59   3e-08
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    58   3e-08
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    59   3e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    59   3e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    59   4e-08
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    59   4e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    59   4e-08
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    59   4e-08
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    58   4e-08
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    58   4e-08
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    59   4e-08
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    58   4e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    58   4e-08
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    59   4e-08
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    58   4e-08
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    58   4e-08
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    59   4e-08
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    57   4e-08
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              59   4e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    58   5e-08
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    57   5e-08
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    59   5e-08
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    59   5e-08
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    59   5e-08
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    59   5e-08
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     58   5e-08
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    58   5e-08
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    58   5e-08
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    58   5e-08
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    58   5e-08
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    59   5e-08
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    58   5e-08
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    58   5e-08
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    57   5e-08
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    58   5e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    58   6e-08
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    58   6e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    58   6e-08
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    58   6e-08
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    57   6e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    58   6e-08
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    58   6e-08
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    58   6e-08
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    58   7e-08
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    58   7e-08
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    58   7e-08
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    57   7e-08
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    58   7e-08
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    57   7e-08
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    58   7e-08
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    58   7e-08
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    58   7e-08
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    57   7e-08
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    57   8e-08
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    57   8e-08
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    57   8e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    58   9e-08
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    57   9e-08
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    57   9e-08
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    57   9e-08
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    57   1e-07
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    57   1e-07
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    57   1e-07
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    57   1e-07
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    57   1e-07
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    57   1e-07
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    57   1e-07
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    57   1e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    57   1e-07
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    57   1e-07
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    57   1e-07
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     57   1e-07
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    57   1e-07
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    57   1e-07
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    57   1e-07
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    57   1e-07
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    56   1e-07
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    56   1e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    57   1e-07
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    56   1e-07
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    57   1e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    57   1e-07
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    56   1e-07
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    57   1e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    57   1e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    57   1e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    57   1e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    57   1e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    56   1e-07
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    57   1e-07
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    56   1e-07
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    57   1e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    56   1e-07
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    56   2e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    57   2e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    56   2e-07
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    56   2e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    56   2e-07
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    56   2e-07
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    56   2e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    56   2e-07
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    56   2e-07
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    56   2e-07
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    56   2e-07
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    56   2e-07
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    56   2e-07
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    56   2e-07
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    56   2e-07
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    55   2e-07
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    56   2e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    56   2e-07
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    56   2e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    56   2e-07
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    56   2e-07
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    56   2e-07
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    56   2e-07
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    55   2e-07
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    55   2e-07
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    56   2e-07
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    56   2e-07
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             56   2e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    55   3e-07
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    55   3e-07
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    55   3e-07
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    55   3e-07
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    56   3e-07
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    55   3e-07
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    55   3e-07
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    56   3e-07
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    55   3e-07
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    55   3e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    56   3e-07
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    56   3e-07
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    55   3e-07
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    55   3e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    55   3e-07
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    55   3e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   3e-07
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    55   3e-07
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    55   3e-07
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    55   3e-07
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    55   3e-07
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    56   3e-07
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    55   3e-07
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    56   3e-07
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    55   3e-07
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    55   3e-07
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    55   3e-07
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    55   4e-07
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    55   4e-07
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    55   4e-07
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    55   4e-07
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    55   4e-07
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    55   4e-07
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    55   4e-07
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    55   4e-07
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    55   4e-07
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    55   4e-07
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    55   4e-07
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    55   4e-07
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    55   4e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    55   4e-07
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    55   4e-07
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    55   4e-07
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    55   4e-07
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    55   4e-07
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    55   4e-07
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    55   4e-07
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    54   4e-07
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    55   4e-07
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    55   4e-07
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    54   4e-07
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    55   4e-07
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    55   4e-07
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    55   5e-07
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    55   5e-07
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    55   5e-07
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    54   5e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    55   5e-07
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    55   5e-07
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    55   5e-07
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    54   5e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     54   5e-07
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    55   5e-07
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    55   5e-07
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    55   5e-07
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    55   5e-07
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    54   5e-07
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    55   5e-07
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    54   5e-07
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    55   5e-07
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    54   6e-07
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               55   6e-07
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    55   6e-07
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      55   6e-07
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    55   6e-07
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    54   6e-07
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    55   6e-07
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    55   6e-07
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    54   6e-07
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    54   6e-07
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    55   7e-07
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    55   7e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    54   7e-07
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    53   7e-07
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    54   7e-07
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    54   7e-07
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    54   7e-07
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    54   8e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    54   8e-07
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    54   8e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    54   8e-07
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    54   8e-07
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    54   9e-07
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    54   9e-07
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    54   9e-07
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    54   9e-07
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    54   9e-07
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    54   9e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    54   1e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    54   1e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    54   1e-06
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    54   1e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    54   1e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    54   1e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    54   1e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     54   1e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    54   1e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    54   1e-06
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    54   1e-06
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    54   1e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    54   1e-06
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    54   1e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    54   1e-06
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    54   1e-06
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    54   1e-06
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    54   1e-06
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    54   1e-06
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    54   1e-06
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    54   1e-06
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    54   1e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    53   1e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    54   1e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    54   1e-06
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    53   1e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     54   1e-06
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    53   1e-06
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    54   1e-06
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    53   1e-06
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    54   1e-06
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    53   1e-06
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    54   1e-06
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    53   1e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    54   1e-06
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    54   1e-06
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    54   1e-06
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    53   2e-06
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    53   2e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    53   2e-06
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    54   2e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    54   2e-06
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    53   2e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    54   2e-06
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    53   2e-06
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    53   2e-06
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    53   2e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    53   2e-06
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    53   2e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    53   2e-06
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    53   2e-06
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    53   2e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    53   2e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    52   2e-06
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    53   2e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    53   2e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    53   2e-06
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    53   2e-06
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    52   2e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    52   2e-06
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    53   2e-06
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    53   2e-06
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    53   2e-06
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    53   2e-06
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    53   2e-06
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    52   2e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    53   2e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    53   2e-06
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    52   2e-06
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    53   2e-06
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    52   2e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    53   2e-06
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    53   2e-06
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    52   2e-06
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              52   3e-06
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    53   3e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    53   3e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    53   3e-06
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    53   3e-06
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    53   3e-06
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    52   3e-06
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    52   3e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    52   3e-06
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    52   3e-06
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    52   3e-06
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    52   3e-06
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    52   3e-06
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    52   3e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    52   3e-06
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    52   3e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    52   3e-06
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    52   3e-06
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    52   3e-06
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    52   4e-06
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    52   4e-06
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    52   4e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    52   4e-06
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    52   4e-06
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     52   4e-06
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    52   4e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    52   4e-06
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    52   4e-06
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    52   4e-06
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    52   4e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    52   4e-06
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    52   4e-06
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    52   4e-06
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     52   4e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    52   4e-06
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    52   5e-06
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    51   5e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    52   5e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    52   5e-06
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    51   5e-06
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    51   5e-06
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    52   5e-06
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    52   5e-06
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    52   5e-06
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    52   5e-06
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    52   5e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    52   5e-06
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               52   6e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    52   6e-06
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    51   6e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    51   6e-06
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    51   6e-06
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    51   6e-06
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    51   6e-06
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    51   6e-06
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    52   6e-06
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    52   6e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    52   6e-06
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    52   6e-06
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    52   6e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    51   6e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    51   6e-06
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    51   7e-06
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    51   7e-06
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    51   7e-06
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    51   7e-06
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               51   7e-06
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    51   7e-06
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    51   7e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    51   7e-06
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       51   7e-06
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    50   8e-06
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    51   8e-06
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    50   8e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    50   8e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    51   8e-06
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    50   8e-06
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    51   8e-06
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    50   8e-06
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    51   8e-06
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    51   8e-06
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    50   8e-06
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    51   9e-06
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     50   9e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    51   9e-06
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    50   9e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    50   9e-06
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    51   9e-06
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    50   9e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    48   9e-06
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    51   1e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    50   1e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    51   1e-05
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    51   1e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    51   1e-05
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    51   1e-05
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    50   1e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    51   1e-05
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    50   1e-05
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    51   1e-05
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    50   1e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    50   1e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    50   1e-05
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    50   1e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    50   1e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    50   1e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    50   1e-05
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    50   1e-05
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    50   2e-05
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    50   2e-05
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    49   2e-05
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    50   2e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    50   2e-05
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    50   2e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    50   2e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    50   2e-05
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    50   2e-05
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    50   2e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    49   2e-05
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     50   2e-05
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    50   2e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    50   2e-05
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    50   2e-05
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    50   2e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    50   2e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    50   2e-05
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    49   2e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    49   2e-05
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    49   2e-05
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    49   2e-05
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    49   3e-05
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    49   3e-05
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    49   3e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    49   3e-05
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    49   3e-05
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    49   3e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    49   3e-05
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    49   3e-05
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    49   3e-05
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    49   3e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    49   3e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    48   3e-05
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    48   3e-05
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    49   3e-05
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    49   3e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    49   3e-05
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    49   4e-05
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    49   4e-05
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    49   4e-05
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    49   4e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    49   4e-05
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    48   4e-05
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    49   4e-05
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    49   5e-05
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    49   5e-05
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    48   5e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      49   5e-05
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    48   5e-05
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    48   5e-05
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    49   5e-05
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    48   6e-05
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    49   6e-05
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    48   6e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    47   6e-05
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    47   6e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    48   6e-05
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    48   6e-05
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    48   6e-05
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    47   7e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    48   7e-05
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    48   7e-05
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    48   7e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    48   7e-05
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    48   7e-05
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    48   7e-05
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    48   7e-05
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    48   8e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    48   8e-05
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    47   8e-05
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    47   8e-05
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    48   8e-05
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    48   9e-05
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    47   9e-05
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    48   9e-05
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    48   9e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    48   9e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    47   1e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    47   1e-04
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               47   1e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    47   1e-04
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    47   1e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    47   1e-04
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    47   1e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    47   1e-04
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    46   1e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    47   1e-04
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    47   1e-04
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    47   1e-04
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    46   2e-04
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    46   2e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    47   2e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    47   2e-04
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    46   2e-04
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    47   2e-04
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      47   2e-04
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    47   2e-04
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    47   2e-04
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    47   2e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   2e-04
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    47   2e-04
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    47   2e-04
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    47   2e-04
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    47   2e-04
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    47   2e-04
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    47   2e-04
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    47   2e-04
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    47   2e-04
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    47   2e-04
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    46   2e-04
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    46   2e-04
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    46   2e-04
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    46   2e-04
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    46   2e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    45   3e-04
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    46   3e-04
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    46   3e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    45   3e-04
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    46   3e-04
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    46   3e-04
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    46   3e-04
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    45   3e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    46   3e-04
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    46   3e-04
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    46   3e-04
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    45   3e-04
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    46   4e-04
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    45   4e-04
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    46   4e-04
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    45   4e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   4e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    45   4e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    45   4e-04
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    45   4e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    45   4e-04
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     45   5e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    45   5e-04
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    45   5e-04
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    45   5e-04
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    45   6e-04
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    45   6e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    45   6e-04
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    45   6e-04
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    45   6e-04
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    45   6e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    45   6e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    44   7e-04
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    45   7e-04
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               44   7e-04
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    45   7e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    45   7e-04
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    45   8e-04
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    45   8e-04
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    44   8e-04
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    45   8e-04
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    45   8e-04
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    44   8e-04
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    44   8e-04
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    45   8e-04
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    45   8e-04
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    45   8e-04
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    45   9e-04
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    44   0.001
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   0.001
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    44   0.001
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    44   0.001
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    45   0.001
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    44   0.001
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    44   0.001
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 44   0.001
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               44   0.001
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    44   0.001
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    44   0.001
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    44   0.001
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    44   0.001
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    44   0.001
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    44   0.001
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    44   0.001
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    44   0.001
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    44   0.001
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               44   0.001
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    44   0.001
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    43   0.002
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    44   0.002
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    43   0.002
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    44   0.002
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    43   0.002
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    43   0.002
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    43   0.002
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    43   0.002
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    43   0.002
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    43   0.002
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    43   0.002
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    43   0.002
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    43   0.003
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    43   0.003
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    43   0.003
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    43   0.003
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    43   0.003
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    42   0.003
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.003
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    43   0.003
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    43   0.003
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    43   0.003
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    43   0.003
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    43   0.003
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    43   0.003
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    43   0.003
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    42   0.003
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    42   0.003
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    42   0.003
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    43   0.004
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    43   0.004
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    43   0.004
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    42   0.004
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    42   0.004
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    42   0.004
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    42   0.004
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    42   0.004
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    42   0.004
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    42   0.004
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    42   0.004
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    42   0.005
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    42   0.005
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    42   0.005
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    42   0.005
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    42   0.005
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    42   0.005
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    42   0.005
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    42   0.005
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    42   0.005
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    42   0.006
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    42   0.006
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    42   0.006
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    41   0.006
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    42   0.007
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    42   0.007
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    41   0.008
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    42   0.008
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    41   0.009
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    41   0.009
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    41   0.010
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    41   0.010
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    41   0.010
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    41   0.010
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    41   0.011
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    40   0.012
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    41   0.012
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      41   0.012
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    41   0.013
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    40   0.013
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    40   0.013
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    40   0.014
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    40   0.014
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    40   0.014
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    41   0.015
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    40   0.015
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    40   0.015
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    40   0.015
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    40   0.015
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    40   0.016
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    40   0.016
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    40   0.016
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    40   0.017
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      40   0.019
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    40   0.019
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    40   0.019
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    40   0.020
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    40   0.020
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    40   0.021
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    40   0.021
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    40   0.023
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    40   0.024
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    40   0.024
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    40   0.024
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    40   0.026
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    39   0.028
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    39   0.029
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    39   0.031
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    39   0.033
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    39   0.033
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    39   0.034
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    39   0.040
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    39   0.041
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    39   0.042
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    39   0.042
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    39   0.042
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    39   0.043
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    39   0.045
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    39   0.045
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    39   0.048
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     39   0.048
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    39   0.049
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    39   0.049
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    39   0.049
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    39   0.051
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    39   0.051
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    39   0.052
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    39   0.053
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.053
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    39   0.057
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    39   0.057
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    39   0.060
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    39   0.063
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    39   0.064
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    38   0.067
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    38   0.068
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    38   0.069
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    39   0.070
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    38   0.073
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    38   0.074
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    38   0.074
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    38   0.075
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    38   0.081
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     38   0.094
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    38   0.098
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    38   0.10 
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    38   0.10 
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    38   0.10 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    38   0.10 
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    38   0.10 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    38   0.11 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    38   0.11 
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    37   0.12 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    37   0.13 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    38   0.13 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    37   0.13 
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    37   0.13 
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    37   0.14 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    37   0.14 
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    37   0.15 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    37   0.16 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    37   0.16 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    37   0.17 
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    37   0.17 
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    37   0.17 
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    37   0.19 
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    37   0.20 
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    37   0.20 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.20 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    37   0.21 
SAKL0A05038g Chr1 complement(458190..460628) [2439 bp, 812 aa] {...    37   0.22 
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    37   0.22 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    37   0.23 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    37   0.23 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    36   0.24 
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    36   0.25 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    36   0.25 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    37   0.25 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    36   0.26 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    36   0.29 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    36   0.29 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    36   0.29 
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    36   0.30 
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    36   0.32 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    36   0.34 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    36   0.38 
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    36   0.40 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    36   0.43 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    36   0.44 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    36   0.44 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    36   0.45 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    35   0.45 
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    35   0.50 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    35   0.51 
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    35   0.52 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    35   0.60 
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    35   0.60 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    35   0.64 
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    35   0.66 
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    35   0.66 
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    35   0.67 
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    35   0.72 
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    35   0.81 
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    35   0.82 
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    34   0.88 
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    35   0.89 
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    34   0.91 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     35   1.0  
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    34   1.1  
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    34   1.1  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    34   1.1  
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    34   1.1  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    34   1.1  
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    34   1.2  
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    34   1.2  
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    34   1.2  
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    34   1.2  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    34   1.2  
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    34   1.2  
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    34   1.3  
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    34   1.4  
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    34   1.4  
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             34   1.5  
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    34   1.5  
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    34   1.5  
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    34   1.5  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    34   1.5  
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    34   1.5  
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    34   1.5  
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    33   1.6  
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    33   1.6  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    33   1.6  
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    33   1.7  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    33   1.8  
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    33   2.0  
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    33   2.2  
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    33   2.2  
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    33   2.4  
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     33   2.4  
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    33   2.4  
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    33   2.4  
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    33   2.6  
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    33   2.6  
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    33   2.7  
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    33   2.7  
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    33   2.8  
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    33   2.9  
KLLA0F27599g Chr6 (2558178..2559746) [1569 bp, 522 aa] {ON} high...    33   3.0  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    33   3.1  
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    33   3.2  
NDAI0E04700 Chr5 complement(1061383..1062975) [1593 bp, 530 aa] ...    33   3.3  
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    33   3.6  
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    33   3.6  
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    32   3.7  
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    32   3.8  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    32   4.1  
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    32   4.3  
TBLA0D01580 Chr4 complement(393964..394182) [219 bp, 72 aa] {ON}...    30   4.5  
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    32   4.6  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    32   4.9  
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    32   4.9  
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    32   6.2  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    32   6.9  
KLTH0H04686g Chr8 complement(419384..421726) [2343 bp, 780 aa] {...    32   7.1  
TBLA0B02980 Chr2 complement(688324..690663) [2340 bp, 779 aa] {O...    32   7.2  
CAGL0J02882g Chr10 complement(279998..281590) [1593 bp, 530 aa] ...    32   7.2  

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score = 1327 bits (3435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/701 (93%), Positives = 654/701 (93%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQIPNIQSSPEKLPSIQST 360
           GIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQIPNIQSSPEKLPSIQST
Sbjct: 301 GIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQIPNIQSSPEKLPSIQST 360

Query: 361 SNGMTTNKILTRQTSPDIENLXXXXXXXXXXXXXXXXXEAITSGSIEKDSQFNNSNLYSE 420
           SNGMTTNKILTRQTSPDIENL                 EAITSGSIEKDSQFNNSNLYSE
Sbjct: 361 SNGMTTNKILTRQTSPDIENLKSKSSSNYYKSGKNYGSEAITSGSIEKDSQFNNSNLYSE 420

Query: 421 KPNLYYRSKDQLDTSNRENSTINDVPGQIEKYGDWSSVYRKTRNSTLHIGRXXXXXXXXX 480
           KPNLYYRSKDQLDTSNRENSTINDVPGQIEKYGDWSSVYRKTRNSTLHIGR         
Sbjct: 421 KPNLYYRSKDQLDTSNRENSTINDVPGQIEKYGDWSSVYRKTRNSTLHIGRSRSSSLDST 480

Query: 481 XXXXXXXXXYTAEPLSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVF 540
                    YTAEPLSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVF
Sbjct: 481 SSSSLSVESYTAEPLSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVF 540

Query: 541 TVLHEGFTGGNSRISSSEHTIRGPXXXXXXXXXXXXTKNFEEGFIRKHVDIVEESAEPKV 600
           TVLHEGFTGGNSRISSSEHTIRGP            TKNFEEGFIRKHVDIVEESAEPKV
Sbjct: 541 TVLHEGFTGGNSRISSSEHTIRGPSSSSHKSRVSSSTKNFEEGFIRKHVDIVEESAEPKV 600

Query: 601 GIKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTNIMTPLVKSTQK 660
           GIKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTNIMTPLVKSTQK
Sbjct: 601 GIKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTNIMTPLVKSTQK 660

Query: 661 TPIDSKNSSPRKKPILPAKPLHLRSQPKQQTAILAGSKVGI 701
           TPIDSKNSSPRKKPILPAKPLHLRSQPKQQTAILAGSKVGI
Sbjct: 661 TPIDSKNSSPRKKPILPAKPLHLRSQPKQQTAILAGSKVGI 701

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  514 bits (1323), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 319/786 (40%), Positives = 436/786 (55%), Gaps = 125/786 (15%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MN  Q+  +    ++TVGSH AK++KYL SGGYAQVY   ++P D    +NIACLKRV+V
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+K+L+N ++VVSYIDSHASK + + G+YEVFVLME+C  G LIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +N+RL++RL E EIL IM+  + G+A MH LQP+L+HRDIKIEN+LIS+N EYKVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCG++RPP++ +E  ++ HDIMKNTTAQYRSPEMLDL+KG  INEKSDIWALGVFL+KLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEG-EKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
           YYTTPFEK G E AIL+++FQYP+YP+YSD LKN+IRV+LS +P  RPN+CQ++EE+SRL
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QG--------------------IVPPMKNFY----------------LSRALETSSL--- 320
           QG                    I  P++N Y                L+  L T++L   
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360

Query: 321 ------------------MQPLQNNSYKVPISDIQDKHKRQIPNIQSSPEKLPSIQSTSN 362
                               PL  N + V IS +QDK          SP +L    S S 
Sbjct: 361 QTTIPPTNQHSPHLLHTQTLPLPTNDHPVAISHVQDK---------ISPHELLKKSSKSL 411

Query: 363 GMT--TNKILTRQTSPDIENLXXXXXXXXXXXXXXXXXEAITSGSIEKDSQFNNSNLYSE 420
           G T  +NK +   ++PD  +                     TS S+        +NL S 
Sbjct: 412 GSTGTSNKNVIDTSAPD--HFTKLLHASKNTDLSYQPVTVPTSSSLY---NLPRANLSSS 466

Query: 421 KPNLYYRSKDQLDTSNRENSTINDVPGQIEKYGDWSSVYRKTRNSTLHIGRXXXXXXXXX 480
               +    D  D S R  + +++   + + Y   S+  R+T ++               
Sbjct: 467 PQKSWKSINDNYDVSKRPTNYVDE---ETQTYTGQSTFLRRTSSNR-------------- 509

Query: 481 XXXXXXXXXYTAEPLSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVF 540
                    Y+   + +N+TG SLVR LS KLKNV+TGE      ++SRQNTG S RS  
Sbjct: 510 -SNRSISSQYSG--VQENTTGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAM 561

Query: 541 TVLHEGFTG--GNSRISSSEHTIRGPXXXXXXXXXXXXTKNFEEGFIRKHVDI------- 591
             +  GFTG   N+R +S ++  R                + +E  + ++  +       
Sbjct: 562 NSIRSGFTGNNNNTRSASYDNGKRLSSVNLHMHSAILEQDDSDEFEMPRYNSVSSNTLKD 621

Query: 592 VEESAEPKVG------------IKLKTTREAKDSIKRRVRELLLVSEDEQYH--RTASGY 637
           VEE     V             +++   RE K+SI++RV++LL  +E+      RTASGY
Sbjct: 622 VEEHERRTVNTSSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGY 681

Query: 638 GKYTDV---QEIVTNIMTPLVKSTQKTPIDSKNSSPRKKPILPAKPLHLRSQPKQQTAIL 694
           GKYTD    ++ ++   + + +  Q T   +  S  RKKP +P K   L+  P  + A L
Sbjct: 682 GKYTDYNKNKDEISPTKSRVAQFNQSTAALASLSGKRKKPPVPYKRDSLKPTPPAKPAFL 741

Query: 695 AGSKVG 700
           +   V 
Sbjct: 742 SSRPVA 747

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  483 bits (1244), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 217/316 (68%), Positives = 268/316 (84%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ ++P Y P TV+TVGSH AK++ YL SGG+AQVYSA + P D    +N+ACLKRV+V
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+K+LRN K+VVSYIDSHA+K S   GSYEVF+LMEYC+GG LIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL+E EIL+IM+QV  G+A MH LQP LIHRDIKIEN+LIS  G+YKVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPP++ +E  Y+QHD++KNTTAQYRSPEM+DL +G+ I+EKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL S+FQ+PA P+YSD LK +IR +L  +P +RPN+CQ++E++SR+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GIVPPMKNFYLSRALE 316
           GI  P++NFYL RA+E
Sbjct: 301 GIQCPVRNFYLLRAME 316

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 8/93 (8%)

Query: 607 TREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTNIMTPLVKSTQKTPIDSK 666
           +REAK+SI+RRVR+LL  SED    ++     +    Q   T+          + P   +
Sbjct: 545 SREAKESIQRRVRDLLNSSEDLPLSKSEPKKDEPKRGQLSKTH--------HDEKPSVKE 596

Query: 667 NSSPRKKPILPAKPLHLRSQPKQQTAILAGSKV 699
            S  + +P  P KP HLR +P  + A L+G K+
Sbjct: 597 KSKQKVRPRAPPKPAHLRPKPPPKPAFLSGKKM 629

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  484 bits (1246), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/324 (67%), Positives = 267/324 (82%), Gaps = 4/324 (1%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ ++PLY P  ++ VGSH AKI+KYL SGG+AQVY   ++P D    +NIACLKRV+V
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGH----TGSYEVFVLMEYCSGGS 116
           PDK SLN  RAEV+A+K+LRN KYVVSYIDSHA+K         GSYEVF+LMEYCSG  
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVC 176
           LIDF+NTRL+NRL+E EIL+IM+ V+ GVA MH LQP L+HRDIKIEN+LIS   E+K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFL 236
           DFGSVCGVIRPP +  E+ ++QHDI+KNTTAQYRSPEML L+K   INEKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 FKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296
           +K+CYYTTPFEKEGE AIL S++QYPAYP YSD+LKN+IRV+L VDP KRPNICQ++EE+
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRLQGIVPPMKNFYLSRALETSSL 320
           SRLQG+  P+KNFYL RA+  +++
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAV 324

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  481 bits (1237), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 225/380 (59%), Positives = 285/380 (75%), Gaps = 7/380 (1%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ  +P Y P T++TVGSH  KI+KYL SGG+AQ+Y+  ++P++    +  ACLKRV+V
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK  LN LRAEVDA+K+L+N ++VVSYIDSHA++ +   G+YEVF+LMEYC GG LIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E+EIL+I++Q   GV+ MH LQP+LIHRDIKIEN+LIS  GE+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VC  IRPPR+ +E+ Y+QHD++KNTTAQYR+PEMLDL +G  INEKSDIWALGVFL+KLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL S++QYPA+P+Y+D LKN+IR  L  DP KRPNICQL+EE+SR+Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GIVPPMKNFYLSRALET-SSLMQPLQNNSYKVPISDIQDKHKRQIPNIQSSPEKLPSIQS 359
           GI  P+ NFYLSR +   +SLM P+       P      KH +    I      +P   S
Sbjct: 301 GIPCPINNFYLSRTINVQASLMNPI-----ITPTQQTALKHSQSSATISDQSYAVPLASS 355

Query: 360 TSNGMTTNK-ILTRQTSPDI 378
            S+  T NK IL     PD+
Sbjct: 356 RSSTTTGNKPILIETEIPDM 375

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 103/221 (46%), Gaps = 30/221 (13%)

Query: 495 LSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTGG-NSR 553
           L ++ TG S+ +  +  LK V+TGE R+ SP+RSRQNTGGS RS F  L  G TG  NSR
Sbjct: 461 LKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTNSR 520

Query: 554 ISSSEHTIRGPXXXXXXXXXXXXTKNFEEGFIRK------------HVDIVEESAEPKV- 600
           +SS   ++R                   +  IR             + D       PK+ 
Sbjct: 521 VSSLASSVRNVSSSSKHSKHSDADDEPNKIKIRMKKAHRRSVPPNLYSDFYANEDTPKLY 580

Query: 601 ----GIKLKTTREAKDSIKRRVRELLLVSEDEQYH-RTASGYGKYTDVQEIVTNIMTPLV 655
                +KLK+    ++SI+ RV+ LL   E+E    +TASGYGKYTD + I + +  P  
Sbjct: 581 SSNSPVKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPV--PER 638

Query: 656 KSTQKTPIDSKNSSPRKKPI---------LPAKPLHLRSQP 687
                TP + + SS    P+          P KP HLR  P
Sbjct: 639 GGRIPTPTNKRYSSVIINPVTEPISIRPSPPPKPKHLRPIP 679

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  470 bits (1210), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/322 (65%), Positives = 266/322 (82%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ  +PLY   T++TVG+H A I KYL SGG+AQ+Y+  +TPVD    +N+ACLKRV+V
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           P K  LN LRAEVDA+K+L+N ++VVSYIDS+A K + + GSYEV +LMEYC GG LIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +N+RL+NRL E EIL+I++Q A GVA MH LQP L+HRDIKIEN+L S NGE+K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCG IRPPR+ +E+ Y+QHDI+KNTTAQYR PEMLDL +G  I+EKSDIWALGVFL+KLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL S+FQYPA+P+YSD LKN+IRV+LS +P KRPNIC+L+EE+S +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GIVPPMKNFYLSRALETSSLMQ 322
           G+  P++NFYL RA + ++ +Q
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQ 322

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 37/55 (67%)

Query: 495 LSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTG 549
           L  N+TG S  +  + K+K V+TGE R+ SP+RSRQ+TGGS RS F  +   FTG
Sbjct: 476 LQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTG 530

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 16/100 (16%)

Query: 607 TREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTNIMTPL-VKSTQK----- 660
           T+  +D+I++RV+ LL  SE EQ     +    +T+    V++ M P  + S +K     
Sbjct: 623 TKTTRDNIQQRVQNLL--SESEQPMERNNIDTHHTNA---VSHSMIPRNLNSREKDSLRY 677

Query: 661 -----TPIDSKNSSPRKKPILPAKPLHLRSQPKQQTAILA 695
                 P++   SSP+K P LP KP HLR +P  +   L+
Sbjct: 678 SSVVINPLEDIGSSPKKAPPLPFKPHHLRPKPPPKPTYLS 717

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  471 bits (1211), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 261/315 (82%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ    +Y P T +TVGSH A+I+KYL SGG+A +Y+A + P D S    IACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+K+LR  ++VVSYIDSHA+K   H GSYEVF+LMEYCSGG LIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL+E E+L I + +  G+A MH LQP LIHRDIKIEN+LIS++  +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPP++ +E  Y+QHDI+KNTTAQYR+PEM+DL +GY INEKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL S+FQ+P+YP YSDSLK++I  +LS +P +RPNICQ++EE+SR+Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GIVPPMKNFYLSRAL 315
           G   P++NFY++RA+
Sbjct: 301 GTPCPLRNFYVTRAM 315

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 1/52 (1%)

Query: 500 TGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTGGN 551
           TG S  R   +KLK V TGE+RS+SP++SRQNTG S RS F  L  GF+GG+
Sbjct: 507 TGGSATRRFGQKLK-VFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGS 557

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 602 IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYG 638
           +K+  T+ ++ SI++RV++LL  S+D    +TA GYG
Sbjct: 635 VKVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYG 671

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  470 bits (1209), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/315 (67%), Positives = 266/315 (84%), Gaps = 1/315 (0%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           M+Q  L  Y   TV+TVGSH A+I+KYL SGG+A +YSA ++P D + +++IACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN+LRAEVDA+K+L+  K+VVSYIDSHA+K S + GSYEVF+LMEYC+ G LIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL+E E+L IM+QV+ GVA MH LQP LIHRDIKIEN+LISE+G +KVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPP++ +E+ Y+QHDI+KNTTAQYRSPEM+DL +G  ++EKSDIWALGVFL+KLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL S+FQ+PAYP YSD LKN+I  LL  +P +RPNICQL+ E+SR+Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GIVPPMKNFYLSRAL 315
           G+  P+KNFYL R +
Sbjct: 300 GVPCPVKNFYLERKM 314

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 83/172 (48%), Gaps = 29/172 (16%)

Query: 499 STGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEG----FTGGNSRI 554
           STG S  R +  KLK +I+ E R+ SP+RSRQNTGGS+RS F+ L  G    F+   S+ 
Sbjct: 502 STGGSFTRRIGDKLKRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRGTSSNFSSDRSKR 561

Query: 555 SSSEHTIR----GPXXXXXXXXXXXXTKNFEEGFIRK-HVDIVEESA--------EPKVG 601
           +S + ++R    G              K     F  K H   V  S+        E K G
Sbjct: 562 NSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYEGKAG 621

Query: 602 ------------IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYT 641
                       IK+   RE+++SI++RV +LL  S+D    +TA  +G+++
Sbjct: 622 SVSRGYNQAHSPIKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFS 673

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  468 bits (1203), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 230/391 (58%), Positives = 284/391 (72%), Gaps = 16/391 (4%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ Q+  Y   T++ VGSH  K++KYLASGG+A VYS  ++P D     N+ACLKRVVV
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVD++K LR  K++VSYIDSHA+K   + G YEV++LMEYCSGG LIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL+E EIL+IM+QV+ GVA MH LQP LIHRDIKIEN+L+S+N E+K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V GVIR PR+ EE  Y+Q+DIMKNTTAQYR PEM+DL +G  I+EKSDIWALGVFL+K C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL S+F++PAYP YSD +KN+I V+L VDP KRPNICQ++EE+SR+Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 GIVPPMKNFYLSRAL---ETSSLMQPLQNNSYKVPISDIQDKHKRQIP-----NIQSSPE 352
           GI  P+KNFYL R +   E   +  P       VP +       + +P     N+Q +P 
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQ-TPS 359

Query: 353 KLPSIQ-------STSNGMTTNKILTRQTSP 376
           K  SIQ       S S  M T + L  Q  P
Sbjct: 360 KTASIQHLPYLHVSKSQPMVTQQDLLSQKQP 390

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 105/218 (48%), Gaps = 32/218 (14%)

Query: 499 STGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEG-----FTG-GNS 552
           STG SL R +  K+K VITGEKR  S +RS QNTG S +S F  L +G     FTG  +S
Sbjct: 520 STGGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSS 579

Query: 553 RISSSE-HTIRGPXXXXXXXXXXXXTKNFEE-----GFIRKHVD--IVE--ESAEPKVGI 602
           R SS E    R              TK+         F+ ++ D  ++E  +  +PK  +
Sbjct: 580 RKSSLEARKYRSTSGKSIPENTSSNTKSHRRSTSSFSFVPENNDYELIEDIQKEKPKSSL 639

Query: 603 KLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIV--------------T 648
           +  ++ +   SI++RV++ L+ ++D     +A+GYGKYTD+                  +
Sbjct: 640 RRSSSLKTSSSIQKRVKD-LINADDIPNRSSATGYGKYTDIGRKTDISDHHKSNANRKSS 698

Query: 649 NIMTPLVKSTQKTPIDSKNSSPRKKPILPAKPLHLRSQ 686
            ++TP V    K+           KP LP KP HL+++
Sbjct: 699 TVITP-VHEAPKSKPAPPPKPAHLKPNLPPKPKHLKAK 735

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  465 bits (1196), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 289/380 (76%), Gaps = 15/380 (3%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MN  ++P Y P TV++VG+H AKI+KY+ASGG+AQVYSA + P D    TN  CLKRV++
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           P+K  LNALRAEV+A+K+L+  K+VV YIDSHA++     G+YEVF+LME+C+ G LIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL+E EIL+IM+QV  G+A MH LQP LIHRDIKIEN+LIS +GEYKVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V G IRPPR+ +E  ++QHDI+KNTTAQYRSPEM+DL +   I+EKSDIWALG+FL+KLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK G++AIL S++Q+ A+P+YSD LKN+I  +LS  P +RPNICQ++EE+SR+Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GIVPPMKNFYLSRALE----TSSLMQP----LQNNSYKVPISDI------QDKHKRQIPN 346
           G+  PM+NFYL RA++    ++S + P    +  N++  P + +      Q      +P 
Sbjct: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMP- 359

Query: 347 IQSSPEKLPSIQSTSNGMTT 366
           +  +P+ +P +  T +G++T
Sbjct: 360 VGVTPQPMPIMAKTRSGIST 379

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  465 bits (1196), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 259/315 (82%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ    +Y   T +TVGSH A+I+KYL SGG+A +YSA ++P D +   N+ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK+SLN LRAEVDA+K+LR  K+VVSYIDSHA+K     GSYEVF+LMEYCS G LIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E E+L IM+ +  G+A MH L P LIHRDIKIEN+LIS++  +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPP++ +E  Y+Q+DI+KNTTAQYRSPEM+DL +G+ INEKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK G+ AIL S+FQ+PAYP YSD LKN+I V+LS +P +RPNICQ++EE+SR+Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GIVPPMKNFYLSRAL 315
            +  P++NFYL R++
Sbjct: 301 NVPCPLRNFYLLRSM 315

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 87/175 (49%), Gaps = 28/175 (16%)

Query: 499 STGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTGGN------S 552
           STG S  RT  ++LK V TGEKRS+SP++SRQNTG S +S F  L  GF+ G+      S
Sbjct: 509 STGGSFSRTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLS 568

Query: 553 RISSSEHTIRGPXXXXXXXXXXXXTKNFEE--GFIRKH------VDIVE--ESAEPKVG- 601
           + ++ + T  G                 EE  GFI  H        IV   +S +   G 
Sbjct: 569 KKNTVDVTTNGSSSNGYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSLQDDSGT 628

Query: 602 -----------IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQE 645
                      +KL  + +A+ SI++RV+ LL  S+D    ++A GYG+ ++ ++
Sbjct: 629 NAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKED 683

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  458 bits (1178), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 258/315 (81%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ Q+ +Y P T+++VGSH A+I+KYL SGG+AQVY+A ++P+D    ++I CLKRV+V
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+K+LRN  +VVSYIDSHA+K   + GSYEVF+LMEYC  G LIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E EIL IM+QV+ GVA MH LQP L+HRDIKIEN+L++  G YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCG+IRPP + +E  Y+QHDIMKNTTAQYRSPEM++L KG  INEKSDIWALGVFL+KLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL + FQ+P +P YSD +K++IR+ L+V P +RPNI QL+EE+S++Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GIVPPMKNFYLSRAL 315
            +  P+ +FYL R L
Sbjct: 301 NVPCPIPDFYLQRKL 315

