Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1039.322.285ON65965935430.0
NCAS0G038002.285ON72665627610.0
YNL021W (HDA1)2.285ON70665827470.0
NDAI0G006502.285ON68965627340.0
Skud_14.3082.285