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  463 bits (1192), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 222/370 (60%), Positives = 275/370 (74%), Gaps = 17/370 (4%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MN  Q+ LY P T++TVGSH AKI+KYL SGG+AQVY+A ++P D     NIACLKRV+V
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK+ LN LRAEVDA+K+L+N K+VVSYIDSHA+K S +  +YEVFVLME+C  G LIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRLRE EIL IM+Q   G+A MH LQP LIHRDIKIEN+LIS NG YKVCDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V GVIRPPR+ +E  Y+QHDI+ NTTAQYRSPEM+DL +G  I+EKSDIWALG+FL+K+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE  IL +++QYP +P YSD LKN+IR++L   P KRPNICQ++EE+SRLQ
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 GIVPPMKNFYLSRALETSSLMQ---------------PLQNNSYKVPISD-IQDKHKRQI 344
               P++NFYL RA+  ++ +                P Q      PIS+ I   H R  
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTT 359

Query: 345 PNIQSSPEKL 354
           PN+ + P  +
Sbjct: 360 PNLSTLPRSI 369

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 40/53 (75%)

Query: 497 KNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTG 549
           +N +G ++VR+LS KLK VITGE R  SP++SRQNTG S+RS   +L  GFTG
Sbjct: 500 ENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTG 552

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 597 EPKVGIKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTN 649
           +P +G  +   +E K+SI+RRV  LL  SED   +++ASGYGKYTD     +N
Sbjct: 658 KPVIG-DININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSN 709

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  459 bits (1181), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 208/321 (64%), Positives = 261/321 (81%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ  +P Y     + VG H A I+KYL SGGYAQVY A ++P D    ++I CLKR++V
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN  RAEVDA+K+LRN  +VVSYIDS+A+K   H G+YEV +LME+C+ G LIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL+E EIL+IM+QV  GVA MH L+P L+HRDIKIEN+LIS +GEYK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPP S +E  ++QHDI+KNTTAQYR+PEM+DL++   I+EKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL S+++Y AYP YSD+LKN+IR++L+  P +RPNICQ++EE+SRLQ
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GIVPPMKNFYLSRALETSSLM 321
           GI  P+KNFYL RA+  S+LM
Sbjct: 301 GIPCPIKNFYLERAIHRSTLM 321

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 18/99 (18%)

Query: 612 DSIKRRVRELLLVSEDEQYHRTASGYGKYT--------DVQEIVTNIMTPLVKSTQKTPI 663
           +SI+ R++ L+  +++   ++ AS YGKYT        D  E + +      K   KT  
Sbjct: 586 NSIQDRMKNLIDNADNIPINKIASDYGKYTKSSDNFGKDSGEEMND------KENIKTAN 639

Query: 664 DSKNSSPRK----KPILPAKPLHLRSQPKQQTAILAGSK 698
               + P+K    KP+   KP HLR Q   +   LAG +
Sbjct: 640 SGTRNQPKKNKKEKPVPAKKPAHLRPQKPPKPTFLAGKR 678

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  461 bits (1187), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 222/364 (60%), Positives = 277/364 (76%), Gaps = 5/364 (1%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MN  Q+ LY P T++TVGSH AKI+KYL SGG+AQVYSA ++P D   + NIACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK+ LN LRAEVDA+K+L+N K+VVSYIDSHA+K S +  +YEVFVLMEYC  G LIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRLKNRL+E EIL IM Q   G+A MH LQP LIHRDIKIEN+LIS  G YKVCDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V GVIRPP++ +E  Y+QHDI+ NTTAQYRSPEM+DL +G  I+EKSDIWALGVFL+K+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL +++QYP++P YSD LKN+IR++L   P +RPNICQ++EE+SRLQ
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQIPNIQSSPEKLP--SIQ 358
               P++NFYL RA+  ++       +    P   +      Q  NIQ+ P  +P  +I+
Sbjct: 300 NRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQ--NIQAMPNIVPLSNIK 357

Query: 359 STSN 362
           +T N
Sbjct: 358 TTPN 361

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/63 (58%), Positives = 45/63 (71%), Gaps = 3/63 (4%)

Query: 497 KNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTG---GNSR 553
           +N TG  +VR+LS KLK VITGE R+ SP++SRQNTG S RS F +L  GFTG    NSR
Sbjct: 500 ENVTGGKIVRSLSSKLKRVITGESRNGSPIKSRQNTGDSIRSAFGMLRHGFTGSSINNSR 559

Query: 554 ISS 556
            +S
Sbjct: 560 STS 562

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 30/42 (71%)

Query: 608 REAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTN 649
           +E K+SI+RRV  LL  SED   +++ASGYGKYTD +   TN
Sbjct: 665 QEKKESIQRRVHNLLNNSEDSLSYKSASGYGKYTDTEAESTN 706

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  454 bits (1168), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 201/311 (64%), Positives = 250/311 (80%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ Q+PLY P T++TVGSH  ++VKYL SGG+AQ+Y+  ++P D    TN+ACLKRV+V
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVD +K+LRN  +VVSYIDSHA+K + + GSYEVF+LMEYC  G LIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+ RLRE EIL+IM+QV  G+A MH L P L+HRDIKIEN+L++  GEYKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCG+IRPP + +E+ Y+QHDIMKNTTAQYR+PEM+DL +G  I+EKSDIWALGVFL+KLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL + FQ+P YP YSD LK +I  +L   P +RPN  Q++EE+S +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GIVPPMKNFYL 311
            +  P+ NFYL
Sbjct: 301 NVQCPIPNFYL 311

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  454 bits (1169), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 208/322 (64%), Positives = 259/322 (80%), Gaps = 1/322 (0%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MN  Q+ LY P T++TVGSH AKI+KYL SGG+AQVY+A ++P D     NIACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           P K+ LN LRAEVDA+K+LRN K+VVSYIDSHA++ S +  +YEVFVLME+C  G LIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAAR-SVNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL+E EIL IM+Q   G+  MH LQP LIHRDIKIEN+LIS +G YKVCDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V GVIRPPR+ +E  Y+QHDI+ NTTAQYRSPEM+DL +G  I+EKSDIWALGVFL+K+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE  IL +++QYP++P YSD LKN+IR++L   P +RPNICQ++EE+SRLQ
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIVPPMKNFYLSRALETSSLMQ 322
               P++NFYL RA+  ++  Q
Sbjct: 300 NKPCPIRNFYLLRAMNQNANTQ 321

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 3/62 (4%)

Query: 498 NSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTG---GNSRI 554
           N  G  +VR+LS KLK VITGE R  SP++SRQNTG S RS F  L  GFTG    NSR 
Sbjct: 503 NINGSKIVRSLSSKLKKVITGESRGNSPIKSRQNTGDSIRSAFGKLRHGFTGNSVNNSRS 562

Query: 555 SS 556
           +S
Sbjct: 563 AS 564

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 608 REAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTN 649
           +E K+SI+RRV  LL  S+D   +++ASGYGKYTD+    +N
Sbjct: 670 QEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYTDIGTETSN 711

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  451 bits (1159), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 255/315 (80%), Gaps = 1/315 (0%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MN  Q+ LY P TV+TVGSH AKI+KYL SGG+AQVY+A ++P D     N ACLKRV+V
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK+ LN LRAEVDA+K+L+N K+VVSYIDSHA+K S +  +YEVFVLME+C  G LIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL++RLRE EIL IM+Q   G+A MH LQP LIHRDIKIEN+LIS +G YKVCDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V GVIRPPR+ +E  Y+QHDI+ NTTAQYRSPEM+DL +   I+EKSDIWALGVFL+K+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL S++QYP++P YSD LK +I ++L   P +RPNICQ++EE+SRLQ
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 GIVPPMKNFYLSRAL 315
               P++NFYL RA+
Sbjct: 300 NEPCPIRNFYLLRAM 314

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%)

Query: 497 KNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTG 549
           +N TG S+VR+LS KLK VITGE RS SP++SRQNTG S RS F +L  G TG
Sbjct: 502 ENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTG 554

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 28/39 (71%)

Query: 611 KDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTN 649
           K+SI+RRV  LL  SED   H++ASGYGKYTDV    +N
Sbjct: 672 KESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASN 710

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  432 bits (1111), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 205/358 (57%), Positives = 275/358 (76%), Gaps = 9/358 (2%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ ++  Y P T++ VGSH  +I+KY+ SGG+AQ+Y+  ++P D    +NIACLKRV+V
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+K+LRN K+VVSYIDSHASK + + GSYEVF+LMEYC  G LIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E E+L I +QVA G+A MH LQP L+HRDIKIEN+LIS++ +YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V G+IRPP + +E++Y+QHD++KNTTAQYRSPEM+D  +G  I+EKSDIWA+GVFL+KLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKE-GEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
           YYTTPFEK  GE AIL ++++YP +P+YS+ LK++I  +L  +P +RPNI Q+IEE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGIVPPMKNFYLSRALETSSL--MQPLQNNSYKV----PISDIQDKHKRQIPNIQSSP 351
           Q +  P+ NFYL    +   +  +QP+  N+  V    PI  +QD  +R +    SSP
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPI--LQDGKQRILEQHSSSP 356

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  445 bits (1144), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 204/316 (64%), Positives = 254/316 (80%), Gaps = 1/316 (0%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ     + P TV+TVGSH  K+VKYL SGG+AQ+Y   V   D S   ++ACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK+SLN LRAEVDA+K+LR  K++VSYIDSHASK   + GSYEV +LMEYCS G LI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL++RL+E E+L IM QV  G+  MH LQP LIHRDIKIEN+LI+ENG+ KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPP++  E+ Y+QHDI+KNTTAQYR+PEM+DL +G+ ++EKSDIWALGVFL+KLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AILK+ FQ+P+YP YS+ LKN+I V+L+ +P  RPN CQ++EE+ R+Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 GIVPPMKNFYLSRALE 316
           G   P+KNFYL R+L+
Sbjct: 300 GQPCPVKNFYLERSLK 315

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  440 bits (1131), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 249/314 (79%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ Q+  Y   T +TVGSH  +IVKYL SGG+AQVYSA ++P D    +NIACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+++LRN +YVVSYIDSHA+K   H GSYEVFVLMEYC  G LIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E EIL IM+QV  GVA MH LQP LIHRDIKIEN+LIS N EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPPR+ +E+ Y+Q DI KNTTAQYRSPEM+D+ +G  I+EKSDIWALG+FL+KLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL   F++P YP YS+ L+++IR +L  +P +RPN+ QL++ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GIVPPMKNFYLSRA 314
            +  P+ +  + +A
Sbjct: 301 NVPCPISDIQVPQA 314

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  438 bits (1127), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 200/320 (62%), Positives = 253/320 (79%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ +L      T +TVG+H+ KI+KYL SGG+AQ+Y+  +  +     +N+ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+K+L N K+VVSYIDSHA++   + G+YEVF+LMEYC GG LIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E EIL IM+Q   G+A MH L P L+HRDIKIEN+L+S+ G YKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V GVIRPPR+ +E+ Y+QHDIMKNTTAQYR PEMLDL +G  I+EK+DIWALGVFL+KLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL ++FQ+P++P YSD LKN+I+ +L   P  RPN+CQ++EE+SR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GIVPPMKNFYLSRALETSSL 320
            +  P++NFYL RA+E   L
Sbjct: 301 NVPCPIRNFYLLRAMEKVKL 320

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 602 IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTD 642
           + L    E + SI+ RV+ LL      +  ++A GYGKYTD
Sbjct: 541 LPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD 581

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  434 bits (1115), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 256/329 (77%), Gaps = 1/329 (0%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ Q+  Y   T +TVGSH  +I+KYL SGG+AQVYSA ++P D    +N+ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+K+LRN +YVVSYIDSHA+K + H GSYEVFVLMEYC  G LIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E EIL IM QV  GVA MH LQP LIHRDIKIEN+LIS   EYK+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCGVIRPPR+ +E+ Y++ D++KNTTAQYRSPEM+D+ +G  I+EKSDIWALG+FL+KLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL  QF++  YP YS+ L+N+I  LL  +P +RPN+ QL+++++ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GIVPPMKNFY-LSRALETSSLMQPLQNNS 328
               P+++   + R     +LM+  QN++
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNLMELHQNSA 329

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  434 bits (1115), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 247/314 (78%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ Q+  Y   T +TVGSH  +I+KYL SGG+AQVYSA + P D    +++ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+++L+N +YVVSYIDSHA+K   H GSYEVFVLMEYC  G LIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E EIL IM+QV  GVA MH LQP LIHRDIKIEN+LIS N EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCG+IRPPR+ +E+ Y+Q DI+KNTTAQYRSPEM+D  +G  I+EKSDIWALG+FL+KLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK G+ AIL  +F++P YP YS+ LK +IR +L  DP  RPN+ QL++ +S +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GIVPPMKNFYLSRA 314
            +  P+ +  + +A
Sbjct: 301 NVPCPINDIQVVQA 314

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  434 bits (1116), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 250/335 (74%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ  +  Y P T + VG H   I+KYL SGG+AQ+Y   V P +     N+ACLKRV+V
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           P+K  LN LRAEV+A+++L+ K +VV YIDS+A++   + G+YEV  LME+C GG LIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL+E E+L+IM QV  G+  MH L P LIHRDIKIEN+LIS NGEYKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V G+IRPP++ EE  ++Q DIMKNTTAQYR PEMLDL +G  INEKSDIWALGVFL+K+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFE  GE+AIL +++QYP YP+YS  LKN+IR++L   P +RPN+CQ++EE+S +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISD 335
           GI  P+ NFYL R   T  +M     + Y +P  +
Sbjct: 301 GIPCPLPNFYLQRQQATQLMMNNTNGSIYPIPTQN 335

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  427 bits (1097), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 190/319 (59%), Positives = 252/319 (78%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ  +  Y   T +TVGSH  +I+KYL +GG+AQ+Y   ++P+D    TNIACLKRV+V
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+K+LRN + VVSYIDSHA+K S   G+YEVF+LMEYC  G LI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           LN+RL+NRL+E E+++IM  V+ GVA MH LQP L+HRDIKIEN+L+S+N E+K+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V G IRPP + +E+  +Q+DIM+NTTAQYRSPEM+D+++G+ I+EKSDIWALGVFL+K+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE  IL S++++PA+P YSD L+++I  LL+V P  RPNI  +++ELS ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GIVPPMKNFYLSRALETSS 319
            I  P+ NFYL   +  +S
Sbjct: 301 NISCPIINFYLKPNMTDAS 319

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  425 bits (1092), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 246/314 (78%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ Q+  Y   T +TVGSH  +I+KYL SGG+AQVYS  ++P D    TN+ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK SLN LRAEVDA+++L+N +YVVSYIDSHA+K     GSYEVFVLMEYC  G LIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E EIL I++QV  GVA MH LQP LIHRDIKIEN+LIS N EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           VCG+IR PR+ +E+ Y+Q DI+KNTTAQYRSPEM+D+ +G  I+EKSDIWALG+FL+KLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFEK GE AIL  +F++P YP YS+ LK++IR +L  +P  RP++ QL++ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GIVPPMKNFYLSRA 314
            +  P+ +    +A
Sbjct: 301 NVPCPINDIQTVQA 314

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  442 bits (1138), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 249/317 (78%), Gaps = 6/317 (1%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATN----IACLK 56
           MNQ ++P Y    V+ +G+H   I KYLA GG+AQVYS  V  +D S A N    +ACLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 58

Query: 57  RVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGS 116
           RV+VPDK  LN LRAEVDA+K+L+  KY+VSYIDSHA +     G YEVF+LMEYCS G 
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118

Query: 117 LIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVC 176
           +IDFLNTRL +RL+E EIL IM+ V  GVA MH LQP LIHRDIKIEN+LISENG+YK+C
Sbjct: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178

Query: 177 DFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFL 236
           DFGS C V+RPP++ +E  +I HDIM NTTAQYRSPEM+D   GY I+EKSDIWALGVFL
Sbjct: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238

Query: 237 FKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296
           +KLCYYTTPFEKEGE AIL  +FQ+P+YP YSD ++N+I ++L+ DP KRPNICQ++E++
Sbjct: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298

Query: 297 SRLQGIVPPMKNFYLSR 313
           S+LQG+  P++NF L+R
Sbjct: 299 SKLQGVPCPIENFMLTR 315

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 601  GIKLKTTREAKDSIKRRVRELLLVSE-DEQYHRTASGYGKYTD 642
             ++L +  +AKD IK+RV ELL  SE D    RTA GYGKYTD
Sbjct: 1197 SLRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 1239

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  425 bits (1093), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 247/316 (78%), Gaps = 7/316 (2%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPAT---NIACLKR 57
           MNQ       P  ++TVGSH  KI++YL SGG+AQ+YS  V     SP     ++ACLKR
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEV----LSPGPIQGSLACLKR 56

Query: 58  VVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSL 117
           V VPDK SLN LRAEVDA+K+L+  ++VVSYIDSHA+K   H G+YEV++LMEYC  G L
Sbjct: 57  VHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGL 116

Query: 118 IDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCD 177
           IDF+N+RL+ RL E E+L IM+ VA G+  MH L P LIHRDIKIEN+LIS +G++KVCD
Sbjct: 117 IDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCD 176

Query: 178 FGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLF 237
           FGSV GVIRPP++  E  Y+QHDI+KNTTAQYR+PEM+DL +   ++EKSDIWALGVFL+
Sbjct: 177 FGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLY 236

Query: 238 KLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELS 297
           K+CY+TTPFEK GE AIL+++FQ+P+YP Y+D LKN+I V+LS  P +RPNICQ++EE+S
Sbjct: 237 KVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVS 296

Query: 298 RLQGIVPPMKNFYLSR 313
           R+QG+  P+ NFYL R
Sbjct: 297 RIQGVPCPLPNFYLER 312

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  416 bits (1070), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/311 (60%), Positives = 240/311 (77%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MN   +P Y P T VTVGSH+  I+KYL SGGYAQ+YSA + P D    TN+A LKRV+V
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           PDK  LN LRAEVDA+K L++ KY+VSYIDSHA+K     G+YEVF++MEYCS G LIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NTRL+NRL E EIL I   ++ GVA MH LQP LIHRDIKIEN+LIS + +YK+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
           V G IRPP++ EE+ Y++HDIM +TTAQYR+PEMLDLTKG+ +N+KSDIWALGVFL+KLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           YYTTPFE+ GE  IL    ++P YP YSD++K +I  +L+ +P  RPNI Q+I+ +S+L 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 GIVPPMKNFYL 311
            +  P+ N ++
Sbjct: 301 NVNCPIPNIHV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  417 bits (1071), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 199/345 (57%), Positives = 255/345 (73%), Gaps = 4/345 (1%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA 68
           Y   T + V SH   I  YL SGG+AQVY+A +T    +    + CLKRV+VP+K+SLN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNR 128
           LRAEVDA+K+L+N KY+VSYIDSHA++      SY V +LMEYCSG  L+DF+N RLK R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPP 188
           L+E+EIL IMT V+ GV  MH+LQP L+HRDIKIEN+L+S +G +K+CDFGSV GV+R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 RSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK 248
            S EE  Y+Q+DI+KNTTAQYRSPEM++L  G+ INEKSDIWALG+ L+KLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 EGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKN 308
            G +AI++ +F YPAYP Y+DSLKN+IRVLLS +P +RPNICQL+EEL R+Q    P+ N
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 FYLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQIPNIQSSPEK 353
           FY+ RA+   S +Q      +++PI       K  I + QSSP K
Sbjct: 309 FYVQRAM---SSLQMDTTQPHRIPILKYTQMSKPVISS-QSSPSK 349

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 103/213 (48%), Gaps = 18/213 (8%)

Query: 491 TAEPLSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTGG 550
           + + +S+NSTG SL+++L  K+K   TG KRS SP++SRQNTG S RS F  + +G    
Sbjct: 494 SVDSISRNSTGGSLIKSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGINLR 553

Query: 551 NSRISSSEHTIRG-------PXXXXXXXXXXXXT-KNFEEGFIRKHVDIVEESAEPKVG- 601
           +SRISS++  +R        P            T KN  E         +    +  +  
Sbjct: 554 SSRISSNDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEYNSLSRKLSLSSQKQNSLND 613

Query: 602 ------IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTNIMTPLV 655
                 I L T  EAK SIK RV+ L+  S D     +A GYGKYTD +  + +  + + 
Sbjct: 614 STSNDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTDNKSSIKHFKSNIE 673

Query: 656 KSTQKTPIDSKNSSP---RKKPILPAKPLHLRS 685
             T    ++    +    + KP +P KP+ LRS
Sbjct: 674 HLTAYGNMNGHLKTAHHLKAKPKVPTKPVFLRS 706

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  414 bits (1063), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 192/317 (60%), Positives = 247/317 (77%), Gaps = 6/317 (1%)

Query: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60
           MNQ  +P Y P  V+ VGSH AKI+KYL SGG+AQ+YS  ++P D    +NIACLKRV+V
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
           P+K  LN LR EVDA+K+L+N ++VVSYIDS+A+K     GSYEVF+LMEYC  GSL+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180
           +NT+L+ RL+EQE+L+IM QV  G+A MH+L P LIHRDIKIEN+LIS +G +KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEK---SDIWALGVFLF 237
           VCG+IRPPR+ +E++Y+QHD+MKNTTAQYRSPEM+DL KG+ I  K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELS 297
            L +YT  F ++ E AIL  ++QYPAYP+YSD LKNV+RVLLS  P KRPNICQL+EE+S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 RLQGIVPPMKNFYLSRA 314
           ++Q I  P+ NFYL R+
Sbjct: 298 KIQNIPCPIDNFYLERS 314

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 111/267 (41%), Gaps = 65/267 (24%)

Query: 498 NSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTG-------- 549
           ++TG S+V  L  +L+NVIT +  + S + + Q TG S +S    L    +G        
Sbjct: 485 DNTGNSIVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKAL 544

Query: 550 ------------GNSRISSSEHTIRGPXXXXXX-XXXXXXTKNFEEGFIRK--HVDIVEE 594
                       G+S    S + I  P             T N  +  +    H ++ +E
Sbjct: 545 SVENARNHLERLGSSYSIGSNNNIAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDE 604

Query: 595 S--------AEPKVG------IKLKTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKY 640
           +         +PK        +K    R+ K SI++RV  LL  +ED    +TA+GYGKY
Sbjct: 605 NELYDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKY 664

Query: 641 TDVQEIV--TNIMTPLVK--STQKTPI--------------------DSKN----SSPRK 672
           T   ++V  TN    LV+  S  +TP+                    D+ N    +  + 
Sbjct: 665 TKRPKMVSPTNPHYHLVRQNSVSQTPLILSARGSSGHPVVVPALINRDNDNGKYPAKSKA 724

Query: 673 KPILPAKPLHLRSQPKQQTAILAGSKV 699
            P++P KP HLR +P ++ A L+  K+
Sbjct: 725 PPVVPKKPDHLRPKPPKKPAHLSSLKI 751

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  288 bits (737), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 214/345 (62%), Gaps = 16/345 (4%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPATNIA-----CLKRVV 59
           YVP T+V VG H  ++VKYLA GG+A++Y      Y++ VD +    +      CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
           V D   LN +R EV+ ++ L+    VV Y DS+AS+       YEV +LME CS  SL+D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           ++N RL  +L E EIL IM  V + VAQMH L   LIHRDIKIEN+L+     +K+CDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKL 239
           S    +    S++++  +  +I  +TT QYRSPEM+DL +   +NEKSDIWALGVFL+KL
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 240 CYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
            +YTTPFE+ G+ AIL S++++P    YS  L N+I V+L+ +P  RPNI Q++ ++  +
Sbjct: 269 MFYTTPFERTGQFAILHSKYEFPLN-NYSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 300 QGIVPPMKNFY------LSRALETSSLMQPLQNNSYKVPISDIQD 338
            GI  PM + Y        +  E  S +Q  QN  Y++ +  I++
Sbjct: 328 SGIKNPMDDAYGLGAYSFEKYTEYQSKLQNYQNQMYQIQVRKIKN 372

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  288 bits (737), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 206/324 (63%), Gaps = 24/324 (7%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT-------------- 50
           + P  VV VG H  +I+KYLA GG+AQ+YS     Y+      P +              
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 51  ---NIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASK-HSGHTGSYEVF 106
              N+ACLKRV+VPD+  LN LR EV+ ++ L+    +V Y DS+AS+ H G+ G +EV 
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPG-FEVL 137

Query: 107 VLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENIL 166
           +LME C   SL+D++N RL  +L E+EIL IM  V +G++QMH LQ  LIHRDIKIEN+L
Sbjct: 138 LLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVL 197

Query: 167 ISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEK 226
           +  +  +K+CDFGS         S++E+  +  +I  +TT QYRSPEM+DL +   I+EK
Sbjct: 198 VDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEK 257

Query: 227 SDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
           SDIWALGVFL+KL +YTTPFE  G+ AIL S+++ P    YS  L N+I ++L+ +P  R
Sbjct: 258 SDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNLR 316

Query: 287 PNICQLIEELSRLQGIVPPMKNFY 310
           PNI Q++ ++    GI PP+K+ Y
Sbjct: 317 PNIYQVMHQVCITIGIEPPIKDKY 340

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  282 bits (721), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 203/313 (64%), Gaps = 20/313 (6%)

Query: 15  VTVGSHTAKIVKYLASGGYAQVY----SAYVTPVDYSPATN-----------IACLKRVV 59
           V VGSH  +IVKYL  GG+AQ+Y    + Y+   D     N           + CLKRV+
Sbjct: 35  VAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIGDLVCLKRVM 94

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
           V D+  L+ ++ EV+ +K LR K  VV Y DS+A+++ G  G +EVF+LMEYC   SL+D
Sbjct: 95  VYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLMEYCPNKSLLD 154

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           ++N RL  +L E EIL+IM  + +GV+Q+H L   LIHRDIKIEN+L+  N  +K+CDFG
Sbjct: 155 YMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHNNRFKLCDFG 214

Query: 180 SVCGVIRPP--RSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLF 237
           S    I PP   + +++  + HDI  +TT QYRSPEM+DL +   +NEK+DIWALGVFL+
Sbjct: 215 STN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKADIWALGVFLY 272

Query: 238 KLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELS 297
           KL +YTTPFE  G+ AIL S+++ P    YS+ L N+I V+L+ +P  RPNI Q++ E+ 
Sbjct: 273 KLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENPNLRPNIYQVLSEIC 331

Query: 298 RLQGIVPPMKNFY 310
            +  +  P+ + Y
Sbjct: 332 SILNVEVPIPDIY 344

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  275 bits (704), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 210/346 (60%), Gaps = 16/346 (4%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT-----NIACLKRVV 59
           YVP  +V VG H  +I+KYLA GG+A++Y A    Y+  +D +        ++ CLKRV+
Sbjct: 99  YVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLKRVL 158

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
           V D   LN +R EV  +K L     +V   DS+AS+ +     YEV +LME CS  SL+D
Sbjct: 159 VTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKSLLD 218

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           ++N RL  +L E EIL IM  V + VAQMH L   LIHRDIKIEN+L+     +K+CDFG
Sbjct: 219 YMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLCDFG 278

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKL 239
           S    +    ++ +M  +  ++  +TT QYRSPEM+D+ +   INEKSDIWALG+FL+KL
Sbjct: 279 STSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFLYKL 338

Query: 240 CYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
            +Y TPFE+ G+ AIL S++++P +  YS  L N+I ++L+ +P  RPNI Q++  + ++
Sbjct: 339 LFYITPFERTGQFAILHSKYEFPQHS-YSMKLINLIIIMLAENPNLRPNIYQVLAYICKI 397

Query: 300 QGIVPPMKNFY------LSRALETSSLMQPLQNNSYKVPISDIQDK 339
             I  P+ + Y        +     + +Q  QN  Y+V I  +Q++
Sbjct: 398 INIKTPIDDIYGLGPYDFQKYTNYQTALQNSQNQMYQVQIRSMQNR 443

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  278 bits (710), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 151/353 (42%), Positives = 217/353 (61%), Gaps = 21/353 (5%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDY--SPAT-------NIACL 55
           Y P  V+ VGSH  +I++Y+A GG+AQ+YS     Y    D   SP +       ++ACL
Sbjct: 18  YQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDLACL 77

Query: 56  KRVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGS------YEVFVLM 109
           KRV+V D+  LN LR EV+ +K L     +V Y DS+AS+    T S      +EV +LM
Sbjct: 78  KRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVLLLM 137

Query: 110 EYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISE 169
           E C   SL+D++N RL  +L EQEIL +M  V++ +AQMH L+  LIHRDIKIEN+L+ +
Sbjct: 138 ELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVLVDQ 197

Query: 170 NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDI 229
              +K+CDFGS         ++ ++ Y+  +I  +TT QYRSPEM+DL +   I+EKSDI
Sbjct: 198 KNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDI 257

Query: 230 WALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNI 289
           WALG+FL+KL ++TTPFE+ G+ AIL S+F++P    YS  L N+I V+LS +P  RPNI
Sbjct: 258 WALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLRPNI 316

Query: 290 CQLIEELSRLQGIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISDIQDKHKR 342
            Q++ ++ +L+ +  P+ + Y   A      M   QNN  KV +     K K+
Sbjct: 317 YQVLHQICQLKQVPIPIADKYGLGAYNFDYYML-FQNNLQKVQVDMFNIKRKQ 368

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  271 bits (694), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 196/309 (63%), Gaps = 9/309 (2%)

Query: 10  VPDTVVTVGSHTAKIVKYLASGGYAQVY--------SAYVTPVDYSPATNIACLKRVVVP 61
            P T++ VGSH  +IVKYLA GG+A +Y        +   TP       ++ACLKRV+V 
Sbjct: 33  APGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVT 92

Query: 62  DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFL 121
           D+  LN LR EV+ +K L+N   +V Y DS+AS+    +  YEV +LME C   SL+D++
Sbjct: 93  DENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYM 152

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
           N RL  +L E+E+L IM  V   VAQMH L   LIHRDIKIEN+L+     +K+CDFGS 
Sbjct: 153 NQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGST 212

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCY 241
                   +++++  + ++I  +TT QYR+PEM+DL +   I+EKSDIWALG+FL+KL +
Sbjct: 213 SSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 272

Query: 242 YTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQG 301
           YTTPFE  G+ AIL S++  PA   YS  L N+I ++L+ +P  RPNI Q+I ++  +  
Sbjct: 273 YTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMK 331

Query: 302 IVPPMKNFY 310
           +  P ++ Y
Sbjct: 332 VDVPFEDKY 340

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  275 bits (704), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 200/312 (64%), Gaps = 12/312 (3%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA-YV---------TPVDYSPATNIACLKRV 58
           Y P TVV VG+   +I+ ++A GG+AQ+YS  Y+         +     P  +IACLKRV
Sbjct: 22  YAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPG-DIACLKRV 80

Query: 59  VVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLI 118
           +VPD+  L+ +R EV+ +K LR  K ++ Y DS+AS+ +     YEV +LME C   SL+
Sbjct: 81  LVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPNNSLL 140

Query: 119 DFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDF 178
           D++N RL  RL E+EIL +M    + ++QMH L   LIHRDIKIEN+L+     +K+CDF
Sbjct: 141 DYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFKLCDF 200

Query: 179 GSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFK 238
           GS         +++++  +  +I  NTT QYRSPEM+DL +   INEKSDIWALG+FL+K
Sbjct: 201 GSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 260

Query: 239 LCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSR 298
           L ++ TPFE  G+ +IL S++++PA   YS  L N+I ++L+ +P+ RPNI Q++  +  
Sbjct: 261 LLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVMHHICS 319

Query: 299 LQGIVPPMKNFY 310
           + G   P+++ Y
Sbjct: 320 VIGCEVPIEDKY 331

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  273 bits (697), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 200/313 (63%), Gaps = 25/313 (7%)

Query: 14  VVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYS----------------PATNIACLKR 57
           VVTVGSH  ++V YLA GG+AQ+Y   V  V+Y+                P +  ACLKR
Sbjct: 101 VVTVGSHRVEVVSYLAEGGFAQIY--VVKFVEYTNEFERKNDESMNQPLKPGS-PACLKR 157

Query: 58  VVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGS----YEVFVLMEYCS 113
           V+V D+  LN +R+EV+ +K L+    +V Y DS+AS+   ++G+    +EV +LME C 
Sbjct: 158 VLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCP 217

Query: 114 GGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEY 173
             SL+D++N RL  +L EQEI  IM  + + VAQMH L   LIHRDIKIEN+L+  N  +
Sbjct: 218 NKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNF 277

Query: 174 KVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALG 233
           K+CDFGS         S++++  +  D+  +TT QYRSPEM+DL K   INEKSDIWALG
Sbjct: 278 KLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALG 337

Query: 234 VFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
           VFL+KL ++TTPFE+ G+ A+L S+F++P    YS  L N+I V+L+ +P  RPNI Q++
Sbjct: 338 VFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIYQVL 396

Query: 294 EELSRLQGI-VPP 305
             LS +    VPP
Sbjct: 397 YYLSEVTNREVPP 409

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  271 bits (693), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 134/306 (43%), Positives = 198/306 (64%), Gaps = 9/306 (2%)

Query: 13  TVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT----NIACLKRVVVPDKK 64
           +++ VG H  +I++YLA GG+A +Y      Y   +D   +     +IACLKRV V D+ 
Sbjct: 32  SILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDEN 91

Query: 65  SLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTR 124
            LN LR EV+ +K L+    VV Y DS+AS+H+  T  +EV +LME CS GSL+D++N R
Sbjct: 92  GLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQR 151

Query: 125 LKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGV 184
           L  +L E+E+L IM  +  G++ MH L+  LIHRDIKIEN+L+     +K+CDFGS    
Sbjct: 152 LATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTSTC 211

Query: 185 IRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTT 244
           +    +++E+  + ++I  +TT QYRSPEM+DL +   INEKSDIWALG+FL+KL +YTT
Sbjct: 212 LPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYTT 271

Query: 245 PFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVP 304
           PFE  G+ AIL S++  P    +S  L N+I V+L+ +P+ RPNI Q++  +  +     
Sbjct: 272 PFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECDV 330

Query: 305 PMKNFY 310
           P+++ Y
Sbjct: 331 PIEDHY 336

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  271 bits (693), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 136/305 (44%), Positives = 194/305 (63%), Gaps = 10/305 (3%)

Query: 15  VTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT-----NIACLKRVVVPDKKS 65
           V VG+H  +IVKYLA GG+A +Y      Y   ++  P       ++ACLKRV+V D+  
Sbjct: 77  VIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTDENG 136

Query: 66  LNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRL 125
           LN +R EV  +K L     +V Y DSHAS+    +  +EV +LME C   SL+D++N RL
Sbjct: 137 LNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRL 196

Query: 126 KNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVI 185
             +L EQEIL IM  V   +AQMH L   LIHRD+KIEN+L+  N  +K+CDFGS     
Sbjct: 197 ATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCF 256

Query: 186 RPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTP 245
               +++E+  + ++I  +TT QYRSPEM+DL +   INEKSDIWALG+FL+KL +YTTP
Sbjct: 257 PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 316

Query: 246 FEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
           FE  G+ AIL S++++P    YS  L N+I ++L+ +P  RPNI Q+++ L  +  +  P
Sbjct: 317 FELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKVKNP 375

Query: 306 MKNFY 310
           +++ Y
Sbjct: 376 LEDKY 380

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  273 bits (697), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 196/316 (62%), Gaps = 15/316 (4%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPATN----------IAC 54
           Y   T V VGSH  +++KY+A GG+AQ+Y+      +      P  N          IAC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSG 114
           LKRV+V D   LN +R EV+ ++ L+    VV Y DS+AS  S     YEV +LME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYK 174
            SL+D++N RL  RL E+EI+ IM    +G+AQ+H L+  LIHRDIKIEN+L+ +   +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 VCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGV 234
           +CDFGS         ++ ++     +I  NTT QYRSPEM+DL +   I+EKSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
           FL+KL ++TTPFE+ G+ AIL S++++P    YS  L N+I ++L+ +P  RPNI Q+++
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 295 ELSRLQGIVPPMKNFY 310
            L  + G   P+ + Y
Sbjct: 398 YLCSINGWKVPLNDKY 413

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  273 bits (697), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 142/347 (40%), Positives = 210/347 (60%), Gaps = 11/347 (3%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT-----NIACLKRVV 59
           Y P  +V VG+H  ++V YLA GG+AQ+Y      Y+   D + +      ++ACLKRV+
Sbjct: 22  YTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVL 81

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
           V D+  LN +R EV+ +K L+    +V Y DS+AS+       +EV +LME C   SL+D
Sbjct: 82  VQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLD 141

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           ++N RL  +L E EI+ IM  VA+ ++QMH L  SLIHRDIKIEN+L+     +K+ DFG
Sbjct: 142 YMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG 201

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKL 239
           S         +++++  +  +I  +TT QYRSPEM+DL +   INEKSDIWALGVFL+KL
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261

Query: 240 CYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
            ++TTPFE  G+ AIL S++++P    YS  L N+I ++L+ +P  RPNI Q++  L  +
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQVLYHLCEI 320

Query: 300 QGIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQIPN 346
             +  P+++ Y   A   S   Q  QN    V +   Q + K+ + N
Sbjct: 321 LNVEVPIEDKYAEGAYNFSKYTQ-FQNKLQNVQLQMYQLQQKKIMQN 366

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  272 bits (695), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 190/303 (62%), Gaps = 11/303 (3%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVY-SAYVTPVDYSPATN---------IACLKRV 58
           +   + V VG+   +IVKYL  GG+AQ+Y   ++   +   + N         +ACLKRV
Sbjct: 25  FANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRV 84

Query: 59  VVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLI 118
           +V D+  LN +R EV+ +K+L+    +V Y DS+AS+    T  +EV +LME C   SL+
Sbjct: 85  LVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLL 144

Query: 119 DFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDF 178
           DF+N RL  +L E+EIL IM  V + VAQMH L P LIHRDIKIEN+L+     +K+ DF
Sbjct: 145 DFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADF 204

Query: 179 GSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFK 238
           GS         +++++  +  DI  +TT QYRSPEM+DL K   I+EKSDIWALG+FL+K
Sbjct: 205 GSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYK 264

Query: 239 LCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSR 298
           L +Y TPFE  G+ AIL S++ +P    YS  L N+I ++LS +P  RPNI Q++ E+  
Sbjct: 265 LLFYITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIYQVLHEICS 323

Query: 299 LQG 301
           + G
Sbjct: 324 ISG 326

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  267 bits (683), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 196/313 (62%), Gaps = 11/313 (3%)

Query: 8   LYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYS----------PATNIACLKR 57
           L  P+T V VG+H  +I+++LA GG+A +Y      +              A +IACLKR
Sbjct: 28  LLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKR 87

Query: 58  VVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSL 117
           V+VPD+  LN LR EV+ +K LR    +V Y DS+AS+H   +  +E+ +LME C   SL
Sbjct: 88  VIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSL 147

Query: 118 IDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCD 177
           +D++N +L  +L E EIL IM  V+  +AQMH L   LIHRDIKIEN+L+ ++  +K+CD
Sbjct: 148 LDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCD 207

Query: 178 FGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLF 237
           FGS         +++++  + ++I  +TT QYRSPEM+DL +   INEKSDIWALG+FL+
Sbjct: 208 FGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 267

Query: 238 KLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELS 297
           KL +YTTPFE  G+ AIL S+++ P    YS  L N+I ++L+ +P  RPNI Q++  + 
Sbjct: 268 KLLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVC 326

Query: 298 RLQGIVPPMKNFY 310
            +     P  + Y
Sbjct: 327 SILKCDVPFTDKY 339

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  268 bits (685), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 195/305 (63%), Gaps = 10/305 (3%)

Query: 15  VTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPATNI-----ACLKRVVVPDKKS 65
           V VG+H  +IVKYLA GG+A +Y      Y   ++ +P+  +     ACLKRV+V D+  
Sbjct: 35  VIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTDENG 94

Query: 66  LNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRL 125
           LN +R EV  +K L     +V Y DSHAS+       +EV +LME C   SL+D++N RL
Sbjct: 95  LNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMNQRL 154

Query: 126 KNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVI 185
             +L EQEIL IM  V   +AQMH L   LIHRD+KIEN+L+  +  +K+CDFGS    +
Sbjct: 155 TTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTSTCL 214

Query: 186 RPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTP 245
               +++E+  + ++I  +TT QYRSPEM+DL +   I+EKSDIWALG+FL+KL +YTTP
Sbjct: 215 PVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTP 274

Query: 246 FEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
           FE  G+ AIL S++++P    YS  L N+I ++L+ +P  RPNI Q+++ L  +  +  P
Sbjct: 275 FELTGQFAILHSKYEFPINN-YSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKVENP 333

Query: 306 MKNFY 310
           +++ Y
Sbjct: 334 IEDKY 338

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  270 bits (689), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 135/309 (43%), Positives = 199/309 (64%), Gaps = 15/309 (4%)

Query: 14  VVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDY----------SPAT--NIACLKRVVVP 61
           +++VG+H  +IV YLA GG+AQ+Y   V  V+Y          S  T  +IACLKRV+V 
Sbjct: 25  MISVGAHRVEIVSYLAEGGFAQIY--VVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN 82

Query: 62  DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFL 121
           D+  LN +R EV+ +K L++   +V Y DS+AS+ +     +EV +LME C   SL+D++
Sbjct: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM 142

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
           N RLK +L E EIL IM  V++G++ MH L   LIHRDIKIEN+L+  N  +K+CD GS 
Sbjct: 143 NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGST 202

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCY 241
                P  S +++  +  +I  +TT QYR+PEM+DL +   INEKSDIWALG+FL+KL +
Sbjct: 203 SQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLF 262

Query: 242 YTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQG 301
           YTTPFE  G+ AIL S++ +P    YS  + N+I ++L+ +P  RPNI Q++  +  +  
Sbjct: 263 YTTPFEITGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMN 321

Query: 302 IVPPMKNFY 310
           +  P+++ Y
Sbjct: 322 LPVPIEDRY 330

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  270 bits (689), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 138/336 (41%), Positives = 211/336 (62%), Gaps = 15/336 (4%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT-----NIACLKRVV 59
           ++P  VV VG+H  ++V YLA GG+AQ+Y      Y+   +          ++ACLKRV+
Sbjct: 22  FLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVACLKRVL 81

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASK-HSGHTGSYEVFVLMEYCSGGSLI 118
           V D+  L+ +R EV+ +K L   + +V Y DS+A + H+G+ G +EV +LME C   SL+
Sbjct: 82  VQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAG-FEVLLLMELCPNKSLL 140

Query: 119 DFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDF 178
           D++N RL  +L E+EIL IM  V++ V+QMH L+  LIHRDIKIEN+L+     +K+CDF
Sbjct: 141 DYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFKLCDF 200

Query: 179 GSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFK 238
           GS         +++E+  +  +I  +TT QYR PEM+DL +   INEKSDIWALG+FL+K
Sbjct: 201 GSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGIFLYK 260

Query: 239 LCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSR 298
           L ++ TPFE  G+ AIL S++++P    YS  L N+I ++L+ +PF RPNI Q++  +  
Sbjct: 261 LLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLNHICT 319

Query: 299 LQGIVPPMKNFYLSRAL---ETSSLMQPLQNNSYKV 331
           + G+  P+++ Y   A    + +     LQN  Y++
Sbjct: 320 MIGVEVPIEDKYGCGAYNFDKYAEFQTKLQNAQYQM 355

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  270 bits (690), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 209/347 (60%), Gaps = 11/347 (3%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT-----NIACLKRVV 59
           + P  +V VG+H  +++ YLA GG+AQ+Y      Y+   D + +      ++ACLKRV+
Sbjct: 22  FTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGDVACLKRVL 81

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
           V D+  LN +R EV+ +K L+    VV Y DS+AS+       +EV +LME C   SL+D
Sbjct: 82  VQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMELCPNKSLLD 141

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           ++N RL  +L E EI+ IM  V + ++QMH L   LIHRDIKIEN+L+  N  +K+ DFG
Sbjct: 142 YMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANNNFKLADFG 201

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKL 239
           S         +++++  +  +I  +TT QYRSPEM+DL +   INEKSDIWALG+FL+KL
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 240 CYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
            ++TTPFE  G+ AIL S++++P    YS  L N+I ++L+ +P  RPNI Q++  L  +
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQVLYHLCEI 320

Query: 300 QGIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQIPN 346
             I  P+++ Y   A   S   Q  QN    V +   Q + K+ + N
Sbjct: 321 LNIEVPIEDKYTEGAYNFSKYTQ-FQNKLQNVQLQMYQLQQKKIMQN 366

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  268 bits (684), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 198/313 (63%), Gaps = 13/313 (4%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATN----------IACLKRV 58
           Y P T V VG+H  +I+KY+A GG+AQ+Y+            N          +ACLKRV
Sbjct: 22  YTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV 81

Query: 59  VVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASK-HSGHTGSYEVFVLMEYCSGGSL 117
           +V D+  LN +R EV+ +K L+    +V Y DS+AS+ H+G  G +EV +LME C   SL
Sbjct: 82  LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPG-FEVLLLMELCPNKSL 140

Query: 118 IDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCD 177
           +D++N RL  +L E+EIL IM  V   V+QMH L   L+HRDIKIEN+L+     +K+CD
Sbjct: 141 LDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCD 200

Query: 178 FGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLF 237
           FGS         +++++  +  +I  +TT QYRSPEM+DL +   I+EKSDIWALG+FL+
Sbjct: 201 FGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLY 260

Query: 238 KLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELS 297
           KL ++TTPFE  G+ AIL S++++P    YS  L N+I ++L+ +P  RPNI Q++  + 
Sbjct: 261 KLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVLHNIC 319

Query: 298 RLQGIVPPMKNFY 310
            + G+  P+++ Y
Sbjct: 320 SISGMKVPIEDQY 332

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  267 bits (682), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 196/311 (63%), Gaps = 10/311 (3%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT-----NIACLKRVV 59
           Y P  +V VG+H  +IV YLA GG+AQ+Y      Y+   D + +      ++ACLKRV+
Sbjct: 22  YTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGDLACLKRVL 81

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
           V D+  LN +R EV+ +K L+    VV Y DS+AS+       +EV +LME C   SL+D
Sbjct: 82  VHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMELCPNKSLLD 141

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           ++N RL  +L E EI+ IM  VA+ ++QMH L   LIHRDIKIEN+L+     +K+ DFG
Sbjct: 142 YMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKDSFKLADFG 201

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKL 239
           S         +++++  +  +I  +TT QYRSPEM+DL +   INEKSDIWALG+FL+KL
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 240 CYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
            ++TTPFE  G+ AIL S++++P    YS  L N+I ++L+ +P  RPNI Q++  L  +
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQVLCHLCDI 320

Query: 300 QGIVPPMKNFY 310
             +  P+++ Y
Sbjct: 321 LNVEVPIEDKY 331

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  265 bits (676), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 210/347 (60%), Gaps = 11/347 (3%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPA-----TNIACLKRVV 59
           Y P  +V VG+H  +IV YLA GG+AQ+Y+     Y+   D + +      ++ACLKRV+
Sbjct: 22  YTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGDVACLKRVL 81

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
           V D+  LN +R EV+ +K L+    VV Y DS+AS+       +EV +LME C   SL+D
Sbjct: 82  VHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMELCPNKSLLD 141

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           ++N RL  +L E EI+ IM  VA+ +++MH L   LIHRDIKIEN+L+     +K+ DFG
Sbjct: 142 YMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAENNFKLADFG 201

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKL 239
           S         +++++  +  +I  +TT QYRSPEM+DL +   INEKSDIWALG+FL+KL
Sbjct: 202 STSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 240 CYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
            ++TTPFE  G+ AIL S++++P    YS  L N+I ++L+ +P  RPNI Q++  +  +
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQVLYHICDI 320

Query: 300 QGIVPPMKNFYLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQIPN 346
                P+++ Y   A + +   +  QN    V I   Q + K+ + N
Sbjct: 321 LNAEVPIEDKYSEGAYDFAKYTK-FQNKLQNVQIQMYQLQQKKIMQN 366

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  262 bits (670), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 137/314 (43%), Positives = 198/314 (63%), Gaps = 20/314 (6%)

Query: 15  VTVGSHTAKIVKYLASGGYAQVYSAYVTPV----------------DYS-PATNIACLKR 57
           + VG+H  +IV YL  GG+AQ+Y      V                +YS    ++ACLKR
Sbjct: 37  LAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLKLGDVACLKR 96

Query: 58  VVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASK-HSGHTGSYEVFVLMEYCSGGS 116
           V+V D+  LN +R EV+ +K LR    +V Y DS+A++ H+G+ G YEV +LME CS  S
Sbjct: 97  VLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPG-YEVLLLMELCSNNS 155

Query: 117 LIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVC 176
           L++++N RL  +L E+E+L IM  V  GVAQMH L+  LIHRDIKIEN+L+  N  +K+C
Sbjct: 156 LLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVDSNNNFKLC 215

Query: 177 DFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFL 236
           DFGS         +++++  +  ++  +TT QYRSPEM+DL +   INEKSDIWALGVFL
Sbjct: 216 DFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSDIWALGVFL 275

Query: 237 FKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296
           +KL +YTTPFE  G+ A+L S+F  PA   YS  + N++ ++LS +   RPNI Q++  +
Sbjct: 276 YKLLFYTTPFETTGQFAMLHSKFDIPANK-YSSKIINLVIIMLSENLNLRPNIYQVMHYI 334

Query: 297 SRLQGIVPPMKNFY 310
            +L  +  P+ + Y
Sbjct: 335 CQLIQVDTPILDIY 348

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  263 bits (671), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 201/323 (62%), Gaps = 27/323 (8%)

Query: 13  TVVTVGSHTAKIVKYLASGGYAQVYSA-YVTPVDYSPATN-------------------- 51
           T V VGSH  +I+KY+A GG+AQ+Y+  YV  ++    +N                    
Sbjct: 28  TQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNPMILK 87

Query: 52  ---IACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASK-HSGHTGSYEVFV 107
              IACLKRV+V D+  LN +R EV+ +K L+    VV Y DS+AS+ H+G +G +EV +
Sbjct: 88  LGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASG-FEVLL 146

Query: 108 LMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILI 167
           LME C   SL+D++N RL  +L E EIL IM  +   V+ MH L+  L+HRDIKIEN+L+
Sbjct: 147 LMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIENVLV 206

Query: 168 SENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKS 227
                +K+CDFGS    +    +++++  +  +I  +TT QYRSPEM+DL +   I+EKS
Sbjct: 207 DAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS 266

Query: 228 DIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRP 287
           DIWALG+FL+KL ++ TPFE  G+ AIL S++++P    YS  L N+I ++L+ +P  RP
Sbjct: 267 DIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRP 325

Query: 288 NICQLIEELSRLQGIVPPMKNFY 310
           NI Q+++ +  +  +  P+++ Y
Sbjct: 326 NIYQVLDNICSMMNVEVPIEDIY 348

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  259 bits (663), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 188/296 (63%), Gaps = 11/296 (3%)

Query: 13  TVVTVGSHTAKIVKYLASGGYAQVYS----AYVTPVD-----YSPATNIACLKRVVVPDK 63
           + V VG H  ++++YLA GG+A +Y      Y   +D       P   + CLKRV V D+
Sbjct: 33  STVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTV-CLKRVRVSDE 91

Query: 64  KSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNT 123
             LN LR EV+ +K LRN   +V Y DS+AS+       YEV +LME C  GSL+D++N 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 RLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCG 183
           RL  +L E E+L IM  + VG++ MH  +  LIHRDIKIEN+L+  +  +K+CDFGS   
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 VIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYT 243
            +    S++E+  + ++I  +TT QYRSPEM+DL +   INEKSDIWALG+FL+KL +YT
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271

Query: 244 TPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299
           TPFE  G+ AIL S+++ P    +S  L N++ ++L+ +P+ RPN+ Q++  +  +
Sbjct: 272 TPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHICSM 326

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  259 bits (663), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 190/315 (60%), Gaps = 31/315 (9%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSA----YVTPVDYSPAT-----------NIA 53
           Y   T++TVG    +I+KYL  GG+AQ+Y+     Y+   D   A            ++A
Sbjct: 40  YKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIGDVA 99

Query: 54  CLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTG------------ 101
           CLKRV+VPD+  L+ +R EVD +K L N   +V Y DS+ASK   ++             
Sbjct: 100 CLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDNNKN 159

Query: 102 ---SYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHR 158
               +E+ +LMEYC   SL+DF+N RL  +L E EIL  MT +   V QMH L   LIHR
Sbjct: 160 TDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPLIHR 219

Query: 159 DIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT 218
           DIKIEN+L+  N  +K+ DFGS   +  P  +++++  +  DI  NTT QYRSPEM+DL 
Sbjct: 220 DIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMIDLY 279

Query: 219 KGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVL 278
           K   I+EKSDIWALGV L+KL +YTTPFE  G+ AIL S++++PA   YS    N+I ++
Sbjct: 280 KCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPANN-YSSKFINLIIIM 338

Query: 279 LSVDPFKRPNICQLI 293
           L+ +P  RPNI Q++
Sbjct: 339 LAENPNLRPNIFQVL 353

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  258 bits (660), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 192/315 (60%), Gaps = 16/315 (5%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYS-------------PATNIACL 55
           Y P  +++VG+H  KI  YLA GG+AQ+Y   V  +DY               + +IACL
Sbjct: 35  YKPGKLISVGAHQVKIEDYLAEGGFAQIYK--VKFIDYLNEFENKKDQLNSLKSGDIACL 92

Query: 56  KRVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGG 115
           KRV+V D+  LN +R EV+ +K+L+    +V Y DS+A + +     YE+ +LME C   
Sbjct: 93  KRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPNN 152

Query: 116 SLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKV 175
           SL+D++N RLK +L E EI+ IM    + V+QMH L   LIH+DIK+ENIL+  N  +K+
Sbjct: 153 SLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFKL 212

Query: 176 CDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVF 235
           CDFGS         S+ ++  +  +I  +TT QYRSPEM+DL +   INE SDIWALGVF
Sbjct: 213 CDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGVF 272

Query: 236 LFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEE 295
           L+KL ++ TPFE+ G+ +IL ++F  P    Y   L N+I ++LS +   RPNI Q++ E
Sbjct: 273 LYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMYE 331

Query: 296 LSRLQGIVPPMKNFY 310
           +  +     P+++ Y
Sbjct: 332 ICSITNTPLPIEDKY 346

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score =  112 bits (279), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 98/353 (27%), Positives = 156/353 (44%), Gaps = 73/353 (20%)

Query: 13  TVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVP--DKKSLNALR 70
           +V+  G H A I + L  GG++ VY      V      ++  LK++  P  + +S++   
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVY-----LVQSRENNDLFALKKIHCPFGNIESVSEAM 73

Query: 71  AEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKN--R 128
            EV++ K  R+  Y+   + S   +     GS  VF+L+ Y   GSL+D +NT L +   
Sbjct: 74  REVNSYKKFRSP-YITHCVSSQVLQE--QDGSKTVFILLPYFPTGSLLDKINTHLLDGTT 130

Query: 129 LREQEILHIMTQVAVGVAQMH-------------ELQPSLIHRD---------------- 159
           + E+EI+ I+  VA G+  MH              +   L +RD                
Sbjct: 131 ISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDS 190

Query: 160 ------------------------IKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMK 195
                                   IK  NI+ S +G   +CD GS         S  ++ 
Sbjct: 191 LELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLV 250

Query: 196 YIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE---- 251
             Q    ++ T  +RSPE+L++T   +I+EK DIW+LG  L+ +C+  +PFE+E +    
Sbjct: 251 EFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGA 310

Query: 252 ---KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQG 301
               AI   +F  P    YS  L  +I+  + VD  KRP+I +L+  L  LQG
Sbjct: 311 SMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score =  107 bits (266), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 89/353 (25%), Positives = 151/353 (42%), Gaps = 65/353 (18%)

Query: 10  VPDTVVTVGSHTAKIVKYLASGGYAQVY-------SAYVTPVDYSPATNIACLKRVVVP- 61
           + D+ V++      I + L  G  + VY             +    A  +  LKR+  P 
Sbjct: 21  ISDSYVSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPF 80

Query: 62  -DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120
            + +S++A   EVD  K  ++  Y+++ +DS   +     GS  + +L+ Y   GSL D 
Sbjct: 81  GNIESISAAMKEVDNYKRFQSP-YIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDM 137

Query: 121 LNTRL--KNRLREQEILHIMTQVAVGVAQMHELQP------------------------- 153
           +N  L     + E E + IM  +A G+  +H+                            
Sbjct: 138 VNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLL 197

Query: 154 -------------------SLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEM 194
                              S +HRDI++ NIL S  G   V D GS C       +  ++
Sbjct: 198 DDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQL 257

Query: 195 KYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE--- 251
             +Q  +  N +  Y +PE+L++     I+ K+DIW++G   + + +  +PFE+E +   
Sbjct: 258 NELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSG 317

Query: 252 ----KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
                AI   ++ +P    YS+SL  VI+  L VDP  RP+I +L++ L  LQ
Sbjct: 318 ASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/338 (26%), Positives = 144/338 (42%), Gaps = 61/338 (18%)

Query: 13  TVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAE 72
           + V++     +I K L  GG + VY      +  S    +  LK+   P      ++ + 
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVY------LVESKEGELFALKKTRCP----FGSIGSI 66

Query: 73  VDALKVLRNKK-----YVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKN 127
             A+K + N +     Y+   +DS   +     GS  V+VL+ Y + GSL D +N  L +
Sbjct: 67  SPAMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLD 124

Query: 128 --RLREQEILHIMTQVAVGVAQMHELQP-------------------------------- 153
             ++ E +IL +   +A G+  +HE  P                                
Sbjct: 125 CTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGE 184

Query: 154 ---SLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYR 210
              S  HRD+K  NI+IS      + D GS         S + +   Q     N T  Y 
Sbjct: 185 SQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYA 244

Query: 211 SPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE-------KAILKSQFQYPA 263
           +PE+LD+     I EK DIW+ G  ++ +C+  +PFE+E +        AI   ++  P 
Sbjct: 245 APEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPR 304

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQG 301
              YS SL  +I   LSV+P +RP++ +LI  L  LQG
Sbjct: 305 GTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 148/332 (44%), Gaps = 55/332 (16%)

Query: 15  VTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVP--DKKSLNALRAE 72
           V+V  H   I + L  GG++ VY      +  S    +  LK++  P     S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVY------LVESRENGLMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKN--RLR 130
           VD  +  ++  Y+   IDS   +     GS  V++L+ Y S GSL D +N  L +  ++ 
Sbjct: 73  VDNYQKFKSP-YIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EQEILHIMTQVAVGVAQMHELQP-------------------SLI--------------- 156
           E E++ +   VA G+  +H+  P                   SL+               
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 157 -HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEML 215
            H DIK  NI+IS  G   + D GS         S + +   Q    ++ T  + +PE+L
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE-------KAILKSQFQYPAYPVYS 268
           D+     I EK D+W+ G  ++ +C+  +PFE+E +        ++   ++  P+   YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 DSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
             L +V++  L+VDP  RP++ +LI  L  LQ
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 93/340 (27%), Positives = 156/340 (45%), Gaps = 46/340 (13%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K ++++  VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVA---KLSIKSEKTRKKLLSEIQIHKSMKHQN-VV 142

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL+D L  R    L E E+    TQ+   + 
Sbjct: 143 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI    N   K+ DFG +  V+   R   E KY         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDR---ERKYTV-----CGT 242

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L + K    + + DIW++GV L+ L     PF+ +    I +      F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLMQ 322
                S+  K +I+ LLS+DP +RP+I ++++ +   +GI PP    Y+   + T     
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVW-FRGIFPP----YIESTVMT----- 351

Query: 323 PLQNNSYKVPISDIQDKHKRQIPNIQSSPEKLPSIQSTSN 362
                  +VP  D    H+  I N +   EK   I+ + N
Sbjct: 352 -------EVPNYDKTLTHQESIINFRKCLEKSGLIEDSMN 384

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 99.8 bits (247), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 86/347 (24%), Positives = 149/347 (42%), Gaps = 61/347 (17%)

Query: 12  DTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIAC-----LKRVVVPDKKSL 66
           DT + V     KI + L  GG + VY   +          +A      LK+++ P+ +S+
Sbjct: 20  DTTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESI 79

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRL- 125
           +    E++  K  ++  YV+  IDS   +     GS  +++++ + + GSL D +N RL 
Sbjct: 80  SNGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLL 136

Query: 126 -KNRLREQEILHIMTQVAVGVAQMHE---------------------------------L 151
               + E E + IM  V  G+  +H+                                 L
Sbjct: 137 EGTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPL 196

Query: 152 QPSLI-----------HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHD 200
           +  ++           HRDI   NIL S +G   + D GS         +  +++ +Q  
Sbjct: 197 EMDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEW 256

Query: 201 IMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE-------KA 253
           +  N T  Y +PE+L L     ++ K DIW+LG   + L +  +PFE+E +        A
Sbjct: 257 VNDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYA 316

Query: 254 ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300
           I   ++ +P    +S+ L +VI+  + VDP +RP   QL+  L  L+
Sbjct: 317 INTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLE 363

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 87/341 (25%), Positives = 145/341 (42%), Gaps = 75/341 (21%)

Query: 12  DTVVTVGSHTAKIVKYLASGGYAQVY------------SAYVTPVDYSPATNIACLKRVV 59
           DT + V     KI + L  GG + VY            +  +TP  Y+       LK+++
Sbjct: 20  DTTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYA-------LKKII 72

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
            P  +S++    E++  K  ++  YV+  IDS  ++     GS  +++++ Y S GSL D
Sbjct: 73  CPSVESISNGMREIENYKRFQSP-YVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQD 129

Query: 120 FLNTRL--KNRLREQEILHIMTQVAVGVAQMHE-------LQP----------------- 153
            +N RL     + E E + IM  V  G+  +H+       + P                 
Sbjct: 130 SINRRLLEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAM 189

Query: 154 --------------------SLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEE 193
                               +  HRDI   NIL S  G   + D GS         S  +
Sbjct: 190 LLEDTPLEMDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQ 249

Query: 194 MKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE-- 251
           +  +Q  +  N T  Y +PE+L+L     ++ K DIW++G   + L +  +PFE+E +  
Sbjct: 250 LSELQEWVNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIH 309

Query: 252 -----KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRP 287
                 AI   ++ +P    +S++L NVI+  + VDP +RP
Sbjct: 310 GASITYAINTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 141/300 (47%), Gaps = 36/300 (12%)

Query: 1   MNQDQLPLY-VPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVV 59
           +  D+ PL+  PDT V   S    I + +  G +  VY A         A  I  L+   
Sbjct: 14  IGSDKEPLHHPPDTAVEKPSQLYDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEET- 72

Query: 60  VPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLID 119
              +  ++ L  E+  L  LR   +V +Y  ++    S       ++++ME+C GGS  D
Sbjct: 73  ---QDDIDVLAQEIYFLSELR-APFVTTYYKTYVEDVS-------MWIVMEFCGGGSCAD 121

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
            L    ++RL E ++ +I+ +V  G+  +H  +   IHRD+K  NIL+++ GE K+ DFG
Sbjct: 122 LLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG 179

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNT---TAQYRSPEMLDLTKGYQINEKSDIWALGVFL 236
            V G             I   + +NT   T  + +PE++    GY  +EK+DIW+LG+  
Sbjct: 180 -VSG------------QIMATLKRNTFVGTPYWMAPEIIARDNGY--DEKADIWSLGITA 224

Query: 237 FKLCYYTTPFEK-EGEKAILKSQFQYPA--YPVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
            +L     P+ K +  K ++    + P      ++ S ++ I + L+ DP  RP    L+
Sbjct: 225 MELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 138/283 (48%), Gaps = 30/283 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +R+   +V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVA---KLSIKTEKTRKKLLSEIQIHKSMRHAN-IV 161

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID    + +       V++L+E C  GSL++ L  R    L E E+    TQ+  G+ 
Sbjct: 162 QFIDCFEDETN-------VYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   +N   K+ DFG +  V+   R   E KY         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVLANDR---ERKYTV-----CGT 261

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L + K    + + DIW++GV ++ L     PF+ +    I +      F +P
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
                S   + +++ LLS+DP +RP+I ++++ +   +GI PP
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYVW-FRGIFPP 362

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 96.7 bits (239), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 146/334 (43%), Gaps = 61/334 (18%)

Query: 12  DTVVTVGSHTAKIVKYLASGGYAQVYSAYVT----PVDYSPAT-NIACLKRVVVPDKKSL 66
           DT + V     KI + L  GG + VY   +      ++ S AT  +  LK+++ P  +++
Sbjct: 20  DTTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENI 79

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRL- 125
           +    E++  K  ++  YV+  IDS   +     GS  +++++ Y S GSL D +N RL 
Sbjct: 80  SNGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLL 136

Query: 126 -KNRLREQEILHIMTQVAVGVAQMHE---------------------------------L 151
               + E E + IM  V  G+  +H+                                 L
Sbjct: 137 EGTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPL 196

Query: 152 QPSLI-----------HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHD 200
           +  ++           HRDI   NIL S +G   + D GS         +  ++  +Q  
Sbjct: 197 EMDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEW 256

Query: 201 IMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE-------KA 253
           +  N T  Y +PE+L+L     ++ K DIW++G   + L +  +PFE+E +        A
Sbjct: 257 VNDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYA 316

Query: 254 ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRP 287
           I   ++ +P    +S+ L +VI+  + VDP +RP
Sbjct: 317 INTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 99.4 bits (246), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 136/282 (48%), Gaps = 30/282 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +R+   VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-VV 151

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL++ L  R    + E E+ + MTQ+   + 
Sbjct: 152 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   +N   K+ DFG +  V+   R   E KY         T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVLANDR---ERKYTV-----CGT 251

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L + K    + + DIW++GV ++ L     PF+ +    I +      F +P
Sbjct: 252 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAFP 310

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVP 304
                S+  K +I  +LS DP +RP+I ++I+ +   +GI P
Sbjct: 311 KDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV-WFRGIFP 351

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 99.4 bits (246), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 136/283 (48%), Gaps = 30/283 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K ++N   +V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSMKNVN-IV 143

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL+D L  R    L E E+    TQ+   + 
Sbjct: 144 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   ++   K+ DFG +  V+   R   E KY         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVLANDR---ERKYTV-----CGT 243

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L + K    + + DIW++GV L+ L     PF+ +    I +      F +P
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
                S   K +I+ LLS+DP +RP++ ++I+ +   +G+ PP
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV-WFRGLFPP 344

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 96.3 bits (238), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 144/334 (43%), Gaps = 61/334 (18%)

Query: 12  DTVVTVGSHTAKIVKYLASGGYAQVYSAYVTP----VDYSPAT-NIACLKRVVVPDKKSL 66
           D  + V     +I + L  GG + VY   ++     +D   AT  +  LK+++ P  +S+
Sbjct: 20  DATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESI 79

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRL- 125
           +    E++  K  ++  YV+  IDS   +     GS  +++++ Y S GSL D +N RL 
Sbjct: 80  SNGMREIENYKRFQSP-YVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLL 136

Query: 126 -KNRLREQEILHIMTQVAVGVAQMHE---------------------------------L 151
               + E E + IM  V  G+  +H+                                 L
Sbjct: 137 EGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPL 196

Query: 152 QPSLI-----------HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHD 200
           +  ++           HRDI   NIL S +G   + D GS         +  ++  +Q  
Sbjct: 197 EMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEW 256

Query: 201 IMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE-------KA 253
           +  N T  Y  PE+L+L     ++ K DIW+LG   + L +  +PFE+E +        A
Sbjct: 257 VNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYA 316

Query: 254 ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRP 287
           I   ++ +P    +S+ L +VI+  + VDP +RP
Sbjct: 317 INTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 95/358 (26%), Positives = 159/358 (44%), Gaps = 58/358 (16%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +       +   A  +A   +  +  +K+   L +E+   K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            ++D      +       V++L+E C  GSL++ L  R    L E E+    TQ+   + 
Sbjct: 143 QFVDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI    N   K+ DFG +  V+    +  E KY         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLA---NESERKYTI-----CGT 242

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS----QFQYP 262
             Y +PE+L + K    + + DIW+LGV L+ L     PF+      I +      F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP---------MKNF---- 309
                SD  K +IR +LS+DP +RP++ ++++ +   +G  PP           NF    
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW-FRGTFPPSIPSTVMSEASNFDNIP 360

Query: 310 ------YLSRALETSSLMQPLQNNSYKVPISDIQDKHKRQ-IPNIQSSPEKLPSIQST 360
                      +E S L++P+         SD   + KR  I +I+SS +KL   Q T
Sbjct: 361 EEQSLINFKDCMEKSLLLEPMS--------SDKSQRQKRDYISSIKSSIDKLEEYQQT 410

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 133/283 (46%), Gaps = 30/283 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +       D   A  +A   +  +  +K+   L +E+   K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL++ L  R    L E E+    TQ+   + 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI    N   K+ DFG +  V+    +  E KY         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLA---NESERKYTI-----CGT 242

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS----QFQYP 262
             Y +PE+L + K    + + DIW+LGV L+ L     PF+      I +      F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
                SD  K +IR +LS+DP +RP++ ++++ +   +G  PP
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW-FRGTFPP 343

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 133/285 (46%), Gaps = 33/285 (11%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+ N L +E+   K +R++  +V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRHQN-IV 158

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID              V++L+E C  GSL+D L  R    L E E+    TQ+   + 
Sbjct: 159 HFIDCFED-------DINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH    ++IHRD+K+ NI   ++   K+ DFG +  +I    +  E KY         T
Sbjct: 210 HMHS--RNIIHRDLKLGNIFFDKDFNLKIGDFG-LAAII---NNENERKYTIC-----GT 258

Query: 207 AQYRSPEMLDLTKGYQINE--KSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQ 260
             Y +PE+  +  G QI    + DIW+LGV +F +     PF+ +    I        + 
Sbjct: 259 PNYIAPEV--IMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYS 316

Query: 261 YPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
           +P     S  +K +I+ +LS++P +RP I Q I   +  +G  PP
Sbjct: 317 FPTDKYVSKDVKKLIQDILSMNPMERPTI-QEILNYNWFKGNFPP 360

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 136/283 (48%), Gaps = 30/283 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +++   +V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKHPN-IV 152

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            ++D      +       V++L+E CS GSL+D +  R    L E E+    TQ+   V 
Sbjct: 153 HFVDCFEDDTN-------VYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   ++   KV DFG +  V+   R   E KY         T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLANNR---ERKYTV-----CGT 252

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQYP 262
             Y +PE+L + K    + + DIW++GV ++ L     PF+ +    I       Q+ YP
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYP 311

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
                S   K +I  +L VDP +RP+I ++I+++   +GI PP
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDV-WFRGIFPP 353

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 123/259 (47%), Gaps = 40/259 (15%)

Query: 52   IACLKRVVVPDKKSLN--------ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S N        ALR+EV  LK L +   +V Y+        G     
Sbjct: 1206 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLN-IVQYL--------GFENKN 1256

Query: 104  EVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
             ++ L +EY +GGS+   +  R+  R  E  I H+ TQV  G+A +H     ++HRD+K 
Sbjct: 1257 SIYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLH--SKGILHRDMKA 1312

Query: 163  ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            +N+L+ ++G  K+ DF    G+ R  +      Y   D+    T  + +PEM+D  +GY 
Sbjct: 1313 DNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQGY- 1363

Query: 223  INEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSLKNVIRV---- 277
             + K DIW+LG  + ++     P+   E   A+ K      A P+  D+L  + RV    
Sbjct: 1364 -SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLITRVGRSF 1422

Query: 278  ---LLSVDPFKRPNICQLI 293
                  +DP KRP   +L+
Sbjct: 1423 LDACFEIDPEKRPTATKLL 1441

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 123/277 (44%), Gaps = 40/277 (14%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           L  G Y+ VY A              C K+ ++ +KK +  +  E D L +L        
Sbjct: 16  LGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKK-VKYVTIEKDLLNML-------- 66

Query: 88  YIDSHASKHSGHTGSYEVFV----------LMEYCSGGSLIDFLNTRLKNRLREQEILHI 137
                     GH G  ++F           ++EY SGG L+  +  RL  RL E    HI
Sbjct: 67  -------AKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHI 117

Query: 138 MTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYI 197
             Q+   V  MH     +IHRD+K EN+L+S+ G   + DFG+ C      R +E  K  
Sbjct: 118 TAQLVDTVDYMHS--KGVIHRDLKPENVLLSQEGRVVITDFGAACTAAD--RKFENTKRT 173

Query: 198 QHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS 257
              +    TA+Y SPE+L  +   Q    SDIWALG  +++L     PF  E E    + 
Sbjct: 174 ASFV---GTAEYVSPELLLHS---QCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEK 227

Query: 258 QFQYPAYPVYSDS--LKNVIRVLLSVDPFKRPNICQL 292
                   ++S+S  + ++++ +L  DP KRP+  QL
Sbjct: 228 IVALDYKWLFSNSPQVVSIVQSILVTDPLKRPSAAQL 264

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 140/296 (47%), Gaps = 39/296 (13%)

Query: 19  SHTAKIVKYLASGGYAQVYS------AYVTPVDYSPATNIACLKRVVVPDKKSLNALRA- 71
           SHT   V YLA G Y Q+        + V  V +  +     LK++ + D K     R+ 
Sbjct: 37  SHTTIHVPYLA-GPYKQLNKIGKGSHSIVYKVTHPTSDATLALKKLPINDYKLKTNRRST 95

Query: 72  ---EVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNR 128
              E++  K++   K ++S ID      +       +++++E C  GSL D +  R K  
Sbjct: 96  ILKEIEIHKLVNGHKNIISMIDHFEIDAT-------MYMVLELCGAGSLYDII-CRSKRS 147

Query: 129 LREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPP 188
           LRE E   +M Q+   V  +HE   +++H D+K+ NILI  +   ++CDFG         
Sbjct: 148 LREWEAKRLMIQLCGAVDWIHE--KNIVHADLKLSNILIDSSNNLQLCDFG--------- 196

Query: 189 RSYEEMKYIQHDIMKNTTAQYRSPE-----MLDLTKGYQINEKSDIWALGVFLFKLCYYT 243
            S+       + I K  T  Y SPE     +L   K     ++SDIW++G+ L+ + +  
Sbjct: 197 HSFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLYAMIFDK 256

Query: 244 TPFEKEGEKA----ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEE 295
           TPFE    ++    I++ ++ +      S+ +K +I+ +L + P +R  I +++ +
Sbjct: 257 TPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVSD 312

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 134/298 (44%), Gaps = 74/298 (24%)

Query: 17  VGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV--PDKKSLNALRAEVD 74
           VG++  KI+K +  G + +VY A   P            K+VV+   DK   N +R    
Sbjct: 36  VGNY--KILKQIGEGSFGKVYLALHKPTH----------KKVVLKSSDKTDPNVVR---- 79

Query: 75  ALKVLRNKKYVVSYIDSHASKHSGHTGSYEV-------FVLMEYCSGGSLIDFLNTRLKN 127
             ++  ++++   YI          T  YEV       ++++EYC    L D+L +  K 
Sbjct: 80  --EIFYHRQFDFPYI----------TKLYEVIITETKVWMVIEYCPNKELYDYLLS--KK 125

Query: 128 RLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRP 187
           R+   E   I  Q+   V   H L  S +HRD+K+ENIL+ ++   K+ DFG        
Sbjct: 126 RISLDESARIFAQIVGAVYYAHSL--SCVHRDLKLENILLDKDNNAKLTDFG-------- 175

Query: 188 PRSYEEMKYIQHDIMKNT-------TAQYRSPEMLDLTK--GYQINEKSDIWALGVFLFK 238
                       D  KNT       T  Y +PE+L   K  GY+I    DIWALG+ L+ 
Sbjct: 176 ---------FTRDFSKNTQLETICGTTVYMAPELLRREKYDGYKI----DIWALGILLYT 222

Query: 239 LCYYTTPF-EKEGEKAILKSQFQYPAYP--VYSDSLKNVIRVLLSVDPFKRPNICQLI 293
           +   T PF E + +K  LK     P Y    ++D   +++  LLS DP  RP I Q++
Sbjct: 223 IINGTMPFDEDDPKKTELKIISASPDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 85/297 (28%), Positives = 139/297 (46%), Gaps = 56/297 (18%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA 68
           +  D +  VG++  KI+K +  G + +VY A      + P     CLK     DK   N 
Sbjct: 30  FTSDELTEVGNY--KILKQVGEGSFGKVYLAL-----HRPTHRKVCLK---TSDKNDPNI 79

Query: 69  LRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFV-------LMEYCSGGSLIDFL 121
           +R      +V  ++++   YI          T  YEV V        +EYC G  L D L
Sbjct: 80  VR------EVFYHRQFDFPYI----------TKLYEVIVTETKVWMALEYCPGKELYDHL 123

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
            +   +R+   E   +  Q++  V   H +    +HRD+K+ENIL+ +NG  K+ DFG  
Sbjct: 124 LSL--HRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGF- 178

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD--LTKGYQINEKSDIWALGVFLFKL 239
                   + E M     + +  TT  Y +PE+++     G++I    DIW+LGV L+ L
Sbjct: 179 --------TRECMTKTTLETVCGTTV-YMAPELIERRTYDGFKI----DIWSLGVILYTL 225

Query: 240 CYYTTPFEKEGE-KAILKSQFQYPAYP--VYSDSLKNVIRVLLSVDPFKRPNICQLI 293
              + PF+ + E K   K   + P Y   +  D  K++I  LL+ +P +RP++ Q++
Sbjct: 226 ITGSLPFDDDDEVKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 96.3 bits (238), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 137/283 (48%), Gaps = 30/283 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K ++++  +V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVA---KLSIKTEKTRKKLLSEIQIHKSMKHQN-IV 205

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL++ L  R   +L E E+    TQ+   + 
Sbjct: 206 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKR--KQLTEPEVRFFTTQICGAIK 256

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI    N   K+ DFG +  V+   R   E K+         T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDR---ERKFTV-----CGT 305

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L + K    + + D+W++GV ++ L     PF+ +    I +      F +P
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
                S   K +++ LLS+DP +RP+I ++++ +   +GI PP
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVW-FRGIFPP 406

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 133/283 (46%), Gaps = 30/283 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +       +   A  +A   +  +  +K+   L +E+   K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSHPN-IV 142

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL++ L  R    L E E+    TQ+   + 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI    N   K+ DFG +  V+    +  E KY         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLA---NESERKYTI-----CGT 242

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS----QFQYP 262
             Y +PE+L + K    + + DIW+LGV L+ L     PF+      I +      F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
                SD  K +IR +LS+DP +RP++ ++++ +   +G  PP
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW-FRGTFPP 343

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 134/284 (47%), Gaps = 30/284 (10%)

Query: 26  KYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYV 85
           ++L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K + +   +
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHTN-I 140

Query: 86  VSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGV 145
           V +ID           +  V++L+E C  GSL++ +  R    + E E+   MTQ+  G+
Sbjct: 141 VQFIDCFED-------NVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT 205
             MH  +  +IHRD+K+ NI   E+   K+ DFG +  V+   R   E K+         
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVLANDR---ERKFT-----ICG 240

Query: 206 TAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQY 261
           T  Y +PE+L + K    + + DIW++GV L+ L     PF+ +    I     +  F Y
Sbjct: 241 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAY 299

Query: 262 PAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
           P     S   K +I  +LS++P +RP+I Q I +    +G  PP
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSI-QEIMDYVWFRGTFPP 342

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 126/303 (41%), Gaps = 63/303 (20%)

Query: 55  LKRVVVPDKKSLNALRAEVDALKVLR-NKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCS 113
           LK+V  P  ++    RA  +     R N  Y+ + +D   ++H    G+  +++L+ Y  
Sbjct: 62  LKKVTCPIGRADFVTRAMTEISNYQRFNSPYITNILDFQVAQHDN--GTKIIYMLLPYFP 119

Query: 114 GGSLIDFLNTRL--KNRLREQEILHIMTQVAVGVAQMHE--------------------- 150
            GSL D +N  +   + L E  ++ +M  +  GV  MHE                     
Sbjct: 120 AGSLQDLINNMIIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLR 179

Query: 151 ----------------LQPSL--------IHRDIKIENILISENGEYKVCDFGSVCGVIR 186
                           L P L        +H  +  ENI++S  G   + +  S    +R
Sbjct: 180 YSDETHLLVDAMELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VR 236

Query: 187 PP---RSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYT 243
            P    S  ++  +Q  + +N+   Y  PE+LDL     I  + DIW+LG   + L Y  
Sbjct: 237 APLELTSNSKLLGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSI 296

Query: 244 TPFEKEGE-------KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296
           + F +E +        +I    F +P  P YS SLK +++  L +DP KRP+I + + + 
Sbjct: 297 SSFAREQQLCGTPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQF 356

Query: 297 SRL 299
             L
Sbjct: 357 QEL 359

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 133/283 (46%), Gaps = 30/283 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +       +   A  +A   +  +  +K+   L +E+   K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMSHPN-IV 142

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL++ L  R    L E E+    TQ+   + 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI    N   K+ DFG +  V+    +  E KY         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLA---NESERKYTI-----CGT 242

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS----QFQYP 262
             Y +PE+L + K    + + DIW+LGV L+ L     PF+      I +      F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
                SD  K +IR +LS+DP +RP++ ++++ +   +G  PP
Sbjct: 302 RDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW-FRGTFPP 343

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 135/277 (48%), Gaps = 32/277 (11%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPD-KKSLNALRAEVDALKVLRN 81
           +I++ +  G +  VY A      Y     I  +K V + D  + ++ L  E+  L  LR+
Sbjct: 21  EILQCIGRGNFGDVYKA-----RYLATNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS 75

Query: 82  KKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQV 141
             Y+ +Y        +       ++++MEYC GGS  + L    +++L E +   I+++V
Sbjct: 76  P-YITNY-------KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEV 127

Query: 142 AVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDI 201
            VG+  +H  +   IHRDIK  NIL+++NG  K+ DFG V G +   R  +         
Sbjct: 128 LVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV------ 178

Query: 202 MKNTTAQYRSPEMLDLT-KGYQINEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQF 259
               T  + +PE++D   KGY  NE +DIW+LG+ + +L     P +K +  KA++    
Sbjct: 179 ---GTPFWMAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 260 QYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
           + P      +S   K+ +   L  DP +RP   +L++
Sbjct: 234 RDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 105/202 (51%), Gaps = 16/202 (7%)

Query: 103 YEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
           Y ++++MEYC GGS  D + T  +  L E ++  ++  V +G+  +H      IHRDIK 
Sbjct: 85  YLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKA 142

Query: 163 ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            NIL++++G  KV DFG             EM+          T  + +PE++ + +G  
Sbjct: 143 ANILLTDSGLVKVADFGVSA----------EMRSTMKAKTFVGTPYWMAPEVV-MNEGMG 191

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS--QFQYPA-YPVYSDSLKNVIRVLL 279
            NEKSDIW+LG+  ++L     P  K     ++++  + + P  +  Y++ +K+ I   L
Sbjct: 192 YNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCL 251

Query: 280 SVDPFKRPNICQLIEELSRLQG 301
             DP KRP+  +L+E    ++G
Sbjct: 252 IKDPEKRPSASELLEHDFMVKG 273

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 123/259 (47%), Gaps = 40/259 (15%)

Query: 52   IACLKRVVVPDKKSLN--------ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S N        ALR+EV  LK L +   +V Y+        G     
Sbjct: 1200 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLN-IVQYL--------GFENKN 1250

Query: 104  EVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
             ++ L +EY +GGS+   +  R+  R  E  I H+ TQV  G+A +H     ++HRD+K 
Sbjct: 1251 NIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLH--SKGILHRDMKA 1306

Query: 163  ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            +N+L+ ++G  K+ DF    G+ R  +      Y   D+    T  + +PEM+D  +GY 
Sbjct: 1307 DNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQGY- 1357

Query: 223  INEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNV 274
             + K DIW+LG  + ++     P+   E   A+ K      A P+  D+L       +N 
Sbjct: 1358 -SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNF 1416

Query: 275  IRVLLSVDPFKRPNICQLI 293
            +     ++P KRP   +L+
Sbjct: 1417 LDACFEINPEKRPTANELL 1435

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 141/311 (45%), Gaps = 84/311 (27%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVP--DKKSL 66
           +  + +V +G++  KIVK +  G + +VY A           +    ++VV+   +K   
Sbjct: 26  FSSNELVDIGNY--KIVKLIGEGSFGKVYLA----------NHRLTHQKVVLKTGNKNDP 73

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFV-------LMEYCSGGSLID 119
           N +R      +V  ++++   +I          T  YEV V        +EYC G  L +
Sbjct: 74  NVVR------EVFYHRQFDFPHI----------TKLYEVIVTESKVWMALEYCPGKELYE 117

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           +L   +++R+  +E   +  Q+   V   H LQ   +HRD+K+ENIL+ + G  K+ DFG
Sbjct: 118 YL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFG 173

Query: 180 ------------SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KGYQINE 225
                       +VCG                      T  Y +PE+++     G++I  
Sbjct: 174 FTRECATKTMLETVCG----------------------TTVYMAPELIERKSYDGFKI-- 209

Query: 226 KSDIWALGVFLFKLCYYTTPFEKEGE-KAILKSQFQYPAY--PVYSDSLKNVIRVLLSVD 282
             DIW+LGV L+ + + T PF++E E K   K   + P Y   V S   K++I  LL  D
Sbjct: 210 --DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKD 267

Query: 283 PFKRPNICQLI 293
           P +RP + Q++
Sbjct: 268 PSQRPQLSQVL 278

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 133/286 (46%), Gaps = 36/286 (12%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +R+   +V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-IV 139

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL+D L  R    L E E+    TQ+   V 
Sbjct: 140 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   ++   K+ DFG +  V+   R   E KY         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVLANDR---ERKYTV-----CGT 239

Query: 207 AQYRSPEML---DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQF 259
             Y +PE+L        Y++    DIW+ GV ++ L     PF+ +    I +      +
Sbjct: 240 PNYIAPEVLTGKHTGHSYEV----DIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDY 295

Query: 260 QYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
            +P     S     +IR +LS+DP +RP++ ++I+ +   +GI PP
Sbjct: 296 VFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVW-FRGIFPP 340

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 131/299 (43%), Gaps = 59/299 (19%)

Query: 47  SPATNIACLKRVVVP--DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYE 104
           +P TN+  LKR+  P  + +S++    EVD  K  ++  Y++  +DS  ++     GS  
Sbjct: 61  TPRTNLYALKRIRCPFGNIESISGAMKEVDNYKRFQSP-YIIHLVDSQVAQQ--RDGSKT 117

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNR--LREQEILHIMTQVAVGVAQMHE------------ 150
           V++L+ Y   GSL D  +  L N   + E E + I+  +A G+  +H+            
Sbjct: 118 VYILLPYFPLGSLQDSTSRNLLNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQ 177

Query: 151 ---------------------LQPSLI------------HRDIKIENILISENGEYKVCD 177
                                L+  ++            HRDIK  NIL S +G   + +
Sbjct: 178 EHDAVSMSYSDEAAFLLEDTPLELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISN 237

Query: 178 FGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLF 237
            GS         +  ++  +Q  +  + T  Y +PE+L +T    ++ K DIW+LG   +
Sbjct: 238 LGSCSKADLSINTGMQLTELQAWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCY 297

Query: 238 KLCYYTTPFEKEGE-------KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNI 289
            + +  +PFE+E +        AI    F +P+   YS+ L  +I   L V+P  RP+I
Sbjct: 298 FMLFGISPFEREEQISGASLKYAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 131/283 (46%), Gaps = 30/283 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +++   +V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHVN-IV 155

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL+D L  R    L E E+    TQ+   + 
Sbjct: 156 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI        K+ DFG    +        E KY         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLAND----RERKYTV-----CGT 255

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS----QFQYP 262
             Y +PE+L + K    + + DIW++GV ++ L     PF+ +    I +      F +P
Sbjct: 256 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFP 314

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPP 305
              + S   K +I+ +LS+DP +RP++ ++++ +   +G  PP
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYI-WFRGCFPP 356

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 134/282 (47%), Gaps = 30/282 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +++   +V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHSN-IV 155

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL+D L  R    L E E+    TQ+   + 
Sbjct: 156 QFIDCFEDDAN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            +H  +  +IHRD+K+ NI   ++   KV DFG +  V+   R   E KY         T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLANDR---ERKYTVCG-----T 255

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L + K    + + DIW++GV ++ L     PF+ +    I +     ++ YP
Sbjct: 256 PNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGYP 314

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVP 304
                S   + +I  +LS++P +RP I  +I+++   +G+ P
Sbjct: 315 KDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV-WFRGVFP 355

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 81/282 (28%), Positives = 132/282 (46%), Gaps = 43/282 (15%)

Query: 52   IACLKRVVVPD--------KKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP         K  + AL++EV  LK L +   +V Y+ S           Y
Sbjct: 1176 MMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-DHLNIVQYLGSEI-----RGNIY 1229

Query: 104  EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
             +F  +EY +GGS+   +  RL  R  E+ I H+ TQV  G+  +H     ++HRD+K +
Sbjct: 1230 SLF--LEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLSGLKYLH--SKGILHRDMKAD 1283

Query: 164  NILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQI 223
            N+L+ E+G  K+ DF    G+ +  ++     Y   D+    T  + +PEM+D  +GY  
Sbjct: 1284 NLLLDEDGICKISDF----GISKKSKNI----YSNSDMTMRGTVFWMAPEMVDTKQGYSA 1335

Query: 224  NEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNVI 275
              K DIW+LG  + ++     P+   E   A+ +      A P+  D++       K+ +
Sbjct: 1336 --KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPDDTIQLISSKGKDFL 1393

Query: 276  RVLLSVDPFKRPNICQLIEE-LSRLQGIVPPMKNFYLSRALE 316
                 +DP KRP    L+E   S+    V P  NF  +R  E
Sbjct: 1394 SKCFEIDPEKRPTADDLLEHSFSK----VDPAFNFSRTRLYE 1431

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 143/305 (46%), Gaps = 45/305 (14%)

Query: 52   IACLKRVVVPDKKSLN--------ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S N        ALR+EV  LK L +   +V Y+        G     
Sbjct: 1200 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYL--------GFENKD 1250

Query: 104  EVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
             ++ L +EY +GGS+   +  R+  R  E  I H+ TQV  G+A +H     ++HRD+K 
Sbjct: 1251 NIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLH--SKGILHRDMKA 1306

Query: 163  ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            +N+L+ ++G  K+ DF    G+ R  +      Y   D+    T  + +PEM+D  +GY 
Sbjct: 1307 DNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQGY- 1357

Query: 223  INEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNV 274
             + K DIW+LG  + ++     P+   E   A+ K      A P+  D+L       +  
Sbjct: 1358 -SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVGRGF 1416

Query: 275  IRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLMQPLQNNSYKVPIS 334
            +     ++P KRP   +L+     +  +    K+  L++ ++++  +     NS K+ I+
Sbjct: 1417 LDACFEINPEKRPTATELLSHRFSVVNVTFDFKSTELAKFIKSNDKL-----NSSKLRIT 1471

Query: 335  DIQDK 339
              ++K
Sbjct: 1472 SQENK 1476

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 131/278 (47%), Gaps = 35/278 (12%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKS--LNALRAEVDALKVLR 80
           K  + +  G +  VY  Y         TN  C  +V+  D     +  ++ EV  L  L+
Sbjct: 20  KRTEVIGRGKFGIVYKGYYI------KTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLK 73

Query: 81  NKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQ 140
               +  Y  S+ +       + E++V+MEYC+GGSL   L      ++ EQ I  IM +
Sbjct: 74  QVPNITHYYGSYLN-------NTELWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRE 123

Query: 141 VAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHD 200
           + + +  +H  +  +IHRDIK  N+LI+ +G  K+CDFG    +            I+  
Sbjct: 124 LLIALMHIH--KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL--------SQTKIRRQ 173

Query: 201 IMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILK 256
            M   T  + +PE+  + +G   + K DIW+LG+  +++     P+ + E  +A   I K
Sbjct: 174 TMAG-TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITK 230

Query: 257 SQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
           S+        +S +LK  I + L  DP +RP+  +L++
Sbjct: 231 SKPPRLEGRQHSSALKEFIALCLDEDPKERPSAEELLK 268

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 123/259 (47%), Gaps = 40/259 (15%)

Query: 52   IACLKRVVVPDKKSLN--------ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S N        ALR+EV  LK L +   +V Y+        G     
Sbjct: 1203 MMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDLDHLN-IVQYL--------GFENKN 1253

Query: 104  EVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
             ++ L +EY +GGS+   +  R+  R  E  I H+ TQV  G+A +H     ++HRD+K 
Sbjct: 1254 NIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGLAYLH--SKGILHRDMKA 1309

Query: 163  ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            +N+L+ ++G  K+ DF    G+ R  +      Y   D+    T  + +PEM+D  +GY 
Sbjct: 1310 DNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQGY- 1360

Query: 223  INEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNV 274
             + K DIW+LG  + ++     P+   E   A+ K      A P+  D+L       ++ 
Sbjct: 1361 -SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVGRSF 1419

Query: 275  IRVLLSVDPFKRPNICQLI 293
            +     ++P +RP   +L+
Sbjct: 1420 LDACFEINPEERPTATELL 1438

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 130/271 (47%), Gaps = 30/271 (11%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           +  G +  VY A    +D S    +A     +      ++ L  E+  L  L +  Y+ +
Sbjct: 40  VGKGNFGDVYKA----IDKSTGNTVAIKVVNLEETDDEIDLLAQEIYFLAELHSP-YITN 94

Query: 88  YIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQ 147
           Y  +     S       ++++MEYC GGS  D L    +  L E+++  I  ++  G+  
Sbjct: 95  YFSTFVEDVS-------MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEY 147

Query: 148 MHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +H  +   IHRDIK  NIL++++G+ K+ DFG V G +   R        + D    T  
Sbjct: 148 LHSQRK--IHRDIKAANILLTDDGKVKLGDFG-VSGQMMATR--------RRDTFVGTPF 196

Query: 208 QYRSPEMLDLT-KGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS--QFQYPAY 264
            + +PE++  + +GY  NEK+DIW+LG+ +F+L     P  +     +L S    + P  
Sbjct: 197 -WMAPEVIARSEQGY--NEKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRPPKL 253

Query: 265 P-VYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
              YS +++  + + L+ DP KRP   +L++
Sbjct: 254 EDRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 136/297 (45%), Gaps = 56/297 (18%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA 68
           +  D +  VG++  KI+K +  G + +VY A      + P     CLK     DK   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLAL-----HRPTHRKVCLK---TSDKNDPNI 79

Query: 69  LRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFV-------LMEYCSGGSLIDFL 121
           +R      +V  ++++   YI          T  YEV V        +EYC G  L D  
Sbjct: 80  VR------EVFYHRQFDFPYI----------TKLYEVIVTESKVWMALEYCPGKELYD-- 121

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
           +     R+   E   +  Q++  V   H +    +HRD+K+ENIL+ +NG  K+ DFG  
Sbjct: 122 HLLSLRRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGF- 178

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD--LTKGYQINEKSDIWALGVFLFKL 239
                   + E M     + +  TT  Y +PE+++     G++I    DIW+LGV L+ L
Sbjct: 179 --------TRECMTKTTLETVCGTTV-YMAPELIERRTYDGFKI----DIWSLGVILYTL 225

Query: 240 CYYTTPFEKEGE-KAILKSQFQYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
                PF+ + E K   K   + P Y   V  D  +++I  LL+ +P +RP++ Q++
Sbjct: 226 ITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 137/297 (46%), Gaps = 56/297 (18%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA 68
           +  D +  VG++  KI+K +  G + +VY A      + P     CLK     DK   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLAL-----HRPTHRKVCLK---TSDKNDPNI 79

Query: 69  LRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFV-------LMEYCSGGSLIDFL 121
           +R      +V  ++++   YI          T  YEV V        +EYC G  L D L
Sbjct: 80  VR------EVFYHRQFDFPYI----------TKLYEVIVTESKVWMALEYCPGKELYDHL 123

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
            +   +R+   E   +  Q++  V   H +    +HRD+K+ENIL+ +NG  K+ DFG  
Sbjct: 124 LSL--HRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGF- 178

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KGYQINEKSDIWALGVFLFKL 239
                   + E M     + +  TT  Y +PE++      G++I    D W+LGV L+ L
Sbjct: 179 --------TRECMTKTTLETVCGTTV-YMAPELIGRKTYDGFKI----DTWSLGVILYTL 225

Query: 240 CYYTTPFEKEGE-KAILKSQFQYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
              + PF+ + E K   K   + P Y   +  D  K++I  LL+ +P +RP++ Q++
Sbjct: 226 ITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 133/294 (45%), Gaps = 60/294 (20%)

Query: 14  VVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEV 73
           +  VG++  KI K +  G + +VY A      + P      LK     DK   N +R   
Sbjct: 36  LTEVGNY--KIQKQIGEGSFGKVYLAT-----HRPTKQKVVLK---TGDKSDPNVVR--- 82

Query: 74  DALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFV-------LMEYCSGGSLIDFLNTRLK 126
              +V  ++++   YI          T  YEV V        +EYC G  L D L +  K
Sbjct: 83  ---EVFYHRQFDYPYI----------TKLYEVIVTETKVWMALEYCPGKELYDHLLS--K 127

Query: 127 NRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIR 186
           +RL   E   +  Q+   V   H L  + +HRD+K+EN+L+ +NG  K+ DFG       
Sbjct: 128 SRLPTLECAELFAQITGAVHYAHTL--NCVHRDLKLENVLLDKNGNAKLTDFGF------ 179

Query: 187 PPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KGYQINEKSDIWALGVFLFKLCYYTT 244
              + E M     + +  TT  Y +PEM+      G+++    DIW+LGV L+ L     
Sbjct: 180 ---TRESMTKAVLETVCGTTV-YMAPEMIQHKPYDGFKV----DIWSLGVILYTLLCGCL 231

Query: 245 PFEKEGEKAILKSQFQYPAYPVYSDSL-----KNVIRVLLSVDPFKRPNICQLI 293
           PF+++ +  +L  Q      PV  + +     +N+I  LLS DP +RPN   ++
Sbjct: 232 PFDEDDD--LLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 132/285 (46%), Gaps = 30/285 (10%)

Query: 26  KYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYV 85
           ++L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K ++++  +
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKHQN-I 201

Query: 86  VSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGV 145
           V ++D              V++L+  C  GSL++ L  R    L E E+     Q+   +
Sbjct: 202 VQFVDCFEDH-------INVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT 205
             MH  +  +IHRD+K+ NI   EN   K+ DFG +  V+   R   E KY         
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVLANDR---ERKYTVCG----- 301

Query: 206 TAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQY 261
           T  Y +PE+L L K    + + DIW++GV +F L     PF+ +    I      S++ +
Sbjct: 302 TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 262 PAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPM 306
           P     S   K +I+ +L  DP  RP+I +++E +   +G  P M
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV-WFRGTFPSM 404

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 117/252 (46%), Gaps = 38/252 (15%)

Query: 52   IACLKRVVVPDKKSLN--------ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S N        ALRAE+  LK L +   +V Y+   A  H       
Sbjct: 1149 MMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNL-DHLNIVQYLGFEAKDHMNS---- 1203

Query: 104  EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
               + +EY +GGS+   +  R+  R  E  I H+ TQV  G++ +H     ++HRD+K +
Sbjct: 1204 ---LFLEYVAGGSVGSLI--RMYGRFDEVMIKHLTTQVLRGLSYLHSR--GILHRDMKAD 1256

Query: 164  NILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQI 223
            N+L+ + G  K+ DF    G+ R  +      Y   ++    T  + +PEM+D  +GY  
Sbjct: 1257 NLLLDQEGVCKISDF----GISRKSKDI----YSNSEMTMRGTVFWMAPEMVDTAQGY-- 1306

Query: 224  NEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNVI 275
            + K DIW++G  + ++     P+   E   A+ K      A P+  D+L       ++ I
Sbjct: 1307 SAKVDIWSMGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQSGRDFI 1366

Query: 276  RVLLSVDPFKRP 287
                 +DP  RP
Sbjct: 1367 DACFQIDPEARP 1378

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 128/272 (47%), Gaps = 29/272 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +R+   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHPN-IV 133

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            + D              V++L+E C  GSL+D L  R   +L E E+    TQ+   + 
Sbjct: 134 QFTDCFED-------DTNVYILLEICPNGSLMDLLKQR--KQLTEPEVRFFTTQIVGAIK 184

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   ++   K+ DFG +  V+   R   E KY         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVLANDR---ERKYTI-----CGT 233

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L   K    + + D+W++GV ++ L     PF+ +    I +      F +P
Sbjct: 234 PNYIAPEVLT-GKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFNFP 292

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
                S   K +I+ +LS+DP +RP++ +++E
Sbjct: 293 RDKPISSEAKVLIKDILSLDPLERPSLTEIME 324

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 131/280 (46%), Gaps = 30/280 (10%)

Query: 19  SHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKV 78
           +H   + + +  G +  VY A     +   A  +  L+       + L  L  E+  L  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENT----NERLEVLAQEIFFLAE 74

Query: 79  LRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIM 138
           L++  Y+++YI +     S       ++++MEYC GGS  D L     N L E+++ +I 
Sbjct: 75  LKSP-YIINYITTLLEDAS-------MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 139 TQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQ 198
            ++  G+  +HE +   IHRDIK  NIL++E G  K+ DFG V G         ++K   
Sbjct: 127 REILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSG---------QLKSTL 174

Query: 199 HDIMKNTTAQYRSPEMLDLT-KGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS 257
                  T  + +PE+     +GY  +EK DIW+LG+ +F+L     P  K     +L +
Sbjct: 175 RRGTIVGTPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLAN 232

Query: 258 QFQYPA---YPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
             +  A      YSD+ K+ + + L  +P +RP    L++
Sbjct: 233 LSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 131/287 (45%), Gaps = 47/287 (16%)

Query: 28   LASGGYAQVY-SAYVTPVDYSPATNIACLKRVVVPDKKSLN--------ALRAEVDALKV 78
            +  G +  VY S  VT         +  +K+V VP+  S N        ALR+EV  LK 
Sbjct: 1344 IGKGSFGSVYLSLNVT------TGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKD 1397

Query: 79   LRNKKYVVSYIDSHASKHSGHTGSYEVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHI 137
            L +   +V Y+        G      ++ L +EY +GGS+   +  R+  R  E  I H 
Sbjct: 1398 L-DHINIVQYL--------GFEKKNNIYSLFLEYVAGGSIGSLI--RMYGRFDESLIRHS 1446

Query: 138  MTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYI 197
             TQ+  G++ +H     ++HRD+K +NIL+   G  K+ DF    G+ R  +      Y 
Sbjct: 1447 TTQILAGLSYLH--SKGILHRDMKADNILLDGEGICKISDF----GISRKSKDI----YS 1496

Query: 198  QHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILK 256
              ++    T  + +PEM+D  +GY  + K DIW+LG  + ++     P+   E   A+ K
Sbjct: 1497 NSEMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIILEMFAGKRPWSNLEVVAAMFK 1554

Query: 257  SQFQYPAYPVYSDSL-------KNVIRVLLSVDPFKRPNICQLIEEL 296
                  A P+  D+L       ++ +     +DP KRP   Q+++ L
Sbjct: 1555 IGQSKSAPPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHL 1601

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 134/276 (48%), Gaps = 39/276 (14%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDAL---KVLRNKKY 84
           L  GG+A+ +      +      + AC  ++V   KKS+   R +   L   ++ +N +Y
Sbjct: 99  LGEGGFARCFH-----IKDDVGISFAC--KIV--SKKSIKTERTKFKLLSEIQIHQNLRY 149

Query: 85  --VVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVA 142
             +V ++D    +         V++L+E C  GSL+D L  R    L E E+  + TQV 
Sbjct: 150 SHIVKFMDCFEDE-------LNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVC 200

Query: 143 VGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIM 202
             +  MH    ++IHRD+K+ N+   +N   K+ DFG    +     +  E KY      
Sbjct: 201 GAINYMH--SNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-- 252

Query: 203 KNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQ 258
              T  Y +PE++ L+K    + ++DIW+LG+ ++ +     PF+ +    I +     Q
Sbjct: 253 ---TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQ 308

Query: 259 FQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
           +++P     ++ +K +I+ LL +DP +RP I  +++
Sbjct: 309 YEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 106/200 (53%), Gaps = 33/200 (16%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           V++ +EYC G  L ++L   +K R+   E  H+ +Q+   V   H ++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 ILISENGEYKVCDFGSV--CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KG 220
           IL+ + G+ K+ DFG    C            K I   +   T   Y +PE+++    +G
Sbjct: 159 ILLDKKGQAKLTDFGFTRECAT----------KGILETVCGTTV--YMAPELIERKPYEG 206

Query: 221 YQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQ-YPAYPVYSDSL-----KNV 274
           Y+I    D W+LG+ L+ + +   PF++E +   +K++++     P Y D+      K++
Sbjct: 207 YKI----DTWSLGIILYTMIHGAMPFDEEDD---IKTKYRIVNNEPFYDDNFIDANGKDL 259

Query: 275 IRVLLSVDPFKRPNICQLIE 294
           I  LL  DP +RP++ Q+++
Sbjct: 260 IMQLLQKDPSQRPSLTQVLQ 279

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 129/272 (47%), Gaps = 29/272 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +++   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 133

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            + D      +       V++L+E C  GSL+D L  R   +L E E+    TQ+   + 
Sbjct: 134 QFTDCFEDDTN-------VYILLEICPNGSLMDLLKQR--KQLTEPEVRFFTTQIVGAIK 184

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   ++   K+ DFG +  V+   R   E KY         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVLANDR---ERKYT-----ICGT 233

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L   K    + + DIW++GV ++ L     PF+ +    I +      F +P
Sbjct: 234 PNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFP 292

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
                S   K +I+ +LS+DP +RP++ +++E
Sbjct: 293 KDKPISSEAKVLIKDILSLDPLERPSLAEIME 324

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 122/259 (47%), Gaps = 40/259 (15%)

Query: 52   IACLKRVVVPDKKS--------LNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S        + ALR+EV  LK L +   +V Y+        G     
Sbjct: 1239 MMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL-DHLNIVQYL--------GFENKD 1289

Query: 104  EVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
             ++ L +EY +GGS+   +  R+  R  E  I H+ TQV  G+A +H     ++HRD+K 
Sbjct: 1290 NIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVLRGLAYLHSR--GILHRDMKA 1345

Query: 163  ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            +N+L+ ++G  K+ DFG         R  +++ Y   D+    T  + +PEM+D  +GY 
Sbjct: 1346 DNLLLDQDGVCKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY- 1396

Query: 223  INEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNV 274
             + K DIW+LG  + ++     P+   E   A+ K      A P+  D+L       ++ 
Sbjct: 1397 -SAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTLPLISQNGRDF 1455

Query: 275  IRVLLSVDPFKRPNICQLI 293
            +     +DP  RP    L+
Sbjct: 1456 LDACFEIDPDNRPTADNLL 1474

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 103/203 (50%), Gaps = 35/203 (17%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           + +++EY SGG    ++  + K RL+E     + TQ+  GV  MH     L+HRD+K+EN
Sbjct: 124 IGIVLEYASGGEFYRYI--QRKRRLKETAGCRLFTQLVSGVNYMH--SKGLVHRDLKLEN 179

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQ 222
           +L+ ++    + DFG V   ++            +D+MK +     Y +PE++  TK Y+
Sbjct: 180 LLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPELVISTKPYE 228

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEK-----EGEKA------ILKSQFQYPAY--PVYSD 269
              K+DIW+ G+ L+ +     P++      EG+        I ++  ++P Y  P+  D
Sbjct: 229 A-RKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPEYISPIPRD 287

Query: 270 SLKNVIRVLLSVDPFKRPNICQL 292
               ++R LL  DP KR NI Q+
Sbjct: 288 ----LLRRLLVSDPRKRLNIRQI 306

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 85/297 (28%), Positives = 134/297 (45%), Gaps = 56/297 (18%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA 68
           +  D +  VG++  KI+K +  G + +VY A      + P     CLK     DK   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLAL-----HRPTHRKVCLK---TSDKNDPNI 79

Query: 69  LRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFV-------LMEYCSGGSLIDFL 121
           +R      +V  ++++   YI          T  YEV V        +EYC G  L D  
Sbjct: 80  VR------EVFYHRQFDFPYI----------TKLYEVIVTESKVWMALEYCPGKELYD-- 121

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
           +     RL   E   +  Q++  V   H +    +HRD+K+ENIL+  NG  K+ DFG  
Sbjct: 122 HLLSLRRLSLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFGF- 178

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KGYQINEKSDIWALGVFLFKL 239
                   + E M     + +  TT  Y +PE+++     G++I    DIW+LGV L+ L
Sbjct: 179 --------TRECMTKTTLETVCGTTV-YMAPELIERKTYDGFKI----DIWSLGVILYTL 225

Query: 240 CYYTTPFEKEGE-KAILKSQFQYPAYP--VYSDSLKNVIRVLLSVDPFKRPNICQLI 293
                PF+ + E K   K   + P Y      D  K++I  LL+ +P +RP++ Q++
Sbjct: 226 ITGYLPFDDDDEVKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 129/278 (46%), Gaps = 35/278 (12%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKS--LNALRAEVDALKVLR 80
           K  + +  G +  VY  Y T       T   C  +V+  D     +  ++ E+  L  L+
Sbjct: 20  KRTEVIGRGKFGVVYKGYYT------KTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLK 73

Query: 81  NKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQ 140
               +  Y  S+ +         +++V+MEYC+GGSL   L      ++ EQ I  IM +
Sbjct: 74  QVPNITHYYGSYLN-------DTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRE 123

Query: 141 VAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHD 200
           +   +  +H  +  +IHRDIK  N+LI+ +G  K+CDFG    +            I+  
Sbjct: 124 LLTALMHIH--KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL--------SQTKIRRQ 173

Query: 201 IMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILK 256
            M   T  + +PE+  + +G   + K DIW+LG+  +++     P+ E E  +A   I K
Sbjct: 174 TMAG-TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITK 230

Query: 257 SQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
           S+        +S +LK +I + L  DP +RP+   L++
Sbjct: 231 SKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLK 268

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 88.6 bits (218), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 138/277 (49%), Gaps = 32/277 (11%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPD-KKSLNALRAEVDALKVLRN 81
           +I++ +  G +  VY A     D + +  I  +K V + D  + ++ L  E+  L  LR+
Sbjct: 21  EILQCIGRGNFGDVYKAR----DLT-SNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS 75

Query: 82  KKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQV 141
             Y+ +Y        +       ++++MEYC GGS  + L    ++++ E++   I+++V
Sbjct: 76  P-YITNY-------KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEV 127

Query: 142 AVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDI 201
            +G+  +H  +   IHRDIK  NIL+++NG  K+ DFG V G +   R  +         
Sbjct: 128 LIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV------ 178

Query: 202 MKNTTAQYRSPEMLDLTK-GYQINEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQF 259
               T  + +PE++D  K GY  NE +DIW+LG+ + +L     P +K +  KA++    
Sbjct: 179 ---GTPFWMAPEVIDRNKQGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 260 QYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
           + P      +S   ++ +   L  DP +RP   +L++
Sbjct: 234 RDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 89.0 bits (219), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 134/274 (48%), Gaps = 30/274 (10%)

Query: 24  IVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKK 83
           I + +  G +  VY A+        A  +  L+      ++ ++ L  E+  L  LR+  
Sbjct: 17  IQECVGRGNFGDVYKAFDKTNGAIVAVKVVNLEHT----EEDIDLLAQEIFFLAELRSP- 71

Query: 84  YVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAV 143
           Y+ +YI +     S       ++++MEYC GG+  D + T   N L E ++  I  +V  
Sbjct: 72  YITNYITTMIEDVS-------MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLK 124

Query: 144 GVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMK 203
           G+  +H+ +   IHRDIK  NIL+++ G+ K+ DFG V G IR   + +   ++      
Sbjct: 125 GLKYLHDQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TMKRGTFV------ 173

Query: 204 NTTAQYRSPEMLDL-TKGYQINEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQY 261
             T  + +PE+++  + GY  NEK+DIW+LG+ +++L     P  K +  K ++    + 
Sbjct: 174 -GTPYWMAPEVVNKESNGY--NEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRK 230

Query: 262 PA--YPVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
           P   +  YSD  K  +   L  DP  RP+   L+
Sbjct: 231 PPKLHGQYSDVAKGFVAACLVKDPNLRPSAEMLL 264

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 121/236 (51%), Gaps = 27/236 (11%)

Query: 64  KSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNT 123
           + ++ L  E+  L  L++  Y+++YI +     S       ++++M+YC GGS  D +  
Sbjct: 54  EDIDLLAQEIFFLAELKSD-YIINYITTIMEDVS-------MWIVMDYCGGGSCSDLIKI 105

Query: 124 RLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCG 183
              N + E+++  I+  V +G+  +HE +   IHRDIK  NIL++++G+ K+ DFG V G
Sbjct: 106 VYPNGIVEEKVSFIVKNVLLGLQYLHEQKK--IHRDIKAANILLTDDGQVKLGDFG-VSG 162

Query: 184 VIRPPRSYEEMKYIQHDIMKNTTAQYRSPEML--DLTKGYQINEKSDIWALGVFLFKLCY 241
            I+          ++ D     T  + +PE++  ++  GY  +EK DIW+LG+  ++L  
Sbjct: 163 QIKAT--------LKRDTFVG-TPYWMAPEVINKEINNGY--DEKVDIWSLGITTYELLK 211

Query: 242 YTTPFEKEGEKAILKSQFQY---PAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
              P  K     ++ S  +      +  Y+D  K+ I   L  DP  RPN+  L++
Sbjct: 212 GVPPLSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 135/297 (45%), Gaps = 56/297 (18%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA 68
           +  D +  VG++  KI+K +  G + +VY A      + P      LK     DK   N 
Sbjct: 26  FTSDELSEVGNY--KILKQIGEGSFGKVYLA-----SHKPTHRKVVLK---TSDKSDPNL 75

Query: 69  LRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFV-------LMEYCSGGSLIDFL 121
           +R      +V  ++++   YI          T  YEV V        +EYC G  L + L
Sbjct: 76  VR------EVFYHRQFDFPYI----------TKLYEVIVTETKVWMALEYCPGRELYEHL 119

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
              + +R+   E   +  Q+   V   H L  + +HRD+K+ENIL+ +NG  K+ DF   
Sbjct: 120 --LMLHRIPLDECAKLFAQIVSAVHYAHSL--NCVHRDLKLENILLDKNGNAKLTDF--- 172

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KGYQINEKSDIWALGVFLFKL 239
            G  R   S   ++ I        T  Y +PE++      G++I    DIW+LGV L+ +
Sbjct: 173 -GFTRECVSKSSLETI------CGTTVYMAPELIQRQAYDGFKI----DIWSLGVILYTM 221

Query: 240 CYYTTPFEKEGE-KAILKSQFQYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
              T PF+++ E K   K    +P +     S   K++I+ LL+  P +RP + Q++
Sbjct: 222 INGTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 132/285 (46%), Gaps = 36/285 (12%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +R+   +V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHTN-IV 139

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            ++D      +       V++L+E C  GSL+D L  R    L E E+    TQ+   V 
Sbjct: 140 QFVDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   ++   KV DFG +  V+   R   E KY         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG-LAAVLANDR---ERKYTV-----CGT 239

Query: 207 AQYRSPEML---DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQF 259
             Y +PE+L        Y++    DIW+ GV ++ L     PF+ +    I +      F
Sbjct: 240 PNYIAPEVLTGKHTGHSYEV----DIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDF 295

Query: 260 QYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVP 304
            +P     S     +I+ +LS+DP +RP++ ++I+ +   +G+ P
Sbjct: 296 VFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYVW-FRGLFP 339

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 115/236 (48%), Gaps = 38/236 (16%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           + +++EY SGG    ++    K RL+E     +  Q+  GV  MH     L+HRD+K+EN
Sbjct: 123 IGIVLEYASGGEFYRYIQK--KRRLKEHAACRLFAQLISGVHYMHSK--GLVHRDLKLEN 178

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQ 222
           +L+ +N    + DFG V           E  + ++++MK +     Y +PE++  TK Y+
Sbjct: 179 LLLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPELVVTTKPYE 227

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEGEKA-----------ILKSQFQYPAY--PVYSD 269
              K+DIW+ GV ++ +     P++ + E             I K+  ++P Y  PV  D
Sbjct: 228 A-RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPRD 286

Query: 270 SLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVP--PMKNFYLSRALETSSLMQP 323
            L+   R+L+S +P KR N+ Q +E+   LQ   P   +      R LE   L +P
Sbjct: 287 LLR---RILVS-NPKKRLNLRQ-VEQHQWLQPHCPFLTITPEEWDRTLEGKELFRP 337

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 118/239 (49%), Gaps = 32/239 (13%)

Query: 65   SLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVL-MEYCSGGSLIDFLNT 123
            ++ A+++EV  LK L +   +V Y+        G    + ++ L +EY +GGS+   +  
Sbjct: 1181 TVEAMKSEVSTLKDLDHLN-IVQYL--------GFEMKHNIYSLFLEYVAGGSVGSLI-- 1229

Query: 124  RLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCG 183
            R+  R  ++ I H+  QV  G++ +H     ++HRD+K +N+L+ ++G  K+ DFG    
Sbjct: 1230 RMYGRFDDKLIRHLTNQVLEGLSYLH--SQGILHRDMKADNLLLDQDGICKISDFGIS-- 1285

Query: 184  VIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYT 243
                 +  E++ Y   ++    T  + +PEM+D  +GY  N K DIW+LG  + ++    
Sbjct: 1286 -----KKSEDI-YSNSEMTMRGTVFWMAPEMVDTKQGY--NAKVDIWSLGCVVLEMFAGK 1337

Query: 244  TPFEK-EGEKAILKSQFQYPAYPVYSD-------SLKNVIRVLLSVDPFKRPNICQLIE 294
             P+   E   A+ K      A P+  D       + KN +     +DP +RP   QL+E
Sbjct: 1338 RPWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLLE 1396

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 135/286 (47%), Gaps = 30/286 (10%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +++   +V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 137

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            +ID      +       V++L+E C  GSL+D L  R    L E E+ +  TQ+   + 
Sbjct: 138 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI    N   K+ DFG +  V+   R   E KY         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLANDR---ERKYTV-----CGT 237

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQFQYP 262
             Y +PE+L   K    + + DIW++GV ++ L     PF+ +    I +      + +P
Sbjct: 238 PNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDYIFP 296

Query: 263 AYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKN 308
                S  +  +I+ +LS+DP +RP++ ++++ +   +GI P   N
Sbjct: 297 REKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVW-FRGIFPARIN 341

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 101/199 (50%), Gaps = 26/199 (13%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           ++++MEYC GGS  D +       L E ++  I   V  G+  +HE +   IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT---TAQYRSPEML-DLTKG 220
           +L++++G  K+ DFG V G +R                +NT   T  + +PE++ + + G
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAK------------RNTFVGTPYWMAPEIISNSSHG 196

Query: 221 YQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQYPAYPVYSDSLKNVIR 276
           Y  NEK+DIW+LG+ +++L     P+ K     ++    K   Q      +SD+ K  I 
Sbjct: 197 Y--NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQ-DCMVSFSDAAKLFIS 253

Query: 277 VLLSVDPFKRPNICQLIEE 295
             L  DP +RP   +L+++
Sbjct: 254 ACLIKDPDERPTATELLQQ 272

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 114/237 (48%), Gaps = 30/237 (12%)

Query: 65   SLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTR 124
            +++ALR EV  LK L +   +V Y+   A       G Y +F  +EY +GGS+   +  R
Sbjct: 1186 TVDALRLEVSTLKDL-DHLNIVQYLGFEA-----KNGIYSLF--LEYVAGGSVGSLI--R 1235

Query: 125  LKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGV 184
            +  R  +  I H+  QV  G++ +H     ++HRD+K +N+L+ ++G  K+ DF    G+
Sbjct: 1236 MYGRFDDILIRHLTIQVLQGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GI 1289

Query: 185  IRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTT 244
             R         Y   ++    T  + +PEM+D  +GY  + K DIW+LG  + ++     
Sbjct: 1290 SRKSNDI----YSNSEMTMKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1343

Query: 245  PFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNVIRVLLSVDPFKRPNICQLI 293
            P+   E   A+ K      A P+  D+L       K  +     +DP KRP   +L+
Sbjct: 1344 PWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 142/293 (48%), Gaps = 30/293 (10%)

Query: 19  SHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKV 78
           S+T  I + +  G +  VY A         A  +  L+      ++ ++ L  E+  L  
Sbjct: 12  SNTYIIQQCVGRGNFGDVYKACDKVEGKVVAVKVVNLEH----SEEDIDLLAQEIFFLAE 67

Query: 79  LRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIM 138
           LR+  ++ +YI +        T    ++++MEYC GGS  D +     N + E+++  I 
Sbjct: 68  LRSP-FITNYITTL-------TEDVSMWIVMEYCGGGSCADLIKHIYINGMPEKKVAFIT 119

Query: 139 TQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQ 198
           +QV  G+  +HE +   IHRDIK  NIL+++ G  K+ DFG V G IR   + +   ++ 
Sbjct: 120 SQVLRGLVYLHEQKK--IHRDIKAANILLTDEGTVKLGDFG-VSGQIRA--TLKRGTFV- 173

Query: 199 HDIMKNTTAQYRSPEMLDL-TKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS 257
                  T  + +PE++     GY  +EK+DIW+LG+ +++L     P  K     ++ +
Sbjct: 174 ------GTPYWMAPEVVSKENDGY--DEKADIWSLGITVYELLKGAPPLSKCDPMKVMIN 225

Query: 258 --QFQYPA-YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMK 307
             + + PA +  YS S KN +   L  +P  R +  +++E     Q  VP +K
Sbjct: 226 LPKRKPPALHGHYSHSAKNFVSSCLVKNPVGRASAYEMVEHNFVNQLAVPNLK 278

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 111/234 (47%), Gaps = 35/234 (14%)

Query: 69  LRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY----EVFVLMEYCSGGSLIDFLNTR 124
           +R E+  L  L+    +  Y            GSY    +++V+MEYC+GGSL   L   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYY-----------GSYLIDTKLWVIMEYCAGGSLRTLLRPG 107

Query: 125 LKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGV 184
           +   + E+ I  IM ++ V +  +H  + ++IHRDIK  NILI+ NG  K+CDFG    +
Sbjct: 108 I---IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAAQL 162

Query: 185 IRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTT 244
                       ++   M   T  + +PE+  + +G   + K DIW+LG+  +++     
Sbjct: 163 --------SQSMLKRQTMAG-TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNP 211

Query: 245 PF-EKEGEKA---ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
           P+   E  +A   I KS+        YS  LK  I + L  DP +RP   +L +
Sbjct: 212 PYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERPYAEELFK 265

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 122/259 (47%), Gaps = 40/259 (15%)

Query: 52   IACLKRVVVPDKKS--------LNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S        ++A+++EV  LK L +   +V Y+        G     
Sbjct: 1279 MMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKDLDHLN-IVQYL--------GFENKD 1329

Query: 104  EVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
             ++ L +EY +GGS+   +  R+  R  E  I H+  QV  G+A +H     ++HRD+K 
Sbjct: 1330 NIYSLFLEYVAGGSVGSLI--RIYGRFDEPLIRHLNIQVLRGLAYLHAR--GILHRDMKA 1385

Query: 163  ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            +N+L+ ++G  K+ DF    G+ R  +      Y   D+    T  + +PEM+D  +GY 
Sbjct: 1386 DNLLLDQDGVCKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQGY- 1436

Query: 223  INEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNV 274
             + K DIW+LG  + ++     P+   E   A+ K      A P+  D+L       +  
Sbjct: 1437 -SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGKSKSAPPIPEDTLPLISAEGREF 1495

Query: 275  IRVLLSVDPFKRPNICQLI 293
            +     +DP KRP   +L+
Sbjct: 1496 LDACFEIDPDKRPTADELL 1514

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 133/293 (45%), Gaps = 49/293 (16%)

Query: 52   IACLKRVVVP-----DKKSLN---ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP     D+  L+   ALR+EV  LK L +   +V Y+        G    +
Sbjct: 1300 MMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKDL-DHLNIVQYL--------GFENDH 1350

Query: 104  EVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
            +++ L +EY  GGS+   +  RL  R  E  I  +  QV  G+A +H     ++HRD+K 
Sbjct: 1351 DIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQVLEGLAYLH--SKGILHRDMKA 1406

Query: 163  ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            +N+L+  +G  K+ DF    G+ R  +      Y   D+    T  + +PEM+D  +GY 
Sbjct: 1407 DNLLLDLDGVCKISDF----GISRKSKDI----YSNSDMTMRGTVFWMAPEMVDTKQGYS 1458

Query: 223  INEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNV 274
               K DIW+LG  + ++     P+   E   A+ K      A P+  D+L       +  
Sbjct: 1459 A--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKNKSAPPIPEDTLPLISQDGRQF 1516

Query: 275  IRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLMQPLQNN 327
            +     +DP  RP   +L+           P  + Y S   +++ L Q +++N
Sbjct: 1517 LNACFEIDPDLRPTADKLLSH---------PFSSVYDSFDFKSTKLAQFIKSN 1560

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 102/215 (47%), Gaps = 38/215 (17%)

Query: 98  GHTGSYEVFV----------LMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQ 147
           GH G   +F           ++E+ SGG L+  +  R   RL E+    I +Q+   V  
Sbjct: 70  GHPGVVRLFCTFHDTDNLYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDY 127

Query: 148 MHELQPSLIHRDIKIENILISENGEYKVCDFGSVC----GVIRPPRSYEEMKYIQHDIMK 203
           MH     +IHRD+K EN+L+S+ G   + DFG+ C    G   P  +     ++      
Sbjct: 128 MHAK--GVIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFVG----- 180

Query: 204 NTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEK------AILKS 257
             TA+Y SPE+L  +   Q +  SD+WALG  +++L     PF  + E         L  
Sbjct: 181 --TAEYVSPELLLHS---QCSFGSDVWALGCIIYQLTQGAPPFRGDTELQSFEKIVALDY 235

Query: 258 QFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQL 292
           ++ Y A P+    +  +++ +L +DP +RP+  QL
Sbjct: 236 RWVYAAPPL----IVALVQSILVLDPLQRPSAKQL 266

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 100/197 (50%), Gaps = 26/197 (13%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           ++++MEYC GGS  D L     N L E+++  I+ +V +G+  +HE +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDL-TKGYQI 223
           IL++E G  K+ DFG V G IR          ++ D     T  + +PE++     GY  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 224 NEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS-------QFQYPAYPVYSDSLKNVIR 276
           NEK+DIW+LG+  ++L     P  K     ++ +       + Q P    +SD+ K+ + 
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKDFVA 250

Query: 277 VLLSVDPFKRPNICQLI 293
             L   P  RP+   L+
Sbjct: 251 GCLVKTPADRPSAYNLL 267

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 130/274 (47%), Gaps = 28/274 (10%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNK 82
           +I + +  G +  V+ A         A  I  L+      +  ++ L  E+  L  LR  
Sbjct: 40  EIKECVGKGSFGDVFRATHRQTGEVVAIKIINLEET----QDDIDVLAQEIYFLSELR-A 94

Query: 83  KYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVA 142
            +V +Y  +     S       ++++ME+C GGS  D L    ++RL E ++ +I+ +V 
Sbjct: 95  PFVTTYFKTFVEDVS-------MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVL 147

Query: 143 VGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIM 202
            G+  +H  +   IHRDIK  NIL++++GE K+ DFG V G I        M  ++    
Sbjct: 148 FGLDYLHSQKK--IHRDIKAANILLTDDGEVKLGDFG-VSGQI--------MATLKRTTF 196

Query: 203 KNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQY 261
              T  + +PE++   K    NEK+DIW+LG+   +L     P+ K +  K ++    + 
Sbjct: 197 VG-TPYWMAPEII-AKKDNGYNEKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRK 254

Query: 262 P--AYPVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
           P      ++ S ++ I + L  DP  RP+  +L+
Sbjct: 255 PPKLQGRFTGSARDFIALCLIKDPDLRPSAAELL 288

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 128/283 (45%), Gaps = 36/283 (12%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIA---CLKRVVVPDKKSLNALRAEVDALKVLRNKKY 84
           L  G Y+ VY A    VD S     A   C K+ ++ + K +  +  E + L +L +  +
Sbjct: 16  LGHGSYSTVYKA----VDRSTGQLFAIKVCSKKHIISENK-VKYVTIEKNTLNLLAHGNH 70

Query: 85  ---VVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQV 141
              +  Y   H S++        ++ ++++  GG L+  L T+   R  E    H M Q+
Sbjct: 71  PGIIKLYYTFHDSEN--------LYFVLDFAPGGELLQLLQTQ--GRFNEAWTKHFMCQL 120

Query: 142 AVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDI 201
              +  +H  +  ++HRD+K EN+L+S  G+  + DFG    +           ++    
Sbjct: 121 IDALEYIHGCK--VVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFV---- 174

Query: 202 MKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQY 261
               TA+Y SPE+L   K    N  SDIWA+G  L++    T PF  E E A  +     
Sbjct: 175 ---GTAEYVSPELLLQNKS---NFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNL 228

Query: 262 PAYPVY--SDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGI 302
             + +Y  S  + +++  +L +DP  R  + Q I+  +  QGI
Sbjct: 229 DYHWIYMVSQHITDLVSKILVLDPDSRYTLPQ-IKNHAWFQGI 270

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 112/226 (49%), Gaps = 22/226 (9%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE         VA  +  +H    +++HRD
Sbjct: 195 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLREHHARKFARGVASALQYLHAN--NIVHRD 250

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTK 219
           +KIENI+IS +GE K+ DFG +  V      ++  K + H      +  + +PE+L    
Sbjct: 251 LKIENIMISTSGEIKIIDFG-LSNV------FDTRKQL-HTFC--GSLYFAAPELLKANP 300

Query: 220 GYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSLKNVI 275
              I  + DIW+ GV L+ L     PF+ E      + I + + +YP +   S  + +++
Sbjct: 301 --YIGPEVDIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLL 356

Query: 276 RVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLM 321
             +L VDP KR N+ ++IE    ++G   P  ++   R+  T  ++
Sbjct: 357 SKMLVVDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKRSPMTPEII 402

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 102/195 (52%), Gaps = 23/195 (11%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +  K +L E E +H  TQ+  GV+  H    ++ HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVS--KGKLSEPEAVHYFTQIIQGVSYCHSF--NICHRDLKPE 255

Query: 164 NILISE-NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
           N+L+ + N   K+ DFG +  +  P +  E      H         Y SPE++ + K Y 
Sbjct: 256 NLLLDKKNKVIKIADFG-MAALELPNKLLETSCGSPH---------YASPEIV-MGKPYH 304

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPAYPVYSDSLKNVIRVL 278
               SD+W+ G+ LF L     PF  +  +K +LK Q   FQ P Y   ++  K++I  +
Sbjct: 305 -GGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTNDAKDLITRI 361

Query: 279 LSVDPFKRPNICQLI 293
           L  +P KR  I +++
Sbjct: 362 LVTNPEKRLTINEIL 376

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 99/194 (51%), Gaps = 24/194 (12%)

Query: 101 GSY----EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLI 156
           GSY     ++++MEYC+GGSL   L      ++ E+ I  IM +V V +  +H  + ++I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIH--KDNVI 141

Query: 157 HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD 216
           HRDIK  N+LI+  G  K+CDFG    V +     + M           T  + +PE+  
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEV-- 190

Query: 217 LTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLK 272
           + +G   + K DIW+LG+  +++     P+ E E  +A   I+KS+        YS SLK
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLK 250

Query: 273 NVIRVLLSVDPFKR 286
             I + L  DP +R
Sbjct: 251 EFIALCLDEDPKER 264

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 99/204 (48%), Gaps = 35/204 (17%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           + +++EY SGG    ++    K RL+E     +  Q+  GV  MH     L+HRD+K+EN
Sbjct: 120 IGIVLEYASGGEFYKYIQK--KRRLKESAACRLFAQLISGVYYMHSK--GLVHRDLKLEN 175

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQ 222
           +L+ +N    + DFG V   +            ++++MK +     Y +PE++   + Y+
Sbjct: 176 LLLDKNENLLITDFGFVNEFL-----------PENELMKTSCGSPCYAAPELVVTARPYE 224

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEGE-----------KAILKSQFQYPAY--PVYSD 269
              K+DIW+ GV ++ +     P++ + E           + I ++  ++P Y  PV  D
Sbjct: 225 A-RKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDYIAPVPRD 283

Query: 270 SLKNVIRVLLSVDPFKRPNICQLI 293
               ++R +L  DP KR  I Q +
Sbjct: 284 ----LLRAILVADPKKRITIAQTL 303

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 100/196 (51%), Gaps = 23/196 (11%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L  R   +L EQE +H   Q+  GV+  H    ++ HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNF--NICHRDLKPE 193

Query: 164 NILIS-ENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
           N+L+  +N   K+ DFG +  +    R  E      H         Y SPE++ + + Y 
Sbjct: 194 NLLLDKKNKTVKIADFG-MAALETTNRLLETSCGSPH---------YASPEIV-MGQKYH 242

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPAYPVYSDSLKNVIRVL 278
               SD+W+ G+ LF L     PF  +   K +LK Q   +Q P+    S   K++I  +
Sbjct: 243 -GSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN--VSKEAKDLISKI 299

Query: 279 LSVDPFKRPNICQLIE 294
           L VDP KR  + +++E
Sbjct: 300 LVVDPEKRITVDKILE 315

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 144/289 (49%), Gaps = 34/289 (11%)

Query: 14  VVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEV 73
           V+  G +  K  + L  G Y+ V  A  T ++ +    +  L +  +  +K +  +  E 
Sbjct: 147 VIKKGINDFKFGETLGDGSYSTVLLA--TSIESNKKYAVKILNKEYLIKQKKVKYVNIEK 204

Query: 74  DALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQE 133
           + L+ L+N K ++S   +   + S       ++ L+EY   G L+  +  R    + E+ 
Sbjct: 205 NTLQRLKNTKGIISLYFTFQDESS-------LYFLLEYAPNGDLLSLM--RKHGSVNEKC 255

Query: 134 ILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEE 193
             +   Q+   +  MH+    +IHRD+K ENIL+  + + K+ DFG+    +    S ++
Sbjct: 256 TQYYAAQIIDALGFMHD--KGVIHRDLKPENILLDVDMKVKLTDFGT--ARLLDSTSEDD 311

Query: 194 MKYIQHDIMKNT-----TAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK 248
           +KY   D++  +     TA+Y SPE+L+    Y ++ + DIWA G  LF++     PF+ 
Sbjct: 312 LKY---DLLTRSNSFVGTAEYVSPELLN--DNY-VDFRCDIWAFGCILFQMIAGKPPFKA 365

Query: 249 EGE----KAILKSQFQYPA-YPVYSDSLKNVIRVLLSVDPFKRPNICQL 292
             E    + ++K QF + A +P+   +++++++ +L  +P +R  I Q+
Sbjct: 366 NNEYLTFQKVMKVQFAFTAGFPM---TVRDLVKNILIKNPERRLLINQI 411

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 92/352 (26%), Positives = 160/352 (45%), Gaps = 51/352 (14%)

Query: 14  VVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEV 73
           ++  G    K  + +  G Y+ V  A  T  D      +  L +  +  +K +  +  E 
Sbjct: 174 IIRKGIKDFKFGEMVGDGAYSTVMLA--TAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEK 231

Query: 74  DALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLK-NRLREQ 132
           +AL+ L N + +V    +   + S       ++ L+EY   G   DFL+   K   L E 
Sbjct: 232 NALQRLNNSRGIVKLFFTFQDESS-------LYFLLEYAPNG---DFLSVMKKYGSLSED 281

Query: 133 EILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYE 192
              +   Q+  G+  +H     +IHRDIK ENIL+ ++ + K+ DFG+   ++ P    E
Sbjct: 282 CTRYYSAQIIDGIKYLH--SKGIIHRDIKPENILLDKDMKVKITDFGT-AKILEPKNEDE 338

Query: 193 ---EMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKE 249
              E   +        TA+Y SPE+L+ +    ++ + DIWA G  +F++     PF+  
Sbjct: 339 DNPEFNLLTRSKSFVGTAEYVSPELLNDS---YVDARCDIWAFGCMVFQMIAGKPPFKAT 395

Query: 250 GE----KAILKSQFQYPA-YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVP 304
            E    + ++K Q+ + A +PV    L  V R+LL V P +R  I Q+ +          
Sbjct: 396 NEYLTFQKVMKVQYAFTAGFPVVVRDL--VKRILLKV-PEQRLTIPQIEKH--------- 443

Query: 305 PMKNFYLSRALETSSL-------MQPLQNNSYKV-PISDIQDK-HKRQIPNI 347
              +FY   + E  S+       +QP + N+  + P+ +++D  +KR I NI
Sbjct: 444 ---HFYKDISFEDGSVWTAPAPEIQPYKINAKSMQPVPELKDAPNKRTIINI 492

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 99/375 (26%), Positives = 171/375 (45%), Gaps = 73/375 (19%)

Query: 27  YLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVV 86
           +L  GG+A+ +           A  +A   ++ +  +K+   L +E+   K +++   +V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSMKHPN-IV 150

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
            + D      +       V++L+E C  GS+++ L  R +  L E E+   M Q+   + 
Sbjct: 151 QFTDCFEDDTN-------VYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            MH  +  +IHRD+K+ NI   +    K+ DFG +  V+   +   E KY         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVLANDK---ERKYTI-----CGT 250

Query: 207 AQYRSPEML---DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK----SQF 259
             Y +PE+L        Y++    DIW++GV L+ L +   PF+ +  + I +      F
Sbjct: 251 PNYIAPEVLTGKHTGHSYEV----DIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDF 306

Query: 260 QYPA-YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL-------SRL-QGIVPPMKNF- 309
            +PA  PV SD+ KN+I  LL ++P  RP++ ++ + +       SRL   I   + NF 
Sbjct: 307 IFPADKPVSSDA-KNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFD 365

Query: 310 ---------YLSRALETSSLMQPLQNNSY---KVPI----SDIQDKHKRQIPNIQSSPEK 353
                     L + +  S L++  Q +SY   K PI    ++I+++  R +         
Sbjct: 366 HLSFSESLINLKQCMLNSGLLKSSQTHSYDGSKNPIELVRTEIEEERNRAV--------- 416

Query: 354 LPSIQSTSNGMTTNK 368
           LP  QS S G T NK
Sbjct: 417 LP--QSLSPGGTKNK 429

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 104/194 (53%), Gaps = 18/194 (9%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           ++++MEYC GGS  D +       + E ++ +I+     G+  +H+ +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD-LTKGYQI 223
           IL+++ G+ K+ DFG V G IR   + +   ++        T  + +PE+++   KGY  
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRA--TMKRGTFV-------GTPYWMAPEVINKQCKGY-- 191

Query: 224 NEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYP--AYPVYSDSLKNVIRVLLS 280
           NEK+DIW+LG+  ++L     P  K +  K +L    + P   +  YS+  K  + + L 
Sbjct: 192 NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLI 251

Query: 281 VDPFKRPNICQLIE 294
            DP +RP+I  L+E
Sbjct: 252 KDPKQRPSIEALLE 265

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 124/271 (45%), Gaps = 33/271 (12%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           +  G Y  VY A     D      +  +K +V  + + LN + AE+  LK L N   +V 
Sbjct: 31  IGRGSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVK 84

Query: 88  YIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQ 147
           Y       H     SYE+++L+EYC+ GSL   + +R    L E E    +TQ  +G+  
Sbjct: 85  Y-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKY 136

Query: 148 MHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +H     +IHRDIK  NIL+S +   K+ DFG V  ++               +    T 
Sbjct: 137 LH--GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTL 182

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYP-- 265
            + +PE+L   +G   +  SDIW+LG  + ++     P+    +  I  +      YP  
Sbjct: 183 NWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPS 239

Query: 266 VYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296
            +S+SLK+ +      + +KRP   QL++ +
Sbjct: 240 SFSESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 111/226 (49%), Gaps = 32/226 (14%)

Query: 96  HSGHTGSYEV-------FVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQM 148
           HS   G YEV       ++++EY  GG L D+L +R K  L E+E +H   Q+  GV+  
Sbjct: 201 HSNILGLYEVWENKSELYLVLEYVDGGELFDYLVSRGK--LGEREAVHYFKQIVQGVSYC 258

Query: 149 HELQPSLIHRDIKIENILIS-ENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           H    ++ HRD+K EN+L+  +N   K+ DFG     +         K +Q       + 
Sbjct: 259 HSF--NICHRDLKPENLLLDKKNKSIKIADFGMAALEV-------SNKLLQTSC---GSP 306

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPA 263
            Y SPE++ + + Y     SD+W+ G+ LF L     PF  +  +K +LK Q   F  P 
Sbjct: 307 HYASPEIV-MGRPYH-GGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQ 364

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEE--LSRLQGIVPPMK 307
               S   K+++  +L V+PFKR    +++    L++   +V P+K
Sbjct: 365 N--LSAEAKDLMSKILVVNPFKRIATEEILNHPLLTKYDKLVKPVK 408

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 85.9 bits (211), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 101/197 (51%), Gaps = 26/197 (13%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           ++++MEYC GGS  D L     N L E+++  I+ QV +G+  +HE +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDL-TKGYQI 223
           IL++E G  K+ DFG V G IR   +++   ++        T  + +PE++     GY  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--STFKRDTFV-------GTPYWMAPEVVCCEVDGY-- 194

Query: 224 NEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS-------QFQYPAYPVYSDSLKNVIR 276
           NEK+DIW+LG+  ++L     P  K     ++ +       + Q P    +S++ K  + 
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSEAAKEFVA 250

Query: 277 VLLSVDPFKRPNICQLI 293
             L   P  RP+   L+
Sbjct: 251 GCLVKTPADRPSAYDLL 267

>NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {ON}
           Anc_6.262 YPL236C
          Length = 367

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 152/349 (43%), Gaps = 64/349 (18%)

Query: 12  DTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATN---IACLKRVVVP--DKKSL 66
           ++++++ +   KI K L     +  YS  V  +D  P      +  LKR+  P  D +S+
Sbjct: 20  NSIISINARDYKIEKLLQDENLS--YSYLVRTLDSEPPFENGPLFVLKRIYCPFGDIESV 77

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLN---- 122
           +A   E+   K      +++S +D     H  + GS ++ VL  +   GS+ D +N    
Sbjct: 78  SAAMNEISYYKKFAGNSHIISCLDYQL--HQKYDGSKQIDVLFPFYHYGSVQDDINRHLL 135

Query: 123 ---TRLKNRLREQEILHIMTQVAVGVAQMHELQ--------------------------P 153
              T L   + E++ + IM  +  G+  +H+ +                          P
Sbjct: 136 SSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAPLLLNDLP 195

Query: 154 SLIHRDIKIEN------------ILISENGEYKVCDFGSVCGVIRPPRSYE-EMKYIQHD 200
             + +D + EN            IL+SE G   + D  S C       S E ++   Q  
Sbjct: 196 MELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQS-CFRTNITISTEIQLNRFQQW 254

Query: 201 IMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE--KAILKSQ 258
           I ++ T Q+ +PE+L L  G +I  K DIW+LG  L+ + +  +PFE+E +    ++K  
Sbjct: 255 IEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVVKYC 314

Query: 259 FQYPAYPV------YSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQG 301
            +   Y +      YS  + +++   L VDP +RP++  ++  L  +QG
Sbjct: 315 IKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQG 363

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 88/329 (26%), Positives = 147/329 (44%), Gaps = 69/329 (20%)

Query: 13  TVVTVGSHTAKIVKYLASGGYAQVYSAY-VTP---------VDYSPATNIACLKRVVVP- 61
           T + VGS    + K +  G +A V+ A+ +TP         VD S   N  C    +VP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSL 117
               +KK L  L  E+  LK + +  ++V  ID   +       S + +++MEYCS G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKISHP-HIVKLIDFERT-------SKDFYLIMEYCSLGDL 140

Query: 118 IDFLNTRLK----------------------NRLREQEILHIMTQVAVGVAQMHELQPSL 155
              +  R +                      N L +  IL+ + Q++  +  +     +L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLR--SKNL 198

Query: 156 IHRDIKIENILISE-----NGEYKVCDFGSVCGVIRPP----RSYEEMKYIQHDIMKNT- 205
           +HRDIK +N+L+S      N      D G V G+   P      +   +++ +  M  T 
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFV-GIYNLPILKIADFGFARFLPNTSMAETL 257

Query: 206 --TAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK----EGEKAILKSQ- 258
             +  Y +PE+L+  K    N K+D+W++G  L+++CY   PF+     E  K I K+  
Sbjct: 258 CGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKAND 314

Query: 259 -FQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
              +P Y    ++LK++I  LL+ DP +R
Sbjct: 315 LIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 101/199 (50%), Gaps = 31/199 (15%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+F+++EY  GG L D+L +R   RL E+E +H   Q+  G A  H    ++ HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGF--NICHRDLKPE 186

Query: 164 NILIS-ENGEYKVCDFGSVCGVIRPPRSYEEMKYIQ--HDIMKNTTA--QYRSPEMLDLT 218
           N+L+  +N   K+ DFG              M  +Q  + +++ +     Y SPE++ + 
Sbjct: 187 NLLLDKKNKRIKIADFG--------------MAALQTSNKLLETSCGSPHYASPEIV-MG 231

Query: 219 KGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQYPAYPVYSDSLKNV 274
           K Y     SD+W+ G+ LF L     PF  +  K +L      ++Q P     S   +++
Sbjct: 232 KNYN-GGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQS--VSSGAQDL 288

Query: 275 IRVLLSVDPFKRPNICQLI 293
           I  +L VDP KR +I +++
Sbjct: 289 ISRILVVDPDKRISINEIL 307

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 127/283 (44%), Gaps = 45/283 (15%)

Query: 28   LASGGYAQVYSAY-VTPVDYSPATNIACLKRVVVPDKKS--------LNALRAEVDALKV 78
            +  G +  VY A  VT         +  +K+V VP+  S        + AL++EV  LK 
Sbjct: 1044 IGKGSFGAVYLALNVT------TGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKD 1097

Query: 79   LRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIM 138
            L N   +V Y+           G Y +F  +EY +GGS+   +  R+  R  +Q I H+ 
Sbjct: 1098 L-NHVNIVQYLG-----FEEKNGIYSLF--LEYVAGGSVGSLI--RMYGRFDDQLIRHLT 1147

Query: 139  TQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQ 198
             QV  G+A +H     ++HRD+K +N+L+  +G  K+ DF    G+ R   +     Y  
Sbjct: 1148 KQVLEGLAYLH--SKGILHRDMKADNLLLDNDGVCKISDF----GISRKSNNI----YSN 1197

Query: 199  HDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKS 257
             D+    T  + +PEM+D   GY  + K DIW+LG  + ++     P+   E   A+ + 
Sbjct: 1198 SDMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQI 1255

Query: 258  QFQYPAYPVYSDSL-------KNVIRVLLSVDPFKRPNICQLI 293
                 A P+  D+        ++ +     +DP  RP    L+
Sbjct: 1256 GKSKTAPPIPDDTKDLVSPAGQSFLDQCFEIDPEMRPTADSLV 1298

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 140/301 (46%), Gaps = 62/301 (20%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV--PDKKSL 66
           +  + +  VG++  KI+K +  G + +VY A   P            ++VV+    K   
Sbjct: 26  FTSNELYEVGNY--KILKQVGEGSFGKVYLAIHRPTH----------RKVVLKSSSKTDP 73

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYE-------VFVLMEYCSGGSLID 119
           N +R      +V  ++++   YI          T  YE       V++ +EYC G  L D
Sbjct: 74  NVVR------EVFYHRQFDHPYI----------TKLYEIIITETKVWMSLEYCPGKELYD 117

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
           +L   +  R+   E   +  Q+   V   H L  + +HRD+K+ENIL+   G  K+ DF 
Sbjct: 118 YL--LVMRRIPLDECSRLFAQIVGAVYYAHSL--NCVHRDLKLENILLDMQGNAKLADF- 172

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEML--DLTKGYQINEKSDIWALGVFLF 237
              G  R   +  +++ I        T  Y +PE+L  D   G++I    DIW+LGV L+
Sbjct: 173 ---GFTRECATKNQLETIC------GTTVYMAPELLRRDTYDGFKI----DIWSLGVILY 219

Query: 238 KLCYYTTPFEKEGEK----AILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
            L   + PF++E E      I+  +  Y      ++S++ +I+ LL  DP KRP++ +++
Sbjct: 220 TLINGSMPFDEEDETRTEWKIINEEPDYNEKIFNANSIE-LIKSLLIKDPKKRPSMTEIL 278

Query: 294 E 294
           +
Sbjct: 279 K 279

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 99/199 (49%), Gaps = 31/199 (15%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+F+++EY  GG L D+L +R   RL E+E +H   Q+  G A  H    ++ HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSF--NICHRDLKPE 186

Query: 164 NILIS-ENGEYKVCDFGSVCGVIRPPRSYEEMKYIQ--HDIMKNTTA--QYRSPEMLDLT 218
           N+L+  +N   K+ DFG              M  +Q  + +++ +     Y SPE++ + 
Sbjct: 187 NLLLDKKNKRIKIADFG--------------MAALQTSNKLLETSCGSPHYASPEIV-MG 231

Query: 219 KGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQYPAYPVYSDSLKNV 274
           K Y     SD+W+ G+ LF L     PF  +  K +L      ++Q P     S   +++
Sbjct: 232 KTYN-GGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--AISLEAQDL 288

Query: 275 IRVLLSVDPFKRPNICQLI 293
           I  +L VDP KR  I  ++
Sbjct: 289 ISRILVVDPNKRITINDIL 307

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 120/259 (46%), Gaps = 40/259 (15%)

Query: 52   IACLKRVVVPDKKS--------LNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S        + ALR+EV  LK L +   +V Y+        G     
Sbjct: 1121 MMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKDL-DHLNIVQYL--------GFENKD 1171

Query: 104  EVFVL-MEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKI 162
             ++ L +EY +GGS+   +  R+  R  E  I H+  QV  G++ +H     ++HRD+K 
Sbjct: 1172 NIYSLFLEYVAGGSVGSLI--RMYGRFDEAMIRHLTIQVLRGLSYLHSR--GILHRDMKA 1227

Query: 163  ENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
            +N+L+ ++G  K+ DFG         R   ++ Y   D+    T  + +PEM+D  +GY 
Sbjct: 1228 DNLLLDQDGVCKISDFGIS-------RKSNDI-YSNSDMTMRGTVFWMAPEMVDTKQGY- 1278

Query: 223  INEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNV 274
             + K DIW+LG  + ++     P+   E   A+ K      A P+  D+L       +  
Sbjct: 1279 -SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQDGRQF 1337

Query: 275  IRVLLSVDPFKRPNICQLI 293
            +     +DP  RP   +L+
Sbjct: 1338 LDSCFEIDPESRPTADKLL 1356

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 122/258 (47%), Gaps = 38/258 (14%)

Query: 52   IACLKRVVVPDKKSLN--------ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP   S N        ALRAEV  LK L +   +V Y+             Y
Sbjct: 1207 MMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKDL-DHLNIVQYLGFEVKD-----SIY 1260

Query: 104  EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
             +F  +EY +GGS+   +  R+  +  E+ I H+  QV  G++ +H     ++HRD+K +
Sbjct: 1261 SLF--LEYVAGGSVGSLI--RMYGKFDEKLIKHLTIQVLRGLSYLHSR--GILHRDMKAD 1314

Query: 164  NILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQI 223
            N+L+ ++G  K+ DF    G+ R  +      Y   ++    T  + +PEM+D  +GY  
Sbjct: 1315 NLLLDQDGVCKISDF----GISRKSKDI----YSNSEMTMRGTVFWMAPEMVDTKQGY-- 1364

Query: 224  NEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSL-------KNVI 275
            + K DIW+LG  + ++     P+   E   A+ K      A P+  D+L       ++ +
Sbjct: 1365 SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPDDTLPLISQSGRDFL 1424

Query: 276  RVLLSVDPFKRPNICQLI 293
                 +DP +RP   +L+
Sbjct: 1425 DQCFKIDPEERPTADKLL 1442

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 110/229 (48%), Gaps = 27/229 (11%)

Query: 62  DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFL 121
           D   +  ++ E+  L  L+    +  Y  S+    S       +++LMEYC+GGSL   L
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDTS-------LWILMEYCAGGSLRSLL 111

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
                 ++ E+ I  IM ++ V +  +H  + ++IHRDIK  N+LI+  G  K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 166

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCY 241
             V +     + M           T  + +PE+  + +G   + K DIW+LG+  +++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
              P+ + E  +A   I+KS+        YS SLK  I + L  DP +R
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 122/270 (45%), Gaps = 33/270 (12%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           +  G Y  VY A     D      +  +K +V    + LN + AE+  LK L N   +V 
Sbjct: 31  IGRGSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVK 84

Query: 88  YIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQ 147
           Y       H     SYE+++L+EYC+ GSL   + +R    L E E    +TQ  +G+  
Sbjct: 85  Y-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKY 136

Query: 148 MHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +H     +IHRDIK  NIL+S +   K+ DFG V  ++               +    T 
Sbjct: 137 LH--GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTL 182

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYP-- 265
            + +PE+L   +G   +  SDIW+LG  + ++     P+    +  I  +      YP  
Sbjct: 183 NWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPS 239

Query: 266 VYSDSLKNVIRVLLSVDPFKRPNICQLIEE 295
            +S+SLK+ +      + +KRP   QL++ 
Sbjct: 240 SFSESLKDFLSKCFVKNMYKRPTADQLLKH 269

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 103/195 (52%), Gaps = 23/195 (11%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           +V++  EYC G  L D + +    R+     + + TQ+   V   H L  + +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHVLSL--QRVPSSACIELFTQIVGAVYYAHSL--NCVHRDLKLE 158

Query: 164 NILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEML--DLTKGY 221
           NIL+ +NG  K+ DFG          + E M     + +  TT  Y +PE++  +   G+
Sbjct: 159 NILLDKNGNAKLTDFGF---------TRECMTKTSLETICGTTV-YMAPELIKRESYDGF 208

Query: 222 QINEKSDIWALGVFLFKLCYYTTPFEKEGE-KAILKSQFQYPAY--PVYSDSLKNVIRVL 278
           +I    DIW+LGV L+ +   + PF+++ E K   K   + P +   + S+  K+++  L
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKL 264

Query: 279 LSVDPFKRPNICQLI 293
           LS DP +RP++ +++
Sbjct: 265 LSKDPNERPSMQEIL 279

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 132/304 (43%), Gaps = 53/304 (17%)

Query: 11   PDTVVTVGSHTAKI-----VKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVP---- 61
            P T +     T KI     +K +  G Y +V   Y     Y     +   +R++V     
Sbjct: 986  PQTTIGAQKRTKKITDFIILKKMGEGAYGKVDLCYHKKEKYIVVIKMIFKERILVDTWVR 1045

Query: 62   DKKSLNALRAEVDALKVLR--NKKYVVSYIDSHASKH--------SGHTGSYEVFVLMEY 111
            D+K L  + +E+  +  L   + K ++S +D               G TG  ++F L+E+
Sbjct: 1046 DRK-LGTIPSEIQIMSTLNKTSNKNILSILDFFEDDDYYYVEQPVHGKTGCIDLFDLIEF 1104

Query: 112  CSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENG 171
                          K  + E E   I  Q+  G++ +HE    ++HRDIK EN+++   G
Sbjct: 1105 --------------KTNMTEFEAKLIFKQIISGISHLHE--SGIVHRDIKDENVIVDAKG 1148

Query: 172  EYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEK-SDIW 230
              K+ DFGS   V   P           D+   T   Y SPE+L   +G +   K  DIW
Sbjct: 1149 FVKLIDFGSAAYVKNGP----------FDVFVGTI-DYASPEVL---RGEKYEGKPQDIW 1194

Query: 231  ALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNIC 290
            ALG+ L+ + +   PF    E  IL+   ++P     S +  ++I+++L+    +RP+I 
Sbjct: 1195 ALGILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSIT 1252

Query: 291  QLIE 294
             + E
Sbjct: 1253 DISE 1256

>KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 483

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 136/284 (47%), Gaps = 31/284 (10%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNK 82
           ++++ +  G +  VY A+    +  P T+    K V +   K +N L    + + +L  +
Sbjct: 8   QLLECVGKGNFGDVYLAHYLGSNQEP-TDPKIPKNVPLA-IKCIN-LEHSNEPIDLLLKE 64

Query: 83  KYVVSYIDSHASKH--SGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQ 140
            Y +S +      H     TG   ++++MEYCS GSL++ L  R  +RL EQ    I+ Q
Sbjct: 65  IYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLL--RYYSRLTEQTTCFIILQ 122

Query: 141 VAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHD 200
           V   +  +HE +  LIHRD+K  NIL++++GE ++ D G V G ++   +    K +   
Sbjct: 123 VCHALEYLHEKR--LIHRDLKAANILLNDDGEVRLADLG-VTGQLKFNSTRHGGKNLNTF 179

Query: 201 IMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQ 260
           +    T  + +PE++   K    + K DIW+LG+   +L     P         +K+  +
Sbjct: 180 V---GTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPPMSHLDS---MKALMR 230

Query: 261 YPAYPVYSDSL----------KNVIRVLLSVDPFKRPNICQLIE 294
            P   + +DS+          K+ IR  L  DP +RP   QL++
Sbjct: 231 IPK--LNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQ 272

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 125/263 (47%), Gaps = 32/263 (12%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   +++ EY SGG L+D++       LRE         +A G+A +H    +++HRD
Sbjct: 212 TMSNHFYMMFEYVSGGQLLDYIIQH--GSLREPLARSFARAIASGLAYLH--ANNVVHRD 267

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT----AQYRSPEML 215
           +KIENI+++  GE K+ DFG     +  PR+            K TT      + +PE+L
Sbjct: 268 LKIENIMLTAAGEIKIIDFG--LSNLFDPRA------------KLTTYCGSLYFAAPELL 313

Query: 216 DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKA----ILKSQFQYPAYPVYSDSL 271
              K Y I  + DIW+ GV L+ L     PF+ E   A    I + +  YPA    S   
Sbjct: 314 R-AKPY-IGPEIDIWSFGVILYVLVVGKVPFDDENSNALHEKIKRGKVSYPA--TLSIEC 369

Query: 272 KNVIRVLLSVDPFKRPNICQLIEELSRLQGIVP-PMKNFY-LSRALETSSLMQPLQNNSY 329
            +++  +L+V+P +R  + +++     ++G    P K+F    R L    L   + N  +
Sbjct: 370 ISLLTKMLTVNPKRRATLKEIVTHHWMVRGYGNIPAKSFQPWRRCLVPEELDNTVFNEMF 429

Query: 330 KVPISDIQDKHKRQIPNIQSSPE 352
            +      D+ ++Q+  + +SPE
Sbjct: 430 NLEFVADVDEARKQLAKLITSPE 452

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 99/197 (50%), Gaps = 27/197 (13%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +  K +L E E +H   Q+  G++  H    ++ HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVS--KGKLTESEAVHYFKQIINGISYCHSF--NICHRDLKPE 264

Query: 164 NILISENGEY-KVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA--QYRSPEMLDLTKG 220
           N+L+ +     K+ DFG                 + + +++ +     Y SPE++ + K 
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIV-MGKC 311

Query: 221 YQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQYPAYPVYSDSLKNVIR 276
           Y     SDIW+ G+ LF L     PF  +  K +L      ++Q P+Y   S   KN+I 
Sbjct: 312 YN-GAPSDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNLIS 368

Query: 277 VLLSVDPFKRPNICQLI 293
            +L VDP KR +  Q++
Sbjct: 369 RILVVDPSKRISTEQIL 385

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 137/295 (46%), Gaps = 52/295 (17%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA 68
           +  + +  VG++  KI+K +  G + +VY A      + P      LK     DK   N 
Sbjct: 26  FTAEELSEVGNY--KIMKQIGEGSFGKVYLA-----SHKPTHRKVVLK---TSDKNDPNV 75

Query: 69  LRA-----EVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNT 123
           +R      + D L + R  + +V+                +V++ +EYC G  L + L  
Sbjct: 76  VREVFYHRQFDYLYITRLYEVIVT--------------ETKVWMALEYCPGKELYEHL-L 120

Query: 124 RLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCG 183
            LK R+   E   +  Q+   +   H L  + +HRD+K+ENIL+ + G  K+ DFG    
Sbjct: 121 ALK-RISLDECSRLFAQIVGAIYYAHSL--NCVHRDLKLENILLDKKGNAKLTDFGF--- 174

Query: 184 VIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KGYQINEKSDIWALGVFLFKLCY 241
                 + E +   Q D +  TT  Y +PE+ +     G++I    DIWALGV L+ +  
Sbjct: 175 ------TRECVSKSQLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMIN 223

Query: 242 YTTPFEKEGE-KAILKSQFQYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
            + PF+++ E K   K   + P     + S   K++I  LL+ DP +RP+I +++
Sbjct: 224 GSMPFDEDDEAKTKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 126/274 (45%), Gaps = 31/274 (11%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNI----ACLKRVVVPDKKSLNALRAEVDALKVLRNKK 83
           L +G Y++VY A    VD S    +     C KR ++ + K +  +  E + L +L    
Sbjct: 18  LGNGSYSRVYKA----VDRSDPQRVYAVKVCSKRHIIHENK-VKYVTIEKNTLNLLARAN 72

Query: 84  YVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAV 143
           +    +  H++ H        ++ ++++ +GG L+  LN R+  +  E    H + Q+  
Sbjct: 73  HP-GIVKLHSTFHDEEN----LYFVLDFAAGGELLSLLN-RV-GKFTEPCARHFIAQLID 125

Query: 144 GVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMK 203
               +H     +IHRD+K EN+L+  +G   V DFG+   + +        +  +     
Sbjct: 126 TTEFIHSQ--GVIHRDLKPENVLLHRDGRLMVTDFGTATNITK--------ENTEGGASF 175

Query: 204 NTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS--QFQY 261
             TA+Y SPE+L      Q    SD+WALG  L++      PF  E E    +     +Y
Sbjct: 176 VGTAEYVSPELLLYN---QCQFASDVWALGCMLYQFIEGVPPFRGENELHTFEKIVALEY 232

Query: 262 PAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEE 295
           P        + +++R +L++DP +RP++  + ++
Sbjct: 233 PWANNNKGGVVSLVRRILTLDPSQRPSLTSIKQD 266

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 113/231 (48%), Gaps = 39/231 (16%)

Query: 72  EVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLRE 131
           E++ALK+L +   V        SK+ G        +++E+ SGG    +L  + K RL+E
Sbjct: 103 EINALKLLTHPNIVRLEEVLQNSKYIG--------IVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 QEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSY 191
                +  Q+  GV  MH     L+HRD+K+EN+L+ +N    + DFG V          
Sbjct: 153 PHACQLFAQLISGVTYMH--SKGLVHRDLKLENLLLDKNENLIITDFGFVNEF------- 203

Query: 192 EEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKE 249
               +  +++MK +     Y +PE++  T+ Y+   K DIW+ G+ L+ +     P++ +
Sbjct: 204 ----FGSNELMKRSCGSPCYAAPELVLSTEPYRA-RKVDIWSCGIILYAMLAGYLPWDDD 258

Query: 250 GE-----------KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNI 289
            +           + I K+  ++PAY   S   +++IR +L+ +P +R +I
Sbjct: 259 SQNPNGDDIGKLYQYITKTALKFPAY--ISPLARDLIRKILTANPSRRISI 307

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 146/301 (48%), Gaps = 64/301 (21%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVP--DKKSL 66
           +  D +  +G++  KI K++  G + +VY           AT+    ++VV+   +K+  
Sbjct: 26  FSSDELSEIGNY--KISKFIGEGSFGKVY----------LATHRLTHQKVVLKTGNKRDP 73

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFV-------LMEYCSGGSLID 119
           N +R      +V  ++++   YI          T  YEV V       ++EYCSG  L +
Sbjct: 74  NVVR------EVFYHRQFDFPYI----------TKLYEVIVTESRVWMVLEYCSGHELYE 117

Query: 120 FLNTRLK-NRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDF 178
            L   LK  RL  +E   + +Q+A  V   HEL+   +HRD+K+EN+L+  NG  K+ DF
Sbjct: 118 HL---LKEQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLENVLLDGNGHAKLTDF 172

Query: 179 GSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD--LTKGYQINEKSDIWALGVFL 236
               G  R   +  +++ I        T  Y +PE+++     G+++    DIW+LG+ L
Sbjct: 173 ----GFTREMATRSQLETIC------GTTVYMAPELIERKCYDGFKV----DIWSLGIIL 218

Query: 237 FKLCYYTTPFEKEGE----KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQL 292
           + +     PF+++ +      I+  +  +    +  D++ ++I+ +L  +P +R ++ Q+
Sbjct: 219 YTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAI-DLIQGMLRKNPNERISLAQV 277

Query: 293 I 293
           +
Sbjct: 278 L 278

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 141/331 (42%), Gaps = 59/331 (17%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           +  G + +V   +      SP  N+   K+V +   K     +     LK+ R       
Sbjct: 75  IGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAISKDSSKELKIYR------- 127

Query: 88  YIDSHASKHSGH----------TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHI 137
             + +A KH  H            S  + +++EY SGG    ++  + K RL+E     +
Sbjct: 128 --EINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYI--QRKKRLKETAACRL 183

Query: 138 MTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYI 197
             Q+  GV  +H     L+HRD+K+EN+L+ ++    + DFG V              Y 
Sbjct: 184 FAQLINGVHYIHS--KGLVHRDLKLENLLLDKHENLVITDFGFVNEF-----------YS 230

Query: 198 QHDIMKNTTAQ--YRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKA-- 253
            +++MK +     Y +PE++  TK Y+   K+DIW+ G+ L+ +     P++ +      
Sbjct: 231 HNELMKTSCGSPCYAAPELVISTKPYEA-RKADIWSCGIILYAMLAGYLPWDDDSGNPDG 289

Query: 254 ---------ILKSQFQYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGI 302
                    I K+  ++P Y  P+  D    ++R +L  DP +R  + Q IE+   L+  
Sbjct: 290 DDISRLYYYITKTPLKFPDYINPIPRD----LLRKILVSDPRRRITMKQ-IEKHEWLK-- 342

Query: 303 VPPMKNFYLSRALETSSLMQPLQNNSYKVPI 333
             P   F      E  ++M P  N S+  P+
Sbjct: 343 --PHTAFLSITPEEWDTIMHPKSNTSFIRPV 371

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 80/145 (55%), Gaps = 15/145 (10%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           ++++MEYC GGS  D L     N L E+++  I+ QV +G+  +HE +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDL-TKGYQI 223
           IL++E G  K+ DFG V G IR          ++ D     T  + +PE++     GY  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 224 NEKSDIWALGVFLFKLCYYTTPFEK 248
           NEK+DIW+LG+  ++L     P  K
Sbjct: 190 NEKADIWSLGITTYELLKGLPPLSK 214

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 101/200 (50%), Gaps = 31/200 (15%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +R   +L EQE +H   Q+  GV+  H    ++ HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHF--NICHRDLKPE 196

Query: 164 NILISE-NGEYKVCDFGSVCGVIRPPRSYEEMKYIQH-DIMKNTTA---QYRSPEMLDLT 218
           N+L+ + N   K+ DFG              M  ++  D +  T+     Y SPE++ + 
Sbjct: 197 NLLLDKKNLSVKIADFG--------------MAALETTDKLLETSCGSPHYASPEIV-MG 241

Query: 219 KGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQYPAYPVYSDSLKNV 274
           + Y     SD+W+ G+ LF L     PF  +  K +L      ++Q P     S+  K++
Sbjct: 242 QKYH-GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--ISNEAKDL 298

Query: 275 IRVLLSVDPFKRPNICQLIE 294
           I  +L VDP  R  I +++E
Sbjct: 299 IAKILIVDPAMRITIDEVLE 318

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 104/198 (52%), Gaps = 27/198 (13%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +R   +L E+E +H   Q+  GV+  H    ++ HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSF--NICHRDLKPE 243

Query: 164 NILIS-ENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT--TAQYRSPEMLDLTKG 220
           N+L+  +N + K+ DFG     +  P          + ++K +  +  Y SPE++ + + 
Sbjct: 244 NLLLDKKNKKIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIV-MGRP 290

Query: 221 YQINEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPAYPVYSDSLKNVIR 276
           Y     SD+W+ G+ LF L     PF  +  +K +LK Q   +Q P     S   +N+I 
Sbjct: 291 YH-GGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LSLEARNLIS 347

Query: 277 VLLSVDPFKRPNICQLIE 294
            +L +DP KR    +++E
Sbjct: 348 KILVIDPEKRITTQEILE 365

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 123/267 (46%), Gaps = 30/267 (11%)

Query: 26  KYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYV 85
           K +  G +  VY A         A  +  L+       + +  L  E+  L  LR+  YV
Sbjct: 19  KCVGRGNFGDVYKAVEIKSGKIVAIKVVNLEHT----NEDIELLSQEIFFLAELRSP-YV 73

Query: 86  VSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGV 145
             Y+ +     S       ++++MEYC GGS  D +    K  L E +   I  +V  G+
Sbjct: 74  TKYLTTLLEDVS-------IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGL 126

Query: 146 AQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT 205
             +HE +   IHRDIK  NIL++++G  K+ DFG V G I+          ++ D     
Sbjct: 127 RYLHEQKK--IHRDIKAANILLTDDGMVKLGDFG-VSGQIKAT--------LKKDTFVG- 174

Query: 206 TAQYRSPEMLDLTK-GYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPA- 263
           T  + +PE++   + GY  NEK+DIW+LG+ +++L     P  K     ++ S  +  A 
Sbjct: 175 TPYWMAPEVVKKDESGY--NEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAP 232

Query: 264 --YPVYSDSLKNVIRVLLSVDPFKRPN 288
             +  YS+  K+ I   L  DP  RPN
Sbjct: 233 KLHGHYSEDAKSFISHCLIKDPNARPN 259

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 110/229 (48%), Gaps = 27/229 (11%)

Query: 62  DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFL 121
           D   +  ++ E+  L  L+    +  Y  S+    S       ++++MEYC+GGSL   L
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTS-------LWIIMEYCAGGSLRSLL 111

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
                 ++ E+ I  IM ++ V +  +H  + ++IHRDIK  N+LI+  G  K+CDFG  
Sbjct: 112 R---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCY 241
             V +     + M           T  + +PE+  + +G   + K DIW+LG+  +++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
              P+ + E  +A   I+KS+        YS SLK  I + L  DP +R
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 102/200 (51%), Gaps = 33/200 (16%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           V++ +EYC G  L ++L    K  +  +E   + +Q+   V   H ++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LAKKHIPLEECSELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 ILISENGEYKVCDFGSV--CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KG 220
           IL+ + G  K+ DFG    C            K I   I   T   Y +PE+++    +G
Sbjct: 159 ILLDKKGHAKLTDFGFTRECAT----------KGILETICGTTV--YMAPELIERKPYEG 206

Query: 221 YQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAY-PVYSDSL-----KNV 274
           Y+I    D W+LG+ L+ + + T PF++  E   +K++++   Y P Y +       K +
Sbjct: 207 YKI----DTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNGKEL 259

Query: 275 IRVLLSVDPFKRPNICQLIE 294
           I  LL  DP +RP++ Q+++
Sbjct: 260 ISQLLEKDPNQRPSLTQVLQ 279

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 123/271 (45%), Gaps = 33/271 (12%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           +  G Y  VY A     D      +  +K VV  + + LN + AE+  LK L N   +V 
Sbjct: 31  IGRGSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVK 84

Query: 88  YIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQ 147
           Y       H     SYE+++L+EYC+ GSL   + +R    L E E    +TQ  +G+  
Sbjct: 85  Y-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKY 136

Query: 148 MHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +H     +IHRDIK  NIL+S +   K+ DFG V  ++               +    T 
Sbjct: 137 LH--GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTL 182

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYP-- 265
            + +PE+L   +G   +  SDIW+LG  + ++     P+    +  I  +      YP  
Sbjct: 183 NWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPS 239

Query: 266 VYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296
            +S+ LK+ +      + +KRP   QL++ +
Sbjct: 240 SFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 133/284 (46%), Gaps = 54/284 (19%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNK 82
           KI+  +  G + +VY A      + P      LK     DK   N +R      +V  ++
Sbjct: 39  KILDQIGEGSFGKVYLA-----QHRPTHTKVVLKS---SDKNDPNIVR------EVFYHR 84

Query: 83  KYVVSYIDSHASKHSGHTGSYEV-------FVLMEYCSGGSLIDFLNTRLKNRLREQEIL 135
           ++   YI          T  YEV       ++ +EYC G  L D + +   +R+   E +
Sbjct: 85  QFDYPYI----------TKLYEVIITETKVWMALEYCPGKELYDRVLSM--HRVPTDECV 132

Query: 136 HIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMK 195
            +  Q+  GV   H L  + +HRD+K+ENIL+ ++G+ K+ DFG          + E M 
Sbjct: 133 QLFAQIVGGVHYAHSL--NCVHRDLKLENILLDKSGDAKLTDFGF---------TRECMT 181

Query: 196 YIQHDIMKNTTAQYRSPEMLDLT--KGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE-K 252
               + +  TT  Y +PE+++     G++I    DIW+LGV L+ +   + PF+++ E K
Sbjct: 182 KTTLETICGTTV-YMAPELIERKSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETK 236

Query: 253 AILKSQFQYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
              K   Q P     + +   K++I  LL+ +P  RP + Q+++
Sbjct: 237 TEWKIVHQTPQLNENIVTADAKDLILRLLAKNPNDRPTVEQILK 280

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 98/188 (52%), Gaps = 23/188 (12%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +  K +L E+E +H   Q+  GV+  H    ++ HRD+K E
Sbjct: 210 ELYLVLEYVDGGELFDYLVS--KGKLSEKEAVHYFKQIIQGVSYCHSF--NICHRDLKPE 265

Query: 164 NILISE-NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
           N+L+ + N   K+ DFG     +  P      K +Q       +  Y SPE++ + K Y 
Sbjct: 266 NLLLDKKNKSIKIADFG--MAALELPN-----KLLQTSC---GSPHYASPEIV-MGKSYH 314

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPAYPVYSDSLKNVIRVL 278
               SD+W+ G+ LF L     PF  +  +K +LK Q   F+ P+    S   +++I  +
Sbjct: 315 -GGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPS--TLSPEAQDLISRI 371

Query: 279 LSVDPFKR 286
           L +DP KR
Sbjct: 372 LVIDPSKR 379

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 138/285 (48%), Gaps = 36/285 (12%)

Query: 24  IVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKK 83
           I + +  G +  VY A         A  +  L+       + +N L  E+  L  L++  
Sbjct: 19  IKQCVGRGNFGDVYKACEKVSGKVVAVKVVNLEHT----DEDINLLAQEIFFLAELKSP- 73

Query: 84  YVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAV 143
           Y+ +YI       +  T    ++++MEYC GGS  D L       L E +  +I  +V  
Sbjct: 74  YITNYI-------TTMTEDVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLK 126

Query: 144 GVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMK 203
           G+  +HE +   IHRDIK  NIL+++ G+ K+ DFG V G IR   + +   ++      
Sbjct: 127 GLEYLHEQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TLKRGTFV------ 175

Query: 204 NTTAQYRSPEMLDL-TKGYQINEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQY 261
             T  + +PE++   + GY  +EK+DIW+LG+ +++L   + P  K +  K ++    + 
Sbjct: 176 -GTPFWMAPEVVSKDSDGY--DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRK 232

Query: 262 PAYPV----YSDSLKNVIRVLLSVDPFKRPNICQLI--EELSRLQ 300
           P  PV    YS + K+ +   L  +P  RP+  +L+  E ++ LQ
Sbjct: 233 P--PVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 142/312 (45%), Gaps = 84/312 (26%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV--PDKKSL 66
           ++ D ++ VG++  +I+K +  G + +VY A   P            ++VV+   DK   
Sbjct: 30  FMSDELIEVGNY--RILKQIGEGSFGKVYLALHRPTH----------RKVVLKTSDKNDP 77

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYE-------VFVLMEYCSGGSLID 119
           N +R      +V  ++++   YI          T  YE       V++ +EYC G  L D
Sbjct: 78  NIVR------EVFYHRQFDYPYI----------TKVYEIIVTETKVWMALEYCPGKELYD 121

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
            L      R+   E   +  Q+   V   H L  + +HRD+K+ENIL+ ++G  K+ DFG
Sbjct: 122 HL--LFSKRIPIAECTELFAQIVGAVYYAHSL--NCVHRDLKLENILLDKHGRAKLTDFG 177

Query: 180 ------------SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KGYQINE 225
                       +VCG                      T  Y +PE+++     G++I  
Sbjct: 178 FTRECMTRSTLETVCG----------------------TTVYMAPELIERKSYDGFKI-- 213

Query: 226 KSDIWALGVFLFKLCYYTTPFEKEGE-KAILKSQFQYPAYP--VYSDSLKNVIRVLLSVD 282
             DIWALGV L+ + Y   PF+++ E K   K   + P +   + S+ +K++I+ LL  D
Sbjct: 214 --DIWALGVILYTMIYGAMPFDEDDEVKTKWKIVNEDPDFTNNISSNDVKDLIKKLLKKD 271

Query: 283 PFKRPNICQLIE 294
           P +RP I ++++
Sbjct: 272 PTERPTIREILK 283

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 97/188 (51%), Gaps = 23/188 (12%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +R   RL E+E +H   Q+  GV+  H    ++ HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAF--NICHRDLKPE 245

Query: 164 NILISE-NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
           N+L+ + N   K+ DFG     +         K +Q       +  Y SPE++ + K Y 
Sbjct: 246 NLLLDKKNSTIKIADFGMAALEV-------SNKLLQTSC---GSPHYASPEIV-MGKQYH 294

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPAYPVYSDSLKNVIRVL 278
               SD+W+ G+ LF L     PF  +  +K +LK Q   +Q P     S   +++I  +
Sbjct: 295 -GGPSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKI 351

Query: 279 LSVDPFKR 286
           L+V+P KR
Sbjct: 352 LTVNPAKR 359

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 123/283 (43%), Gaps = 69/283 (24%)

Query: 26  KYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSL------NALRAEVDALKVL 79
           K L  G + +VY      V + P+  I  LK +   +KK +         R EV+    L
Sbjct: 112 KILGKGKFGKVYC-----VRHIPSGFICALKAM---EKKEIIQYNIEKQFRREVEIQSSL 163

Query: 80  RNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMT 139
           R+      Y   H  K         V+++MEY   G L   L  R  N   ++   + + 
Sbjct: 164 RHPNLTQLYGYFHDEK--------RVYLVMEYLVNGELYKHLKGR--NHFSDEVASYYVY 213

Query: 140 QVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG------------SVCGVIRP 187
           Q+A  +  MHE   +++HRDIK ENI+I  N   K+ DFG            ++CG    
Sbjct: 214 QMAGALDYMHE--RNILHRDIKPENIIIGFNNVIKLTDFGWSVINSKGFKRKTLCG---- 267

Query: 188 PRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFE 247
                             T  Y SPE++   K  + +EK D+WALGV  ++L   + PFE
Sbjct: 268 ------------------TVDYLSPELI---KSREYDEKVDVWALGVLTYELLVGSPPFE 306

Query: 248 KEGE----KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
           +E +    K ILK    +P + +  D+ +++I  LL  DP  R
Sbjct: 307 EESKELTYKRILKRNLVFPDH-IDPDA-RHLISRLLEYDPANR 347

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 81/271 (29%), Positives = 119/271 (43%), Gaps = 39/271 (14%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLN---ALRAEVDALKVL 79
           +I K L  G + +VY      V +  +  +  LK +   D    N     R EV+    L
Sbjct: 110 EIGKVLGKGKFGRVYC-----VRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSL 164

Query: 80  RNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMT 139
           R+      Y   H  K         V++LMEY   G L   L  R  +   +    + + 
Sbjct: 165 RHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR--SHFNDVVASYYVY 214

Query: 140 QVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQH 199
           Q+A  +  MHE   +++HRDIK ENI+I  N   K+ DFG    VI P  S  +      
Sbjct: 215 QMADALDYMHER--NILHRDIKPENIIIGFNNTIKLTDFG--WSVITPKGSKRKTLC--- 267

Query: 200 DIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE----KAIL 255
                 T  Y SPE++   +  + NEK D+WALGV  ++L   + PFE+E +    K IL
Sbjct: 268 -----GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRIL 319

Query: 256 KSQFQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
           K    +P +       +++I  LL  DP  R
Sbjct: 320 KRNLIFPDH--VDTEARHLISRLLEYDPGDR 348

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 101/201 (50%), Gaps = 24/201 (11%)

Query: 101 GSY----EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLI 156
           GSY    +++V+MEYC+GGSL   L      ++ E+ +  I+ ++ + +  +H  + ++I
Sbjct: 89  GSYLYDTKLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRKLLIALVYIH--KDNVI 143

Query: 157 HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD 216
           HRDIK  N+LI+  G  K+CDFG    +       + M           T  + +PE+  
Sbjct: 144 HRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMA---------GTPYWMAPEV-- 192

Query: 217 LTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLK 272
           + +G   N K+DIW+LG+  +++     P+ + E  +A   I KS+        YS  LK
Sbjct: 193 IMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLK 252

Query: 273 NVIRVLLSVDPFKRPNICQLI 293
             I + L  DP +RP    L+
Sbjct: 253 EFIALCLDEDPEERPTAEDLL 273

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 98/193 (50%), Gaps = 18/193 (9%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           ++++MEYC GGS  D L     N L E+++  I+ QV +G+  +HE +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDL-TKGYQI 223
           IL++E G  K+ DFG V G +R          ++ D     T  + +PE++     GY  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 224 NEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPV---YSDSLKNVIRVLLS 280
           NEK+DIW+LG+  ++L     P  K     ++ +  +     +   +SD+ K  +   L 
Sbjct: 190 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAGCLV 249

Query: 281 VDPFKRPNICQLI 293
             P  RP+   L+
Sbjct: 250 KVPADRPSAYDLL 262

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 99/195 (50%), Gaps = 23/195 (11%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+F+++EY  GG L D+L +R   +L E+E +H   Q+  GV+  H    ++ HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSF--NICHRDLKPE 248

Query: 164 NILISEN-GEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
           N+L+ +     K+ DFG +  +  P +           +    +  Y SPE++ + K Y 
Sbjct: 249 NLLLDKKINTIKIADFG-MAALELPNKLL---------VTSCGSPHYASPEIV-MGKSYH 297

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPAYPVYSDSLKNVIRVL 278
               SD+W+ G+ LF L     PF  +  +K +LK Q   FQ P     S   +++I  +
Sbjct: 298 -GSPSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQN--ISLEAEDLISRI 354

Query: 279 LSVDPFKRPNICQLI 293
           L VDP KR  I  ++
Sbjct: 355 LVVDPEKRIQINDIL 369

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 98/195 (50%), Gaps = 20/195 (10%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           ++++MEYC+GGS+   L      ++ E+ I  IM ++ V +  +H  + ++IHRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELLVALHYIH--KDNVIHRDIKAAN 168

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQIN 224
           +LI+  G  K+CDFG    + +     + M           T  + +PE+  + +G   +
Sbjct: 169 LLITNEGNVKLCDFGVAAQLNQNTMRRQTMA---------GTPYWMAPEV--IMEGISYD 217

Query: 225 EKSDIWALGVFLFKLCYYTTPF-EKEGEKAILKSQFQYPAY---PVYSDSLKNVIRVLLS 280
            K+DIW++G+  +++     PF E E  +A+       PA      +   LK  I + L 
Sbjct: 218 TKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLD 277

Query: 281 VDPFKRPNICQLIEE 295
            DP +RP   +L+ E
Sbjct: 278 EDPQERPTADKLLHE 292

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 97/194 (50%), Gaps = 20/194 (10%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           +++V+MEYC+GGSL   L      ++ E+ +  I+  + V +  +H  + ++IHRDIK  
Sbjct: 94  KLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRNLLVALLYIH--KDNVIHRDIKAA 148

Query: 164 NILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQI 223
           N+LI+  G  K+CDFG    +       + M           T  + +PE+  + +G   
Sbjct: 149 NVLITNGGHVKLCDFGVAAQLTTANHKRQTMA---------GTPYWMAPEV--IMEGVYY 197

Query: 224 NEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLKNVIRVLL 279
           N K+DIW+LG+  +++     P+ + E  +A   I KS+        YS  LK  I + L
Sbjct: 198 NTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCL 257

Query: 280 SVDPFKRPNICQLI 293
             DP  RP   +L+
Sbjct: 258 DEDPEARPTAEELL 271

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 98/194 (50%), Gaps = 19/194 (9%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+F+++EY  GG L D+L +  K +L EQE +H   Q+  GVA  H    ++ HRD+K E
Sbjct: 144 ELFLVLEYVEGGELFDYLVS--KGKLPEQEAVHYFRQIIQGVAYCHNY--NICHRDLKPE 199

Query: 164 NILISE-NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQ 222
           N+L+ + N + K+ DFG     +       E            +  Y SPE++ + K Y 
Sbjct: 200 NLLVDKKNHQIKIADFG--MAALETTNKLLETSC--------GSPHYASPEIV-MGKNYH 248

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQF-QYPAYPVYSDSLKNVIRVLLS 280
               SD+W+ G+ LF L     PF  +  +K +LK Q  +Y      S   +++I  +L 
Sbjct: 249 -GSPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKYHMPQNISSEAQDLISKILI 307

Query: 281 VDPFKRPNICQLIE 294
           VDP  R  I ++++
Sbjct: 308 VDPRGRITINEVLQ 321

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 106/224 (47%), Gaps = 32/224 (14%)

Query: 99  HTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHR 158
           HT S   ++L EY SGG L+D++       L+E        Q+   +  +H    +++HR
Sbjct: 169 HTLSNHFYMLFEYVSGGQLLDYIIQH--GSLKESRARTFTRQICSALKYLHSH--NIVHR 224

Query: 159 DIKIENILISENGEYKVCDFG-----SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPE 213
           D+KIENI+IS++G  K+ DFG       C  +   ++Y    Y            + +PE
Sbjct: 225 DLKIENIMISKDGNIKLIDFGLSNLYDKCNKL---KTYCGSLY------------FAAPE 269

Query: 214 MLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSD 269
           +L  T    I  + D+W+ GV L+ L     PF+ E      + I + +  YP +   S 
Sbjct: 270 LLKATP--YIGPEIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIKQGKVFYPQF--LSI 325

Query: 270 SLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSR 313
            + +++  +L VDPFKR  + Q++     ++    P K++   R
Sbjct: 326 EVISLLSKMLVVDPFKRATLDQVMNHHWMVRDCDGPPKSYIPDR 369

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 99/195 (50%), Gaps = 23/195 (11%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           V++ +EYC G  L D+L   LK R+   E   +  Q+   V   H LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEML--DLTKGYQ 222
           IL+ +NG   + DFG          + E     Q + +  TT  Y +PE++  +   GY+
Sbjct: 159 ILLDKNGYAMLTDFGF---------TRECATKTQLETVCGTTV-YMAPELIKREAYDGYK 208

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEGE-KAILKSQFQYPAY--PVYSDSLKNVIRVLL 279
           +    D W+LG+ L+ + +   PF+++   +  LK   + PA      S   K++I  LL
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 280 SVDPFKRPNICQLIE 294
             +  +RPN+ ++++
Sbjct: 265 DKNAAQRPNLNEVLQ 279

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 123/271 (45%), Gaps = 31/271 (11%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           +  G +  VY  Y     +  A  +  L      D+  +  ++ E+  L  L+    +  
Sbjct: 41  IGRGKFGVVYKGYHLNTKHVYAIKVLNLDS----DEDEVEDVQKEIQFLASLKQLPNITR 96

Query: 88  YIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQ 147
           Y  S+    S       ++++MEYC GGSL   L      ++ E+ I  IM ++ + +  
Sbjct: 97  YYGSYLKNTS-------LWIIMEYCGGGSLRSLLR---PGKIDEKYIGVIMREILIALKY 146

Query: 148 MHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +H  + ++IHRDIK  N+LI+ +G  K+CDFG    + +     + M           T 
Sbjct: 147 IH--KDNVIHRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTMA---------GTP 195

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQFQYPA 263
            + +PE+  + +G   + K+DIW+ G+  +++     P+ + E  +A   I KS+     
Sbjct: 196 YWMAPEV--IMEGVYYDTKADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLE 253

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
              YS  +K  I   L  DP +RP   +L++
Sbjct: 254 GRNYSALIKEFIATCLDEDPSERPTADELLK 284

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 99/197 (50%), Gaps = 27/197 (13%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +R K  L E+E +H   Q+  GVA  H    ++ HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSRGK--LPEREAVHYFKQIIQGVAYCHAF--NICHRDLKPE 228

Query: 164 NILIS-ENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA---QYRSPEMLDLTK 219
           N+L+  +N   K+ DFG     +              D + +T+     Y SPE++ + K
Sbjct: 229 NLLLDKKNKIIKIADFGMAALEVS-------------DKLLSTSCGSPHYASPEIV-MGK 274

Query: 220 GYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSD---SLKNVIR 276
            Y     +D+W+ G+ LF L     PF  +  K +L  + Q   Y + SD     K++I 
Sbjct: 275 SYH-GSPTDVWSCGIILFALLTGHLPFNHDNIKKLLL-KVQSGVYHMPSDLSPDAKDLIS 332

Query: 277 VLLSVDPFKRPNICQLI 293
            +L VDP KR    +++
Sbjct: 333 KILVVDPDKRLTTTEIL 349

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 119/258 (46%), Gaps = 46/258 (17%)

Query: 52  IACLKRVVVPDKKS--LNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLM 109
           I  ++R  + +KK   L   R E++ALK+L +   V        SK+ G        +++
Sbjct: 91  IKLIRRDTLAEKKDQELKVYR-EINALKLLSHPNIVKLEDVLQNSKYIG--------IVL 141

Query: 110 EYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISE 169
           EY SGG    +L  + K RL+E        Q+  GVA +H     L+HRD+K+EN+L+ +
Sbjct: 142 EYASGGEFYKYL--QRKKRLKEPLACSTFAQLISGVAYIHS--KGLVHRDLKLENLLLDK 197

Query: 170 NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQINEKS 227
           +    + DFG V  +              + +MK       Y +PE++  TK Y    K+
Sbjct: 198 HSNLVITDFGFVNEI-----------STNNKLMKTPCGSPCYAAPELVLSTKPYDA-RKA 245

Query: 228 DIWALGVFLFKLCYYTTPFEKEGEKA-----------ILKSQFQYPAY--PVYSDSLKNV 274
           DIW+ GV L+ +     P++ + E             I K+  ++P Y  P+  D    +
Sbjct: 246 DIWSAGVILYAMLAGYLPWDDDPENPDGSNIMRLYEYITKNNLKFPDYIEPLARD----L 301

Query: 275 IRVLLSVDPFKRPNICQL 292
           IR +L + P  R NI Q+
Sbjct: 302 IRKILVIQPKSRLNIVQV 319

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 113/236 (47%), Gaps = 30/236 (12%)

Query: 66   LNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRL 125
            + ALR+EV  LK L +   +V Y+    +K+S ++      + +EY +GGS+   +  RL
Sbjct: 1221 VEALRSEVSTLKNL-DHLNIVQYL-GFENKNSIYS------LFLEYVAGGSVGSLI--RL 1270

Query: 126  KNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVI 185
              R  E  I  +  QV  G++ +H     ++HRD+K +N+L+  +G  K+ DFG      
Sbjct: 1271 YGRFDESLIRFLTVQVLRGLSYLHSR--GILHRDMKADNLLLDLDGVCKISDFGIS---- 1324

Query: 186  RPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTP 245
               R   ++ Y   D+    T  + +PEM+D  +GY  + K DIW+LG  + ++     P
Sbjct: 1325 ---RKSNDI-YCNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRP 1378

Query: 246  FEK-EGEKAILKSQFQYPAYPVYSDSL-------KNVIRVLLSVDPFKRPNICQLI 293
            +   E   A+ K      A P+  D+L       +  +     +DP +RP    L+
Sbjct: 1379 WSNLEVVAAMFKIGKSKTAPPIPEDTLPLISKEGREFLDACFEIDPERRPTADTLL 1434

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 129/271 (47%), Gaps = 28/271 (10%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           L  G Y+ V  A  T +D      +  L +  +  +K +  +  E +AL+ + N K +V 
Sbjct: 185 LGDGAYSTVMLA--TSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLK-NRLREQEILHIMTQVAVGVA 146
              +   + S       ++ L+EYC  G   DFL+   K   L E    +   QV   + 
Sbjct: 243 LFFTFQDESS-------LYFLLEYCPNG---DFLSLMKKYGSLNETVACYYSAQVIDAID 292

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTT 206
            +H     +IHRDIK ENIL+ +  + K+ DFG+    I    +  +   +        T
Sbjct: 293 YLH--TNGIIHRDIKPENILLDKEFKIKLTDFGT--AKILDSSTNNKFDLLTRSKSFVGT 348

Query: 207 AQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE----KAILKSQFQYP 262
           A+Y +PE+L+ +    ++ + D+WA G  L+++     PF+   E    + ++K Q+ + 
Sbjct: 349 AEYVAPELLNDS---FVDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFT 405

Query: 263 A-YPVYSDSLKNVIRVLLSVDPFKRPNICQL 292
           A +P+    ++++++ +L  D  +RP+I Q+
Sbjct: 406 AGFPLI---IRDLVKKILVKDLNQRPSISQI 433

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 121/268 (45%), Gaps = 31/268 (11%)

Query: 23  KIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNK 82
           K  + +  G +  VY  Y        A  +  L      D   +  ++ E+  L  L+  
Sbjct: 24  KRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDS----DSDEVEDVQREIQFLASLKQI 79

Query: 83  KYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVA 142
             +  Y  S+    S       ++++ME+C+GGSL   L      ++ E+ I  IM ++ 
Sbjct: 80  SNITRYYGSYLKDTS-------LWIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELL 129

Query: 143 VGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIM 202
           V +  +H  + ++IHRDIK  N+LI+  G  K+CDFG    V +     + M        
Sbjct: 130 VALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA------- 180

Query: 203 KNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQ 258
              T  + +PE+  + +G   + K DIW+LG+  +++     P+ + E  +A   I+KS+
Sbjct: 181 --GTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSK 236

Query: 259 FQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
                   YS SLK  I + L  DP +R
Sbjct: 237 PPRLEDRSYSTSLKEFIALCLDEDPKER 264

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 107/236 (45%), Gaps = 30/236 (12%)

Query: 66   LNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRL 125
            L AL++EV  LK L +   +V Y+      H      Y +F  +EY +GGS+   +  RL
Sbjct: 1193 LEALKSEVSTLKDL-DHVNIVQYLGFENKNHV-----YSLF--LEYVAGGSVGSLI--RL 1242

Query: 126  KNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVI 185
              R  E  I  +  QV  G+A +H     ++HRD+K +N+L+  +G  K+ DFG      
Sbjct: 1243 FGRFDEDLIRFLAVQVLRGLAYLH--SKGILHRDMKADNLLLDVDGICKISDFGI----- 1295

Query: 186  RPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTP 245
                      Y   D+    T  + +PEM+D  +GY  + K DIW+LG  + ++     P
Sbjct: 1296 ---SKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRP 1350

Query: 246  FEK-EGEKAILKSQFQYPAYPVYSDS-------LKNVIRVLLSVDPFKRPNICQLI 293
            +   E   A+ K      A P+  D+        K+ +     +DP KRP    L+
Sbjct: 1351 WSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLL 1406

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 133/300 (44%), Gaps = 61/300 (20%)

Query: 55  LKRVVVP--DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYC 112
           +++++ P  D +S++    E+D  +  ++  Y++  +DS   +     GS  V +L+ Y 
Sbjct: 88  VRQIMCPFGDIESVSNALKEIDNYRYFKSP-YIMQCLDSQVIQR--RDGSKTVLILLPYL 144

Query: 113 SGGSLIDFLNTRLKN--RLREQEILHIMTQVAVGVAQMHE----------LQP------- 153
             GSL D ++  L +  R+ E E++ +M     G+  +H+          + P       
Sbjct: 145 PLGSLRDAIDRNLLDGIRMSESEVIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAV 204

Query: 154 ------------------------------SLIHRDIKIENILISENGEYKVCDFGSVCG 183
                                         S  H +IK  NIL S +G   + + GS+  
Sbjct: 205 SMTLSDDAAMLLDGTPFEMDMLSSHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQK 264

Query: 184 VIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYT 243
           +     + + +K I+    ++ T  Y  PE+L+L  G  ++   DIW+LG  L+ L +  
Sbjct: 265 LDLKIENVKMLKSIKEWTEEHCTVYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGI 324

Query: 244 TPFEKEGE-------KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296
           +PF++E +         I K+++ +P   VYS  L +VI   L V+P  RP + +L+ +L
Sbjct: 325 SPFKREEQVNEVPLKYGISKARYSFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQL 384

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 126/288 (43%), Gaps = 31/288 (10%)

Query: 15  VTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVD 74
           V VG  + + ++ L  G   +V+       +   A  +   + ++   +K +  +  E +
Sbjct: 429 VKVGPQSFEKIRMLGQGDVGKVFLVREKETNRLYALKVFTKREMI--KRKKVQRILTEQE 486

Query: 75  ALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEI 134
            L    N  +VV+        HS  T  Y V++ MEYC GG     L TR    + E + 
Sbjct: 487 IL-ATSNHPFVVTLY------HSFQTEDY-VYLCMEYCMGGEFFRALQTRKAKSISEDDA 538

Query: 135 LHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG---SVCGVIRPPR-- 189
               ++V   +  +H L    I+RD+K ENIL+ ++G   + DF          +P +  
Sbjct: 539 RFYASEVTAALEYLHLL--GFIYRDLKPENILLHKSGHIMLSDFDLSVQANDAAKPVKRV 596

Query: 190 ----SYEEMKYIQHDIMKNT---TAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYY 242
               S  + K        N+   T +Y +PE++   +G       D W LG+ ++++ + 
Sbjct: 597 ATQSSMVDTKVFSEGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTLGILIYEMLFG 653

Query: 243 TTPFEKEGEKA----ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
            TPF+ E        ILK++  +P +   S   K++IR LLS +  KR
Sbjct: 654 CTPFKGENTNETFCNILKNEVTFPEHHEISRHCKDLIRKLLSKNESKR 701

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 107/218 (49%), Gaps = 22/218 (10%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE         +A  +  +H    +++HRD
Sbjct: 234 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLREHHARKFARGIASALQYLHAN--NIVHRD 289

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTK 219
           +KIENI+IS +GE K+ DFG +  +  P       +   H      +  + +PE+L  + 
Sbjct: 290 LKIENIMISTSGEIKIIDFG-LSNMFDP-------RTQLHTFC--GSLYFAAPELLKASP 339

Query: 220 GYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSLKNVI 275
              +  + D+W+ GV L+ L     PF+ E      + I + +  YP +   S  + +++
Sbjct: 340 --YVGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQH--LSIEVISLL 395

Query: 276 RVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSR 313
             +L VDP KR ++ Q++E    ++G   P  ++  +R
Sbjct: 396 SKMLVVDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNR 433

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 99/202 (49%), Gaps = 30/202 (14%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE+        +A  +  +H    +++HRD
Sbjct: 3   TMSNHFYMLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLH--MNNIVHRD 58

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYE----EMKYIQHDIMKNTTAQYRSPEML 215
           +KIENI+IS +GE K+ DFG +  +  P +        + +   +++K     Y  PE+ 
Sbjct: 59  LKIENIMISTSGEIKIIDFG-LSNMYNPKKQLHTFCGSLYFAAPELLK--ACPYTGPEV- 114

Query: 216 DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSL 271
                       D+W+ GV LF L     PF+ E      + I + + +YP +   S  +
Sbjct: 115 ------------DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEV 160

Query: 272 KNVIRVLLSVDPFKRPNICQLI 293
            +++  +L VDP KR ++ Q++
Sbjct: 161 ISLLSKMLVVDPTKRASLKQVV 182

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 146/301 (48%), Gaps = 62/301 (20%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPD--KKSL 66
           +    +  VG++  KI++ +  G + +VY A   P            ++VV+    K   
Sbjct: 35  FCSSDLTVVGNY--KILEQIGEGSFGKVYLAMHRPTH----------RKVVIKSSVKNDP 82

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYE-------VFVLMEYCSGGSLID 119
           N +R      +V  ++++   YI          T  YE       V++ +EYC G  L D
Sbjct: 83  NIVR------EVFYHRQFEYHYI----------TKLYEIIVTESKVWMALEYCPGRELYD 126

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
            +  ++K R+  +E + + +Q+   V   H L  + +HRD+K+ENIL+ ++G  K+ DFG
Sbjct: 127 HV-LQMK-RIPAEECIQLFSQIVGAVYYAHSL--NCVHRDLKLENILLDKDGNAKLTDFG 182

Query: 180 SVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT--KGYQINEKSDIWALGVFLF 237
                     + E M+ +  + +  TT  Y +PE+ +     G++I    DIW+LGV L+
Sbjct: 183 F---------TRECMEKVNLETICGTTV-YMAPELTERKPYDGFKI----DIWSLGVILY 228

Query: 238 KLCYYTTPFEKEGEK----AILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
            +   + PF+++ E      I+  + +Y +  + ++  ++++R LL  D   RP++ +++
Sbjct: 229 TMLSGSMPFDEDDEAKTKWKIINEEPEYNSKFMTAEG-EDLVRKLLQKDSNLRPSVREIL 287

Query: 294 E 294
           +
Sbjct: 288 Q 288

>Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {ON}
           complement(67104..68684) [1581 nt, 527 aa]
          Length = 526

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 120/254 (47%), Gaps = 42/254 (16%)

Query: 64  KSLNALRAEVDALK-VLR----NKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSL- 117
           K++N L  + +  K + R    NK +   YI  +    +  + S  +F+ MEY  G SL 
Sbjct: 265 KTINTLNTDPEYQKQIFRELQFNKSFKSDYIVRYYGMFTDESNS-SIFIAMEYMGGRSLD 323

Query: 118 ---IDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYK 174
              ++ LN  L  R+ E+ +  I   V  G++ +HE +  +IHRDIK +NIL++E G+ K
Sbjct: 324 AIYLNLLN--LGGRIGEKVLGKIAESVLRGLSYLHERK--VIHRDIKPQNILLNEKGQVK 379

Query: 175 VCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGV 234
           +CDFG V G        E +  +        T+ Y +PE +   +G   +   D+W+LG+
Sbjct: 380 LCDFG-VSG--------EAVNSLATTFTG--TSFYMAPERI---QGQPYSVTCDVWSLGL 425

Query: 235 FLFKLCYYTTPFEKEGEKA----------ILKSQFQYPAYP----VYSDSLKNVIRVLLS 280
            L ++     PF  +   A          IL    Q    P    V+S S K+ I   L 
Sbjct: 426 TLLEVAQAKFPFGSDKMTATIAPIELLMLILTFSPQLKDEPELNIVWSKSFKSFIEYCLK 485

Query: 281 VDPFKRPNICQLIE 294
            DP +RP+  Q+I+
Sbjct: 486 KDPSERPSPRQMIQ 499

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 129/279 (46%), Gaps = 37/279 (13%)

Query: 23  KIVKYLASGGYAQVYSAYVTP---VDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVL 79
           K  K +  G +  VY  +      V      N+ C       D   +  ++ E+  L +L
Sbjct: 7   KRTKVIGKGKFGTVYKGHSIKSKKVFAIKVLNLDC-------DINEIQDIQNEIKFLSLL 59

Query: 80  RNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMT 139
           R    +  Y  S+           +++++MEYC+GGS+ + +      R  E  I  I+ 
Sbjct: 60  RYAPNITYYYHSYLINR-------KIWIIMEYCNGGSVRNLIKI---GRFNEIYISVILR 109

Query: 140 QVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQH 199
           ++   +  +H    ++IHRDIK  NILI++NG  K+CDFG    +        E    + 
Sbjct: 110 ELLYALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAAKL--------EFSKPKR 159

Query: 200 DIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKAI-LKS 257
             M   T  + +PE++  +  Y  + K+DIW++G+  +++     P+ E +  KA+ L +
Sbjct: 160 QTMAG-TPYWMAPEVIIESSLY--DTKADIWSVGITAYEITTGNPPYCEYDATKAMQLIT 216

Query: 258 QFQYPAYP--VYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
           + + P     +YS SLK  I + L  DP +R    +L+E
Sbjct: 217 KLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLE 255

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 125/281 (44%), Gaps = 50/281 (17%)

Query: 28  LASGGYAQVYSAYVTPV------DYSPATNIACLKRVVVPDKKSLNA-LRAEVDALKVLR 80
           L  GG+ +V   + TP+      D      I  +KR  + + KS    +  E++ALK L 
Sbjct: 48  LGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSISNDKSKEVKIYREINALKQLH 107

Query: 81  NKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQ 140
           +   V        SK+ G        +++EY SGG    ++  R    L+E     +  Q
Sbjct: 108 HPNIVKLEEVLQNSKYIG--------IVLEYASGGEFYKYIQKR--RVLKEHVACRLFAQ 157

Query: 141 VAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHD 200
           +  GV  +H     L+HRD+K+EN+L+ ++    + DFG V              + Q++
Sbjct: 158 LISGVHYIHSK--GLVHRDLKLENLLLDKHENLIITDFGFV-----------NEYFSQNE 204

Query: 201 IMKNTTAQ--YRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKA----- 253
           +M  +     Y +PE++  T+ YQ   ++D+W+ G+ LF +     P++ + +       
Sbjct: 205 LMTTSCGSPCYAAPELVISTQPYQ-GRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDI 263

Query: 254 ------ILKSQFQYPAY--PVYSDSLKNVIRVLLSVDPFKR 286
                 I  +  ++P Y  P+  D    ++R +L  DP +R
Sbjct: 264 AKLYYYITHTALKFPEYITPIPRD----LLRRILVADPRRR 300

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 132/287 (45%), Gaps = 39/287 (13%)

Query: 14  VVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA---LR 70
           +V +  +  +I + L  G + +VY      V + P+  I  LK +   +  + N     +
Sbjct: 110 MVDLKLNDFEIGRKLGKGKFGKVYC-----VRHKPSGLICALKVMNKMEIVNFNVQKQFK 164

Query: 71  AEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLR 130
            E+D    L +K     Y   H SK+        V+++MEY  GG L   L  +    + 
Sbjct: 165 REIDIQYHLNHKNLTKLYAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMN 214

Query: 131 EQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRS 190
           +    + + Q+   +  MH+ +  +IHRD+K ENILI  N + K+ DFG     I  P +
Sbjct: 215 DITASNYVYQMTDALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNN 269

Query: 191 YEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG 250
            +             T  Y SPE++      + +E  D+WALG+  ++L     PFE++ 
Sbjct: 270 QKRKTLC-------GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDT 319

Query: 251 E----KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLI 293
           +    K I KS  ++P  P  S   +++I  LL V P +R N+ Q++
Sbjct: 320 KEQTYKRIAKSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 100/194 (51%), Gaps = 24/194 (12%)

Query: 101 GSY----EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLI 156
           GSY     ++++M+YC+GGS+   L      ++ E+ I  IM ++ + +  +H  + ++I
Sbjct: 110 GSYLKDTNLWIIMDYCAGGSIRTLLR---PGKIDEKYIGIIMREILIALQYIH--KDNVI 164

Query: 157 HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD 216
           HRDIK  N+L++  G+ K+CDFG    + +     + M           T  + +PE+  
Sbjct: 165 HRDIKAANVLVTNEGKVKLCDFGVAAQLNQTKLRRQTMA---------GTPYWMAPEV-- 213

Query: 217 LTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLK 272
           + +G   + K+DIW+LG+  +++     P+ E E  +A   I KS+        YS SLK
Sbjct: 214 IMEGAYYDTKADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRSYSTSLK 273

Query: 273 NVIRVLLSVDPFKR 286
             I + L  DP +R
Sbjct: 274 EFIALCLDEDPKER 287

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 100/190 (52%), Gaps = 27/190 (14%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +  K +L E+E +H   Q+  GV+  H    ++ HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVS--KGKLPEREAIHYFKQIVEGVSYCHSF--NICHRDLKPE 243

Query: 164 NILISE-NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT--TAQYRSPEMLDLTKG 220
           N+L+ + N   K+ DFG     +  P          + ++K +  +  Y SPE++ + + 
Sbjct: 244 NLLLDKKNRRIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIV-MGRP 290

Query: 221 YQINEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPAYPVYSDSLKNVIR 276
           Y     SD+W+ G+ LF L     PF  +  +K +LK Q   +Q P+    S   +++I 
Sbjct: 291 YH-GGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN--LSSEARDLIS 347

Query: 277 VLLSVDPFKR 286
            +L +DP KR
Sbjct: 348 KILVIDPEKR 357

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 100/200 (50%), Gaps = 35/200 (17%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           + +++EY SGG    ++  + K RL+E     +  Q+  GV  MH    +L+HRD+K+EN
Sbjct: 128 IGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMH--SKNLVHRDLKLEN 183

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQ 222
           +L+ +N    + DFG V   + P   Y          MK +     Y +PE++  T+ Y 
Sbjct: 184 LLLDKNENLVITDFGFVNEFL-PDNEY----------MKTSCGSPCYAAPELVISTRPY- 231

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEK-----EGE------KAILKSQFQYPAY--PVYSD 269
           +  K+D+W+ G+ L+ +     P++      EG+      + I ++  ++P Y  P+  D
Sbjct: 232 VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEYITPIPRD 291

Query: 270 SLKNVIRVLLSVDPFKRPNI 289
               ++R +L  DP KR N+
Sbjct: 292 ----LLRKILVPDPNKRVNM 307

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 9/159 (5%)

Query: 154 SLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPE 213
           S  HR+IK  NIL S +G   + D  S        ++ +++   +  I    +  + SPE
Sbjct: 248 SYAHRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEWIDSCCSVPFMSPE 307

Query: 214 MLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE-------KAILKSQFQYP--AY 264
           +LDL  G +I+EK DIW+LG  ++ +    +PFE+E +         IL + F +P    
Sbjct: 308 LLDLKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGME 367

Query: 265 PVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIV 303
              S  L + I+  L VDP KRP I QL+ +L  LQ  V
Sbjct: 368 RHASRELIDTIKQCLQVDPTKRPTINQLLNDLQALQSTV 406

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 136/310 (43%), Gaps = 44/310 (14%)

Query: 12  DTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIAC-LKRVVVPDKKSLNALR 70
           D  +  G++  K V  +  G Y  VY A          TN  C +K++   D+  LN   
Sbjct: 2   DNSIAHGTYALKQV--IGRGAYGVVYRAV------KRGTNKPCAIKQIEFEDESELNEHM 53

Query: 71  AEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLR 130
            E+D LK LR++  +V Y       H       E+++++EYC+ GSL D L       L 
Sbjct: 54  LEIDLLKNLRHQN-IVEYRGFIQKAH-------ELYIILEYCARGSLRDILK---HGPLL 102

Query: 131 EQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRS 190
           E + ++ +TQ   G+  +HE    +IHRDIK  N+L++E G  K+ DFG    + R   +
Sbjct: 103 EDDTVNYVTQTLYGLQYLHE--QGVIHRDIKAANLLLTEEGIVKLADFGVSTRINRMAMT 160

Query: 191 YEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFE--- 247
           Y              +  + +PE++    G   +  SDIW+LG  + +L     PF    
Sbjct: 161 YA------------GSPNWMAPEVM---TGQGASTVSDIWSLGATVVELLTGNPPFHNLV 205

Query: 248 -KEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPM 306
            +    AI+  ++  P     S   K+ +      + FKR    +L+  +  L+ I  P 
Sbjct: 206 NESACYAIVNEEYIPPL--TLSAECKDFLSRCFQKNMFKRATAQELLAHI-WLKKIQKPK 262

Query: 307 KNFYLSRALE 316
               L+  +E
Sbjct: 263 SKINLAEYIE 272

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 110/238 (46%), Gaps = 46/238 (19%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE         +A  +  +H    +++HRD
Sbjct: 172 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLREHHARKFTRGIASALQYLHA--NNIVHRD 227

Query: 160 IKIENILISENGEYKVCDFG------------SVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +KIENI+IS +GE K+ DFG            + CG          + +   +++K   +
Sbjct: 228 LKIENIMISTSGEIKIIDFGLSNLFDKSKQLHTFCG---------SLYFAAPELLK--AS 276

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPA 263
            Y  PE+             D+W+ GV L+ L     PF+ E      + I + + +YP 
Sbjct: 277 PYTGPEV-------------DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQ 323

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLM 321
           +   S  + +++  +L VDP +R ++ Q++E    ++G   P  ++  +R   T  ++
Sbjct: 324 H--LSIEVISLLSKMLVVDPHRRASLKQVVEHHWMVRGYDGPPPSYVPNRIPLTPEML 379

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 118/245 (48%), Gaps = 54/245 (22%)

Query: 75  ALKVLR-------NKKYVVSYIDSHASKHSGHTG----------SYEVFVLMEYCSGGSL 117
           A+K++R       ++K V  Y + +A KH  H            S  + +++EY SGG  
Sbjct: 72  AIKLIRRDSIPKNSEKEVKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEF 131

Query: 118 IDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCD 177
             ++  + K RL+E     +  Q+  GV  MH     L+HRD+K+EN+L+ ++    + D
Sbjct: 132 YKYI--QRKRRLKEAIACRLFAQLVSGVNYMHSK--GLVHRDLKLENLLLDKHENLVITD 187

Query: 178 FGSVCGVIRPPRSYEEMKYIQH-DIMKNTTAQ--YRSPEMLDLTKGYQINEKSDIWALGV 234
           FG V             +++ H ++MK +     Y +PE++  TK Y+   KSD+W+ GV
Sbjct: 188 FGFVN------------EFVSHNELMKTSCGSPCYAAPELVVSTKPYEA-RKSDVWSCGV 234

Query: 235 FLFKLCYYTTPFEKEGEKA-----------ILKSQFQYPAY--PVYSDSLKNVIRVLLSV 281
            L+ +     P++ + +             I ++  ++P Y  P+  D L+   R+L+S 
Sbjct: 235 ILYAMLAGYLPWDDDPKNPDGNDIVRLYYYITRTPLKFPEYITPLSRDLLR---RILVS- 290

Query: 282 DPFKR 286
           DP KR
Sbjct: 291 DPKKR 295

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 104/202 (51%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLI 156
           GSY     ++++MEYC+GGSL   L      ++ E+ I  IM ++ V +  +H  + ++I
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKVIH--KDNVI 134

Query: 157 HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD 216
           HRDIK  N+LI+  G+ K+CDFG    + +     + M           T  + +PE+  
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV-- 183

Query: 217 LTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLK 272
           + +G   + K DIW+LG+  +++     P+ + E  +A   I+KS+        Y+  LK
Sbjct: 184 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLK 243

Query: 273 NVIRVLLSVDPFKRPNICQLIE 294
             I + L  DP +R +  +L++
Sbjct: 244 EFIALCLDEDPQERLSAEELLK 265

>Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W
           (REAL)
          Length = 900

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 143/325 (44%), Gaps = 57/325 (17%)

Query: 2   NQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVP 61
           N+DQ      + + + G++TA+  K +  G +A VY  ++T  D S    I  + R  + 
Sbjct: 12  NRDQTTSVNHNLMTSAGNYTAE--KEIGKGSFATVYRGHLTS-DKSQHIAIKEVSRAKLK 68

Query: 62  DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFL 121
           +KK L  L  E+  LK +++  ++V  ID   +       S + +++MEYC+ G L   L
Sbjct: 69  NKKLLENLEIEIAILKKIKHP-HIVGLIDCERT-------STDFYLIMEYCALGDLTFLL 120

Query: 122 NTR---------LK-------------NRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
             R         LK             N L    +L  + Q+A  +  +     +L+HRD
Sbjct: 121 KRRKELMENHPLLKTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLR--SKNLVHRD 178

Query: 160 IKIENILISE-----NGEYKVCDFGSVCGVIRPP----RSYEEMKYIQHDIMKNTTAQ-- 208
           IK +N+L+S      +      + G V G+   P      +   +++ +  +  T     
Sbjct: 179 IKPQNLLLSTPLIGYHDSKTFHELGFV-GIYNLPILKIADFGFARFLPNTSLAETLCGSP 237

Query: 209 -YRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK------SQFQY 261
            Y +PE+L+  K    N K+D+W++G  +F++C  T PF       + K          +
Sbjct: 238 LYMAPEILNYQK---YNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITF 294

Query: 262 PAYPVYSDSLKNVIRVLLSVDPFKR 286
           P+Y      LK +I  LL+ DP KR
Sbjct: 295 PSYCNIEPELKELICSLLTFDPAKR 319

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 117/245 (47%), Gaps = 31/245 (12%)

Query: 62  DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFL 121
           D+  +  ++ EV  L  L+    +  Y  S+    S       ++++MEYC+GGSL   L
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTS-------LWIIMEYCAGGSLRSLL 125

Query: 122 NTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSV 181
                 ++ E+ I  IM ++ V +  +H  + ++IHRDIK  N+LI+  G  K+CDFG  
Sbjct: 126 R---PGKIDEKYIGVIMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 180

Query: 182 CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCY 241
             + +     + M           T  + +PE+  + +G   + K DIW+LG+  +++  
Sbjct: 181 AQLNQSTLRRQTMA---------GTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIAT 229

Query: 242 YTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELS 297
              P+ E E  +A   I KS+        Y+  LK  I + L  DP +R +     EELS
Sbjct: 230 GNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKERLS----AEELS 285

Query: 298 RLQGI 302
           + + I
Sbjct: 286 KTKFI 290

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 99/200 (49%), Gaps = 31/200 (15%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +  K +L E E +H   Q+   VA  H    ++ HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVS--KGKLPESEAIHYFKQIVQAVAYCHGF--NICHRDLKPE 203

Query: 164 NILISENGE-YKVCDFGSVCGVIRPPRSYEEMKYIQ-HDIMKNTTA---QYRSPEMLDLT 218
           N+L+ +     K+ DFG              M  ++  D +  T+     Y SPE++ L 
Sbjct: 204 NLLLDKKKRSIKIADFG--------------MAALETSDKLLETSCGSPHYASPEIV-LG 248

Query: 219 KGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL----KSQFQYPAYPVYSDSLKNV 274
           + Y     SD+W+ G+ LF L     PF  +  K +L      ++Q P +   S   K++
Sbjct: 249 RKYH-GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKDL 305

Query: 275 IRVLLSVDPFKRPNICQLIE 294
           I  +L VDP +R  I Q+++
Sbjct: 306 ISRILVVDPNRRITIDQILQ 325

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 108/238 (45%), Gaps = 46/238 (19%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY +GG L+D++       LRE         VA  +  +H    +++HRD
Sbjct: 202 TMSNHFYMLFEYVAGGQLLDYIIQH--GSLREHHARKFARGVASALQYLH--ANNIVHRD 257

Query: 160 IKIENILISENGEYKVCDFG------------SVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +KIENI+IS +GE K+ DFG            + CG          + +   +++K    
Sbjct: 258 LKIENIMISNSGEIKIIDFGLSNVYDTRKQLHTFCG---------SLYFAAPELLK--AH 306

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPA 263
            Y  PE+             D+W+ GV L+ L     PF+ E      + I + + +YP 
Sbjct: 307 PYTGPEV-------------DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKRGKVEYPQ 353

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLM 321
           +   S  + +++  +L VDP +R ++ Q++E     +G   P  ++  +R   T  ++
Sbjct: 354 H--LSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTKGYDTPAPSYVPNRIPLTPEML 409

>Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar to
           Ashbya gossypii AER223C
          Length = 893

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 121/270 (44%), Gaps = 35/270 (12%)

Query: 28  LASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYVVS 87
           +  G Y  VY A     D      +  +K +   +++ L+    E+D LK LR++  +V 
Sbjct: 25  IGKGAYGVVYKAVNKATD-----QVIAIKAIEYQNEEELHEHMLEIDLLKNLRHEN-IVK 78

Query: 88  YIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQ 147
           Y       H     S+E+++L+EYC  GSL D +    K  L E +    + Q   G+  
Sbjct: 79  Y-------HGFIQSSHELYILLEYCIRGSLRDLIK---KEALSEAKAKVYVKQTVRGLQY 128

Query: 148 MHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +H+    +IHRDIK  N+L++ENG  K+ DFG    V     +Y              + 
Sbjct: 129 LHD--QGVIHRDIKAANLLLTENGIVKLADFGVSTRVTNMAMTYA------------GSP 174

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPV- 266
            + +PE++ L KG   +  SDIW+LG  + +L     PF     +A   +      YP  
Sbjct: 175 NWMAPEVM-LGKG--ASTVSDIWSLGATVVELLTGNPPFHNLVNEAACYAIVNDVYYPPE 231

Query: 267 -YSDSLKNVIRVLLSVDPFKRPNICQLIEE 295
             S   KN I      + FKRP   QL+++
Sbjct: 232 HLSTQCKNFIERCFQKNMFKRPQAHQLLQQ 261

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 101/197 (51%), Gaps = 30/197 (15%)

Query: 101 GSY----EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLI 156
           GSY    +++++MEYC+GGSL   L      ++ E+ I  IM ++ V +  +H  + ++I
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELLVALLYIH--KDNVI 144

Query: 157 HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ---YRSPE 213
           HRDIK  N+LI+ +G  K+CDFG               +  Q ++ + T A    + +PE
Sbjct: 145 HRDIKAANVLITNDGRVKLCDFGVAA------------QLTQSNVRRQTMAGTPYWMAPE 192

Query: 214 MLDLTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQFQYPAYPVYSD 269
           +  + +G   + K DIW+LG+  +++     P+ + E  +A   I KS+        YS 
Sbjct: 193 V--IMEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSP 250

Query: 270 SLKNVIRVLLSVDPFKR 286
            LK  I + L  DP +R
Sbjct: 251 LLKEFIALCLDEDPKER 267

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 99/190 (52%), Gaps = 27/190 (14%)

Query: 104 EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
           E+++++EY  GG L D+L +  K +L E+E +H   Q+  GV+  H    ++ HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVS--KGKLPEREAIHYFKQIVEGVSYCHSF--NICHRDLKPE 243

Query: 164 NILISE-NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT--TAQYRSPEMLDLTKG 220
           N+L+ + N   K+ DFG     +  P          + ++K +  +  Y SPE++ + + 
Sbjct: 244 NLLLDKKNRRIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIV-MGRP 290

Query: 221 YQINEKSDIWALGVFLFKLCYYTTPFEKEG-EKAILKSQ---FQYPAYPVYSDSLKNVIR 276
           Y     SD+W+ G+ LF L     PF  +  +K +LK Q   +Q P     S   +++I 
Sbjct: 291 YH-GGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LSAEARDLIS 347

Query: 277 VLLSVDPFKR 286
            +L +DP KR
Sbjct: 348 KILVIDPAKR 357

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 110/230 (47%), Gaps = 24/230 (10%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE+        +A  +  +H    +++HRD
Sbjct: 173 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLH--MNNIVHRD 228

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTK 219
           +KIENI+IS +GE K+ DFG +  +  P +                +  + +PE+L   K
Sbjct: 229 LKIENIMISTSGEIKIIDFG-LSNMYDPKKQLHTF---------CGSLYFAAPELL---K 275

Query: 220 GYQ-INEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSLKNV 274
            +  I  + D+W+ GV L+ L     PF+ E      + I + + +YP +   S  + ++
Sbjct: 276 AHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQH--LSIEVISL 333

Query: 275 IRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLMQPL 324
           +  +L VDP KR  + Q++      +G   P  ++   R   T + + P+
Sbjct: 334 LSKMLVVDPSKRATLKQVVSHQWMQRGYDFPAPSYLPYRVPLTVAGLDPV 383

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 102/200 (51%), Gaps = 22/200 (11%)

Query: 99  HTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHR 158
           +T S   ++L EY SGG L+D++       L+E    +   Q+   +  +H    +++HR
Sbjct: 196 YTLSNHFYMLFEYVSGGQLLDYIIQH--GSLKESHARNFARQILSALKYLH--ANNIVHR 251

Query: 159 DIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT 218
           D+KIENI+IS NG  K+ DFG +  +      Y++ K ++       +  + +PE+L   
Sbjct: 252 DLKIENIMISSNGNIKIIDFG-LSNL------YDKSKKLK---TYCGSLYFAAPELLRAN 301

Query: 219 KGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSLKNV 274
               I  + D+W+ GV L+ L     PF+ E      + I + +  YP +   S  + ++
Sbjct: 302 P--YIGPEIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIKQGRVFYPQF--LSIEVISL 357

Query: 275 IRVLLSVDPFKRPNICQLIE 294
           +  +L VDPFKR  + Q+++
Sbjct: 358 LSTMLVVDPFKRATLDQVMK 377

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 133/308 (43%), Gaps = 53/308 (17%)

Query: 26  KYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYV 85
           K +  G +A VY  Y    D +    +  + +  + +KK L  L  E+  LK L N K++
Sbjct: 136 KEIGKGSFAVVYRGYSNE-DPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-NHKHI 193

Query: 86  VSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLK------------------- 126
           V+ ID   +K+       +  ++MEYCS G L   +  R +                   
Sbjct: 194 VNLIDCQRNKN-------DFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPN 246

Query: 127 ---NRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILIS--------ENGEYKV 175
              N L    +L+ + Q+A  +  +     +LIHRDIK +N+L+S        +    K+
Sbjct: 247 PDCNGLNIAFVLNYLQQLASALKFLRSR--NLIHRDIKPQNLLLSTPYTDYHDQQTFKKL 304

Query: 176 CDFGSVCGVIRPPRSYEEMKYIQHDIMKNT---TAQYRSPEMLDLTKGYQINEKSDIWAL 232
              G  C  I     +   +++ +  +  T   +  Y +PE+L+  K    N K+D+W++
Sbjct: 305 GYIGISCLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLWSV 361

Query: 233 GVFLFKLCYYTTPFEKEGEKAILK------SQFQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
           G  L+++ Y   PF+      +LK          +P+Y    D +K +I  LL  DP KR
Sbjct: 362 GTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFDPIKR 421

Query: 287 PNICQLIE 294
            +  +  E
Sbjct: 422 MSFQEFFE 429

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 107/238 (44%), Gaps = 46/238 (19%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE         +A  +  +H    +++HRD
Sbjct: 277 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLREHHARKFARGIASALQYLHS--NNIVHRD 332

Query: 160 IKIENILISENGEYKVCDFG------------SVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +KIENI+IS +GE K+ DFG            + CG          + +   +++K    
Sbjct: 333 LKIENIMISTSGEIKIIDFGLSNLYDTTRQLHTFCG---------SLYFAAPELLK--AH 381

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPA 263
            Y  PE+             D+W+ GV L+ L     PF+ E      + I + +  YP 
Sbjct: 382 PYTGPEV-------------DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQ 428

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLM 321
           +   S  + +++  +L VDP KR  + Q++E    ++G   P  ++  +R   T  ++
Sbjct: 429 H--LSIEVISLLSKMLVVDPKKRATLRQVVEHHWMVRGYDNPSSSYLPNRIPLTPQML 484

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 122/260 (46%), Gaps = 46/260 (17%)

Query: 52  IACLKRVVVP--DKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLM 109
           I  ++R  +P   +K +   R E++ALK L +   V        SK+ G        +++
Sbjct: 74  IKLIRRDTIPKNSEKEIKIYR-EINALKHLNHPNIVRLEEVLQNSKYIG--------IVL 124

Query: 110 EYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISE 169
           EY SGG    ++    K RL+E     +  Q+  GV  MH     L+HRD+K+EN+L+ +
Sbjct: 125 EYASGGEFYKYIQK--KRRLKEGPACRLFAQLISGVYYMHSK--GLVHRDLKLENLLLDK 180

Query: 170 NGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQINEKS 227
           N    + DFG V   +            ++++MK +     Y +PE++   + Y+   K+
Sbjct: 181 NENLLITDFGFVNEFL-----------PENELMKTSCGSPCYAAPELVVTARPYEA-RKA 228

Query: 228 DIWALGVFLFKLCYYTTPFEKEGE-----------KAILKSQFQYPAY--PVYSDSLKNV 274
           D+W+ GV L+ +     P++ + E           + I ++  ++P Y  PV  D    +
Sbjct: 229 DVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDYIAPVPRD----L 284

Query: 275 IRVLLSVDPFKRPNICQLIE 294
           +R +L  DP +R  I + ++
Sbjct: 285 LREILIPDPKRRITISKTLK 304

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 99/200 (49%), Gaps = 35/200 (17%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           + +++E+ SGG    ++  + K RL+E     +  Q+  GV  MH     L+HRD+K+EN
Sbjct: 119 IGIVLEFASGGEFYKYI--QKKRRLKETPACRLFAQLVSGVHYMH--SKGLVHRDLKLEN 174

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQ 222
           +L+ ++    + DFG V    +           ++++MK +     Y +PE++  T+ Y+
Sbjct: 175 LLLDKHENLIITDFGFVNEFSQ-----------RNELMKTSCGSPCYAAPELVVTTEPYE 223

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEGEKA-----------ILKSQFQYPAY--PVYSD 269
              K+D+W+ G+ L+ +     P++ + +             I K+  ++P Y  P+  D
Sbjct: 224 A-RKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLYITKTALKFPEYINPIQRD 282

Query: 270 SLKNVIRVLLSVDPFKRPNI 289
               ++R +L  DP KR NI
Sbjct: 283 ----LLRKILVSDPTKRLNI 298

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 127/284 (44%), Gaps = 37/284 (13%)

Query: 26   KYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLN----ALRAEVDALKVLRN 81
            +++  G +  V+SA    +D      I  +K + + D+KS+     A++ E+  L++L +
Sbjct: 1253 QFVGGGAFGTVFSA--VNLD---TGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNH 1307

Query: 82   KKYVVSY-IDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMT- 139
               V  Y ++ H  K         V + MEYC GGSL   L      R+ ++ +  I   
Sbjct: 1308 PNVVQYYGVEVHRDK---------VNLFMEYCEGGSLAQLLE---HGRIEDEMVTQIYAL 1355

Query: 140  QVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGV----IRPPRSYEEMK 195
            Q+  G+A +H  Q S++HRDIK ENIL+  NG  K  DFG+   +     + P    E K
Sbjct: 1356 QMLEGLAYLH--QSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGK 1413

Query: 196  YIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTP-FEKEGEKAI 254
                + M   T  Y SPE +   K  +     DIW+LG  + ++     P F  + E AI
Sbjct: 1414 ADGVNSMMG-TPMYMSPESITGAKKGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAI 1471

Query: 255  LK--SQFQYPAYPVYSDSLKNVIRVLLSV---DPFKRPNICQLI 293
            +   +    P  P   +     I  LL     DP KR    +L+
Sbjct: 1472 MYHVAAGHVPQLPTKEELSPQGIDFLLRCLKQDPNKRSTAMELL 1515

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 97/194 (50%), Gaps = 24/194 (12%)

Query: 101 GSY----EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLI 156
           GSY     ++++MEYC+GGSL   L   +   + E+ I  IM ++   +  +H  + ++I
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--KDNVI 162

Query: 157 HRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLD 216
           HRDIK  N+LI+  G+ K+CDFG    + +     + M           T  + +PE+  
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV-- 211

Query: 217 LTKGYQINEKSDIWALGVFLFKLCYYTTPF-EKEGEKA---ILKSQFQYPAYPVYSDSLK 272
           + +G   + K DIW+LG+  +++     P+ E E  +A   I KS+        YS  LK
Sbjct: 212 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRQYSSGLK 271

Query: 273 NVIRVLLSVDPFKR 286
             I + L  DP +R
Sbjct: 272 EFIALCLDEDPKER 285

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 108/232 (46%), Gaps = 30/232 (12%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE+        +A  +  +H    +++HRD
Sbjct: 278 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLH--LNNIVHRD 333

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYE----EMKYIQHDIMKNTTAQYRSPEML 215
           +KIENI+IS +GE K+ DFG +  +  P +        + +   +++K     Y  PE+ 
Sbjct: 334 LKIENIMISTSGEIKIIDFG-LSNMFNPKKQLHTFCGSLYFAAPELLK--ACPYTGPEV- 389

Query: 216 DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSL 271
                       D+W+ GV L+ L     PF+ E      + I + + +YP +   S  +
Sbjct: 390 ------------DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEV 435

Query: 272 KNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSRALETSSLMQP 323
            +++  +L VDP KR  + Q++      +G   P  ++   R   T+  + P
Sbjct: 436 ISLLSKMLVVDPSKRATLKQVVNHQWMQRGYDFPAPSYIPHRVPLTADALDP 487

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 146/314 (46%), Gaps = 53/314 (16%)

Query: 74  DALKVLRNKKY--VVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLRE 131
           D LK+L+   +  +V + D   SK        + +++ +  +GG L D + +  K +  E
Sbjct: 88  DELKILQKLDHPNIVKFKDWFESKD-------KFYIVTQLATGGELFDRILS--KGKFTE 138

Query: 132 QEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILI---SENGEYKVCDFGSVCGVIRPP 188
            + + I+TQ+   V  +H    +++HRD+K ENIL    S++    + DFG    + +  
Sbjct: 139 IDAVKIVTQILSAVQYIH--SKNIVHRDLKPENILYIDPSDDSPLVLADFG----IAKEL 192

Query: 189 RSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK 248
           +S +E+ +         +  Y +PE+L  T G+   +  DIW+LGV  + L    +PF  
Sbjct: 193 KSGDELIF-----KAAGSLGYVAPEVL-TTSGH--GKPCDIWSLGVVTYTLLSGYSPFIA 244

Query: 249 EGEKAILKS--------QFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEE----- 295
           E  +  L+         +F  P +   SD  KN I   L + P KRP   +L+E+     
Sbjct: 245 ESVEGFLEECTEGSKPVKFHKPYWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITC 304

Query: 296 LSRLQGIVPPMKNFYLSRA-LETSSLMQPLQNNSYKV---------PISDIQDKHKRQIP 345
            +  + ++P +K  Y +RA    +  +  L N   K+         P +DIQ+     IP
Sbjct: 305 CTSCKNLLPTVKKEYDARAKFREAVEIVKLNNRICKLRKMYCRGDEPETDIQENETASIP 364

Query: 346 NIQSSPEKLPSIQS 359
           + Q+  E L S+++
Sbjct: 365 SSQT--ETLSSLKN 376

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 143/318 (44%), Gaps = 59/318 (18%)

Query: 15  VTVGSHTAKIVKYLASGGYAQVYSAYVTPVDY-----SPATNIAC--LKRVVVPDKKSLN 67
           +T+G  T  I K +  G +A V+ A++          SP  N A   + R  + +KK L 
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPPLNFAIKIVSRSKLKNKKLLE 89

Query: 68  ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTR--- 124
            L  E+  LK + N  ++V  ID   +       + + +++MEYC+ G L   +  R   
Sbjct: 90  NLEIEIAILKKI-NHPHIVKLIDCERT-------TTDFYLIMEYCALGDLTFLIKKRHEL 141

Query: 125 LKNR-------------------LREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENI 165
           +KN                    L    IL+ + Q+A  +  +     +L+HRDIK +N+
Sbjct: 142 IKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLR--SKNLVHRDIKPQNL 199

Query: 166 LI-------SENGEYKVCDFGSVCGV-IRPPRSYEEMKYIQHDIMKNT---TAQYRSPEM 214
           L+       +++  +K   F  +  + I     +   +++ +  M  T   +  Y +PE+
Sbjct: 200 LLLTPLINYNDSKAFKKLGFIGIYELPILKIADFGFARFLPNTSMAETLCGSPLYMAPEI 259

Query: 215 LDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK------SQFQYPAYPVYS 268
           L+  K    N K+D+W++G  L+++CY T PF+      + K      ++  +P Y    
Sbjct: 260 LNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYIQIQ 316

Query: 269 DSLKNVIRVLLSVDPFKR 286
           + +K +I  LL+ DP +R
Sbjct: 317 NDMKILISKLLTFDPQRR 334

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 127/281 (45%), Gaps = 36/281 (12%)

Query: 26  KYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKYV 85
           K L +G +  V  A  T      A  I  +K+ +  +K  L AL  E+D L+ L +   +
Sbjct: 41  KTLGAGTFGVVRQARNTETGEDVAVKI-LIKKALKGNKIQLEALYDELDILQRLHHPN-I 98

Query: 86  VSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGV 145
           V++ D   SK        + +++ +   GG L D +    K +  E + + I+ ++   V
Sbjct: 99  VAFKDWFESKD-------KFYIITQLAKGGELFDRILK--KGKFTEVDAVRILVEILSAV 149

Query: 146 AQMHELQPSLIHRDIKIENILI---SENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIM 202
             MH    +++HRD+K EN+L    S+     V DFG    + +  +S EE+ Y      
Sbjct: 150 KYMH--SQNIVHRDLKPENLLYIDKSDESPLVVADFG----IAKRLKSDEELIY-----K 198

Query: 203 KNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKS----- 257
              +  Y +PE+L    G+   +  DIW+LGV  + L    + F+ E  +  L       
Sbjct: 199 PAGSLGYVAPEVL-TQDGH--GKPCDIWSLGVITYTLLCGYSAFKAERVQDFLDECTTGE 255

Query: 258 ---QFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEE 295
              +F  P +   SD  K  I   L++DP KRP   QL+E+
Sbjct: 256 YPVRFHRPYWDSVSDKAKQFILKALNLDPSKRPTAAQLLED 296

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 127/277 (45%), Gaps = 45/277 (16%)

Query: 28  LASGGYAQV---YSAYVTPVDYSPATNIACLKRVVVP--DKKSLNALRAEVDALKVLRNK 82
           L  G + +V   +S   +P + S    I  ++R  +P    K +   R E++ALK L + 
Sbjct: 50  LGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKEIKIYR-EINALKHLSHP 108

Query: 83  KYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVA 142
             V        SK+ G        +++EY SGG    ++    K RL+E     +  Q+ 
Sbjct: 109 NIVKLEEVLQNSKYIG--------IVLEYASGGEFYKYIQK--KRRLKEAVACRLFAQLI 158

Query: 143 VGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIM 202
            GV  MH     L+HRD+K+EN+L+ ++    + DFG V              +   ++M
Sbjct: 159 SGVQYMHSK--GLVHRDLKLENLLLDKHENLVITDFGFVNEF-----------FAHSELM 205

Query: 203 KNTTAQ--YRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGE--------- 251
           K +     Y +PE++  +K Y+   K+DIW+ GV L+ +     P++ + +         
Sbjct: 206 KTSCGSPCYAAPELVVSSKPYEA-RKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGK 264

Query: 252 --KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKR 286
             + I ++  ++P Y   +   ++++R +L  DP +R
Sbjct: 265 LYQYITRTPLKFPEY--ITPLPRDLLRRILYPDPKRR 299

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 122/267 (45%), Gaps = 45/267 (16%)

Query: 28  LASGGYAQVYSAYVT--PVDYSPATNIACLKRVVVP--DKKSLNALRAEVDALKVLRNKK 83
           L  G + +V   +    P + S    I  ++R  +P   +K +   R E++ALK L +  
Sbjct: 71  LGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTIPKHSEKEVKIYR-EINALKHLNHPN 129

Query: 84  YVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAV 143
            V        SK+ G        ++++Y SGG    ++  + K RL+E     +  Q+  
Sbjct: 130 IVRLEEVLQNSKYIG--------IVLQYASGGEFYKYI--QKKRRLKEPPACRLFAQLIS 179

Query: 144 GVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMK 203
           GV  MH     L HRD+K+EN+L+ E+    + DFG V             ++ ++D+MK
Sbjct: 180 GVYYMH--HKGLAHRDLKLENLLLDEHENLMITDFGFV------------NEFHKNDLMK 225

Query: 204 NTTAQ--YRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKA-------- 253
            +     Y +PE++   + Y+   K+D+W+ GV L+ +     P++ + E          
Sbjct: 226 TSCGSPCYAAPELVVTARPYEA-RKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKL 284

Query: 254 ---ILKSQFQYPAY--PVYSDSLKNVI 275
              I KS  ++P Y  P+  D L+ ++
Sbjct: 285 YHYITKSALKFPEYIKPLPRDLLRRIL 311

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 110/218 (50%), Gaps = 22/218 (10%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           ++ L+EY S G L+  L  +      E   ++   Q+   +  +H +   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSM--GIIHRDIKPEN 389

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT-----TAQYRSPEMLDLTK 219
           IL++++ + K+ DFG+   ++ P +  +       ++++ +     TA+Y SPE+  LT 
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPEL--LTD 446

Query: 220 GYQINEKSDIWALGVFLFKLCYYTTPFEKEGE----KAILKSQFQYPA-YPVYSDSLKNV 274
            Y  + + DIWA G  LF+L     PF+   E    + I+K Q+ + A +P     L+++
Sbjct: 447 SY-TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTI---LRDL 502

Query: 275 IRVLLSVDPFKRPNICQLIEEL-SRLQGIVPPMKNFYL 311
           I+ +L  +P  R  I Q+   L  R +    P   +YL
Sbjct: 503 IKKILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 102/211 (48%), Gaps = 23/211 (10%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE+     +  +A  +  +H    +++HRD
Sbjct: 192 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLRERHARKFVRGIASALQYLH--LNNIVHRD 247

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTK 219
           +KIENI+IS +GE K+ DFG           Y+  K + H      +  + +PE+L    
Sbjct: 248 LKIENIMISTSGEIKIIDFGLS-------NLYDNKKQL-HTFC--GSLYFAAPELLKANP 297

Query: 220 GYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSLKNVI 275
              I  + DIW+ GV ++ L     PF+ E      + I K + +YP +   S    +++
Sbjct: 298 --YIGPEVDIWSFGVVIYVLVCGKVPFDDENASVLHEKIKKGKVEYPQH--LSIECISLL 353

Query: 276 RVLLSVDPFKRPNICQLIEELSRLQGI-VPP 305
             +L VDP KR ++ Q+       +G   PP
Sbjct: 354 SKMLVVDPLKRASLKQVCNHQWMQRGFDFPP 384

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 98/202 (48%), Gaps = 30/202 (14%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE+        +A  +  +H    +++HRD
Sbjct: 211 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLH--MNNIVHRD 266

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYE----EMKYIQHDIMKNTTAQYRSPEML 215
           +KIENI+IS +GE ++ DFG +  +  P +        + +   +++K     Y  PE+ 
Sbjct: 267 LKIENIMISSSGEIRIIDFG-LSNLYDPKKQLHTFCGSLYFAAPELLK--AHPYTGPEV- 322

Query: 216 DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSL 271
                       DIW+ GV L+ L     PF+ E      + I + + +YP +   S  +
Sbjct: 323 ------------DIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQH--LSIDV 368

Query: 272 KNVIRVLLSVDPFKRPNICQLI 293
            +++  +L VDP KR  + Q++
Sbjct: 369 ISLLSKMLVVDPLKRATLKQVV 390

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 116/245 (47%), Gaps = 39/245 (15%)

Query: 63  KKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLN 122
           K+S   L  E++ALK+L +   V        SK+ G        +++EY SGG    ++ 
Sbjct: 117 KESEIKLYREINALKMLTHPNIVKLEEVLQNSKYIG--------IVLEYASGGEFYKYI- 167

Query: 123 TRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVC 182
            + K RL+E +   I  Q+  GV+ +H     L+HRD+K+EN+L+ + G   + DFG V 
Sbjct: 168 -KFKKRLKESKACTIFAQLISGVSYIH--SKGLVHRDLKLENLLLDKAGNLLITDFGFVN 224

Query: 183 GVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240
            V +            + +M        Y +PE++   + Y    K+DIW+ GV L+ + 
Sbjct: 225 EVTK-----------TNKLMHTPCGSPCYAAPELVTSVEPYNA-RKADIWSCGVILYAML 272

Query: 241 YYTTPFEKEGE-----------KAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNI 289
               P++ + +           K I     ++P Y   +   ++++R +L +DP KR ++
Sbjct: 273 AGYLPWDDDPKNINGTDIVKLYKYIENQPLKFPEY--INMVPRDLLRRMLEIDPAKRMSM 330

Query: 290 CQLIE 294
             +++
Sbjct: 331 KHILQ 335

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 132/279 (47%), Gaps = 52/279 (18%)

Query: 29  ASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEVDALKVLRNKKY--VV 86
           ASGG   VY+AY    D S A     L++   P K+ +      ++ + V+++ K+  +V
Sbjct: 561 ASGG---VYTAYEVGTDASVAIKQMNLEKQ--PKKELI------INEIIVMKDSKHPNIV 609

Query: 87  SYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVA 146
           ++IDS   K        +++V+ME+  GGSL D +   +   L E +I  +  +   G+ 
Sbjct: 610 NFIDSFLLKG-------DLWVIMEFMEGGSLTDVVTHCI---LTEGQIGTVCRETLRGLQ 659

Query: 147 QMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNT- 205
            +H     +IHRDIK +NIL+S  G+ K+ DFG  C  I            +H++ + T 
Sbjct: 660 FLHSN--GVIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN-----------EHNLKRTTM 705

Query: 206 --TAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAIL-------K 256
             T  + +PE++      +   K DIW+LG+ + ++     P+  E     L        
Sbjct: 706 VGTPYWMAPEVVSRK---EYGPKVDIWSLGIMIIEMIESEPPYLNETPLRALYLIATNGT 762

Query: 257 SQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEE 295
            + + P   + SD L + +   L V+P +R +   L+E+
Sbjct: 763 PKLKEPE--LLSDVLNDFLSWCLKVNPDERASASTLLED 799

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 107/233 (45%), Gaps = 49/233 (21%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE         +A  +  +H    +++HRD
Sbjct: 258 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLREHHARKFARGIASALQYLH--LNNIVHRD 313

Query: 160 IKIENILISENGEYKVCDFG------------SVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +KIENI+IS +GE K+ DFG            + CG          + +   +++K    
Sbjct: 314 LKIENIMISNSGEIKIIDFGLSNVFDNRKQLHTFCG---------SLYFAAPELLK--AH 362

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPA 263
            Y  PE+             D+W+ G+ L+ L     PF+ E      + I + + +YP 
Sbjct: 363 PYTGPEV-------------DVWSFGIVLYVLVCGKVPFDDENSSVLHEKIRQGKVEYPN 409

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGI-VPPMKNFYLSRAL 315
           +   S  + +++  ++ VDP KR ++ Q++E     +G   PP+   YL R +
Sbjct: 410 H--LSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRGYDFPPLS--YLPRRI 458

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 142/303 (46%), Gaps = 66/303 (21%)

Query: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPD--KKSL 66
           ++ D +  VG++  +I++ +  G + +VY A+  P            ++VV+    K   
Sbjct: 26  FMSDDLTEVGNY--RILRQIGEGSFGKVYLAHHLPTH----------RKVVLKSSAKSDP 73

Query: 67  NALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYE-------VFVLMEYCSGGSLID 119
           N +R      +V  ++++   YI          T  YE       V++ +EYC G  L +
Sbjct: 74  NVVR------EVFYHRQFEFPYI----------TKLYEIIVTETKVWMALEYCPGKELYE 117

Query: 120 FLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFG 179
            L  RL +R+   E   +  Q++  +   H L  + +HRD+K+ENIL+ + G  K+ DFG
Sbjct: 118 HL-LRL-HRIPVDECSRLFAQISGAMYYAHSL--NCVHRDLKLENILLDKVGNAKLTDFG 173

Query: 180 SV--CGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTK--GYQINEKSDIWALGVF 235
               C            K I   I   T   Y +PE++   +  G++I    D+W+LGV 
Sbjct: 174 FTRECA----------SKNILETICGTTV--YMAPELIKRERYDGFKI----DVWSLGVI 217

Query: 236 LFKLCYYTTPFEKEGEK----AILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQ 291
           L+ L     PF++E +K     I+     + +  +  D++ +++  LL+ DP  RP++ +
Sbjct: 218 LYTLLNGFMPFDEEQQKNTEWKIVNEMPSFDSTLLGPDAV-DLLSKLLAKDPIDRPSMKE 276

Query: 292 LIE 294
           ++E
Sbjct: 277 VLE 279

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 105/230 (45%), Gaps = 46/230 (20%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       +RE +       +A  +  +H    +++HRD
Sbjct: 212 TLSNHFYMLFEYVSGGQLLDYIIQH--GSIREHQARKFARGIASALMYLH--ANNIVHRD 267

Query: 160 IKIENILISENGEYKVCDFG------------SVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +KIENI+IS++ E K+ DFG            + CG          + +   +++K    
Sbjct: 268 LKIENIMISDSSEIKIIDFGLSNLYDSRKQLHTFCG---------SLYFAAPELLK--AH 316

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPA 263
            Y  PE+             D+W+ GV LF L     PF+ E      + I + + +YP 
Sbjct: 317 PYTGPEV-------------DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQ 363

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSR 313
           +   S  + +++  +L VDP +R  + Q++E    ++G   P  ++   R
Sbjct: 364 H--LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNAPPPSYLPKR 411

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 141/292 (48%), Gaps = 31/292 (10%)

Query: 13  TVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAE 72
           T++  G    K    L  G Y+QV+ A  +  D S    +  L +  +  +K +  +  E
Sbjct: 109 TIIRKGIKDFKFGDMLGDGSYSQVFLA-TSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIE 167

Query: 73  VDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLK-NRLRE 131
             AL+ L++   V++   +   + +       ++ L+EY   G   DFL+   K   L E
Sbjct: 168 KTALQNLKSVTGVINLSFTFQDEAN-------LYFLLEYAPNG---DFLSLIKKFGTLNE 217

Query: 132 QEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSY 191
           +  ++   Q+   +  MH     +IHRDIK ENIL+  N + K+ DFG+   + +  +S 
Sbjct: 218 ECTIYYSAQIIDAIGSMHSH--GIIHRDIKPENILLDGNMKIKLTDFGTAKLLQK--KSD 273

Query: 192 EEMKYIQHDIMKNT----TAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFE 247
           +  K   + + +++    TA+Y SPE+  L+  Y  + K DIWA G  ++++     PF+
Sbjct: 274 KNGKPHYNLLTRSSSFVGTAEYVSPEL--LSDNY-TDYKCDIWAFGCLVYQMIAGKPPFK 330

Query: 248 KEGE----KAILKSQFQYPA-YPVYSDSLKNVIRVLLSVDPFKRPNICQLIE 294
              E    + ++K QF + A +P     ++++++ +L   P KR  I Q+ E
Sbjct: 331 ATNEYLTFQKVMKVQFAFTAGFPTI---IRDLVKNILVKQPEKRLTIPQIKE 379

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 99/202 (49%), Gaps = 30/202 (14%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       LRE+        +A  +  +H    +++HRD
Sbjct: 150 TMSNHFYMLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLH--LNNIVHRD 205

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYE----EMKYIQHDIMKNTTAQYRSPEML 215
           +KIENI+IS +GE ++ DFG +  +  P +        + +   +++K     Y  PE+ 
Sbjct: 206 LKIENIMISSSGEIRIIDFG-LSNMYDPKKQLHTFCGSLYFAAPELLK--AHPYTGPEV- 261

Query: 216 DLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSL 271
                       DIW+ GV L+ L     PF+ E      + I + + +YP +   S  +
Sbjct: 262 ------------DIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQH--LSIDV 307

Query: 272 KNVIRVLLSVDPFKRPNICQLI 293
            +++  +L VDP+KR  + Q++
Sbjct: 308 ISLLSKMLVVDPYKRATLKQVV 329

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 112/236 (47%), Gaps = 45/236 (19%)

Query: 82  KKYVVSYIDSHASKHSGH----------TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLRE 131
           KK V  Y + +A KH  H            S  + +++EY  GG    ++  + K RL+E
Sbjct: 92  KKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYI--QKKRRLKE 149

Query: 132 QEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSY 191
                + +Q+  GV  +H     L+HRD+K+EN+L+ +N    + DFG V          
Sbjct: 150 TNACRLFSQLISGVHYIHS--KGLVHRDLKLENLLLDKNENLVITDFGFVNEFCS----- 202

Query: 192 EEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK- 248
                 ++++MK +     Y +PE++  TK Y+   K+DIW+ GV L+ +     P++  
Sbjct: 203 ------RNELMKTSCGSPCYAAPELVVSTKPYEA-RKADIWSCGVILYAMLAGYLPWDDD 255

Query: 249 ----EGEKA------ILKSQFQYPAY--PVYSDSLKNVIRVLLSVDPFKRPNICQL 292
               EG         I  +  ++P Y  P+  D L+   R+L+S DP +R N+ Q+
Sbjct: 256 PNNPEGSDIGRLYNYICSTPLKFPDYILPIPRDLLR---RILVS-DPKRRINLKQI 307

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 90/192 (46%), Gaps = 31/192 (16%)

Query: 98   GHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIH 157
            G TGS ++F L+E+ S               + E EI  +  QV  GV  +H+    ++H
Sbjct: 1210 GETGSIDLFDLIEFTSN--------------MTEFEIKLLFKQVVSGVKHLHD--QGIVH 1253

Query: 158  RDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDL 217
            RDIK ENI++   G  K+ DFGS   V   P           D+   T   Y +PE+L  
Sbjct: 1254 RDIKDENIIVDNKGFIKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG- 1301

Query: 218  TKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRV 277
               Y+  +  DIWALG+ L+ + +   PF    E  IL+   ++      S     +I++
Sbjct: 1302 GNPYE-GKPQDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKL 1358

Query: 278  LLSVDPFKRPNI 289
            +L+ + FKRP I
Sbjct: 1359 ILNRNVFKRPTI 1370

>Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 138/315 (43%), Gaps = 57/315 (18%)

Query: 12  DTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRA 71
           + + + G++TA+  K +  G +A VY  ++T  D S    I  + R  + +KK L  L  
Sbjct: 16  NLMASAGNYTAE--KEIGKGSFATVYRGHLTS-DKSQHIAIKEVSRTKLKNKKLLENLEI 72

Query: 72  EVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLK----- 126
           E+  LK +++  ++V  ID   +       S + +++MEYC+ G L   L  R +     
Sbjct: 73  EIAILKKIKHP-HIVGLIDCERT-------STDFYLIMEYCALGDLTFLLKRRKELMENH 124

Query: 127 -----------------NRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISE 169
                            N L    +L  + Q+A  +  +     +L+HRDIK +N+L+S 
Sbjct: 125 PLLRTVFEKYPPPSESHNGLHRAFVLSYLQQLASALKFLR--SKNLVHRDIKPQNLLLST 182

Query: 170 -----NGEYKVCDFGSVCGVIRPP----RSYEEMKYIQHDIMKNTTAQ---YRSPEMLDL 217
                +      + G V G+   P      +   +++ +  +  T      Y +PE+L+ 
Sbjct: 183 PLIGYHDSKTFHELGFV-GIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNY 241

Query: 218 TKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILK------SQFQYPAYPVYSDSL 271
            K    N K+D+W++G  +F++C  T PF       + K          +P+Y      L
Sbjct: 242 QK---YNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPEL 298

Query: 272 KNVIRVLLSVDPFKR 286
           K +I  LL+ DP KR
Sbjct: 299 KELICSLLTFDPVKR 313

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 109/220 (49%), Gaps = 26/220 (11%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       +RE +       +A  +  +H    +++HRD
Sbjct: 214 TLSNHFYMLFEYVSGGQLLDYIIQH--GSIREHQARKFARGIASALIYLH--ANNIVHRD 269

Query: 160 IKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLT- 218
           +KIENI+IS++ E K+ DFG +  +      Y+  K + H      +  + +PE+L    
Sbjct: 270 LKIENIMISDSSEIKIIDFG-LSNI------YDSRKQL-HTFC--GSLYFAAPELLKANP 319

Query: 219 -KGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPAYPVYSDSLKN 273
             G ++    D+W+ GV LF L     PF+ E      + I + + +YP +   S  + +
Sbjct: 320 YTGPEV----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVIS 373

Query: 274 VIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSR 313
           ++  +L VDP +R  + Q++E    ++G   P  ++   R
Sbjct: 374 LLSKMLVVDPKRRATLKQVVEHHWMVRGFNGPPPSYLPKR 413

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 94/195 (48%), Gaps = 31/195 (15%)

Query: 98   GHTGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIH 157
            G +GS ++F L+E              +K  + E E + I  Q+A G+  +H+    ++H
Sbjct: 1042 GTSGSIDLFDLIE--------------MKTDMTEHEAMLIFKQIASGIKNLHD--NGIVH 1085

Query: 158  RDIKIENILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDL 217
            RDIK EN+++  NG  K+ DFGS   V   P           D+   T   Y +PE+L  
Sbjct: 1086 RDIKDENVIVDCNGFVKIVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG- 1133

Query: 218  TKGYQINEKSDIWALGVFLFKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRV 277
             + Y+  +  DIWA+GV L+ + Y   PF    E  IL +  +  +    SD    +IR 
Sbjct: 1134 GEPYE-GKPQDIWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRK 1190

Query: 278  LLSVDPFKRPNICQL 292
            +L+    KRP+I ++
Sbjct: 1191 ILNRSVSKRPSIDEI 1205

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 95/200 (47%), Gaps = 35/200 (17%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           + +++EY +GG    F+  + K RL+E     + +Q+   V  +H     L+HRD+K+EN
Sbjct: 142 IGIVLEYAAGGEFYKFI--QRKRRLKENHACRLFSQLISAVHYIH--SKGLVHRDLKLEN 197

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQ 222
           +L+       + DFG V   +R           Q+ +MK +     Y +PE++   + Y 
Sbjct: 198 LLLDNEENLIITDFGFVNEFLR-----------QNGMMKTSCGSPCYAAPELVVSNRPYD 246

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEGEKA-----------ILKSQFQYPAY--PVYSD 269
              K+D W+ G+ LF +     P++ + +             IL +  ++P Y  PV  D
Sbjct: 247 A-RKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDISRLYNYILNTPLKFPEYINPVPRD 305

Query: 270 SLKNVIRVLLSVDPFKRPNI 289
               ++R +L +DP KR NI
Sbjct: 306 ----LLRKILVIDPKKRINI 321

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 95/186 (51%), Gaps = 31/186 (16%)

Query: 105 VFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIEN 164
           + +++EY SGG    ++  + K RL+E    ++ +Q+  GV  MH     L+HRD+K+EN
Sbjct: 152 IGIVLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMH--CKGLVHRDLKLEN 207

Query: 165 ILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQ--YRSPEMLDLTKGYQ 222
           +L+ + G   + DFG V          E  K+   ++MK +     Y +PE++  T+ Y+
Sbjct: 208 LLLDKYGNLIITDFGFVN---------EFSKF--SELMKTSCGSPCYAAPELVISTRPYE 256

Query: 223 INEKSDIWALGVFLFKLCYYTTPFEKEGE-----------KAILKSQFQYPAY--PVYSD 269
              K+DIW+ G+ LF +     P++ + +           K I  +  ++P Y  P+  D
Sbjct: 257 A-RKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFPEYISPMARD 315

Query: 270 SLKNVI 275
            L+N++
Sbjct: 316 LLRNIL 321

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 105/230 (45%), Gaps = 46/230 (20%)

Query: 100 TGSYEVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRD 159
           T S   ++L EY SGG L+D++       +RE +       +A  +  +H    +++HRD
Sbjct: 225 TLSNHFYMLFEYVSGGQLLDYIIQH--GSIREHQARKFARGIASALMYLH--ANNIVHRD 280

Query: 160 IKIENILISENGEYKVCDFG------------SVCGVIRPPRSYEEMKYIQHDIMKNTTA 207
           +KIENI+IS++ E K+ DFG            + CG          + +   +++K    
Sbjct: 281 LKIENIMISDSSEIKIIDFGLSNLYDSRKQLHTFCG---------SLYFAAPELLKANP- 330

Query: 208 QYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEKEG----EKAILKSQFQYPA 263
            Y  PE+             D+W+ GV LF L     PF+ E      + I + + +YP 
Sbjct: 331 -YTGPEV-------------DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQ 376

Query: 264 YPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKNFYLSR 313
           +   S  + +++  +L VDP +R  + Q++E    ++G   P  ++   R
Sbjct: 377 H--LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFDGPPPSYLPKR 424

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 136/290 (46%), Gaps = 32/290 (11%)

Query: 14  VVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNALRAEV 73
           V+  G    K  + L  G Y+ V  A  T ++      +  L +  +  +K +  +  E 
Sbjct: 203 VILKGIKDFKFGEVLGDGSYSTVMLA--TSIETKKKYAVKVLSKEYLIKQKKVKYVNIEK 260

Query: 74  DALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLK-NRLREQ 132
           +AL+ L N + +V    +   + S       ++ L+EY   G   DFL+   K   + E 
Sbjct: 261 NALQKLNNSRGIVRLFFTFQDEAS-------LYFLLEYAPNG---DFLSLIKKFGSMNED 310

Query: 133 EILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPPRSYE 192
              +   Q+   +  +H     +IHRDIK ENIL+    + K+ DFG+   ++ P  S  
Sbjct: 311 CASYYSAQIIDAIHFVHSR--GIIHRDIKPENILLDSEMKVKLTDFGT-AKILEPKSSSS 367

Query: 193 EMKYIQHDIMKNT-----TAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFE 247
             K+  +D++  +     TA+Y SPE+L+ +     + + DIWA G  +F++     PF+
Sbjct: 368 SSKHETYDLLTRSKSFVGTAEYVSPELLNDSYA---DSRCDIWAFGCIVFQMIAGKPPFK 424

Query: 248 KEGE----KAILKSQFQYPA-YPVYSDSLKNVIRVLLSVDPFKRPNICQL 292
              E    + ++K Q+ + A +P+    ++++++ +L   P +R  I Q+
Sbjct: 425 ATNEYLTFQKVMKVQYAFTAGFPLV---IRDLVKRILIKAPEQRLTISQI 471

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 127/270 (47%), Gaps = 46/270 (17%)

Query: 52   IACLKRVVVP-----DKKSLN---ALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSY 103
            +  +K+V VP     D+ ++N   AL +EV  LK L +   +V Y+             Y
Sbjct: 1149 MMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDL-DHLNIVQYL-----GFENKNCIY 1202

Query: 104  EVFVLMEYCSGGSLIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIE 163
             +F  +EY +GGS+   +  RL     EQ I  + TQV  G+A +H     ++HRD+K +
Sbjct: 1203 SLF--LEYVAGGSVGSLI--RLYGHFDEQLIRFLTTQVLEGLAYLHLR--GILHRDMKAD 1256

Query: 164  NILISENGEYKVCDFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQI 223
            N+L+  +G  K+ DF    G+ R   +     Y   ++    T  + +PEM+D T+GY  
Sbjct: 1257 NLLLDNDGVCKISDF----GISRKSNNI----YSNSEMTMRGTVFWMAPEMVDTTQGY-- 1306

Query: 224  NEKSDIWALGVFLFKLCYYTTPFEK-EGEKAILKSQFQYPAYPVYSDSLKNVI---RVLL 279
            + K DIW+LG  + ++     P+   E   A+ +      A P+  D+L ++    R  L
Sbjct: 1307 SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPEDTLPHISQDGRAFL 1366

Query: 280  S----VDPFKRPN--------ICQLIEELS 297
                 +DP +RP          CQ+ +E +
Sbjct: 1367 DDCFMIDPEERPTADTLLSHPFCQVPKEFN 1396

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,919,832
Number of extensions: 3037904
Number of successful extensions: 12691
Number of sequences better than 10.0: 1945
Number of HSP's gapped: 11108
Number of HSP's successfully gapped: 2048
Length of query: 701
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 584
Effective length of database: 40,065,477
Effective search space: 23398238568
Effective search space used: 23398238568
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)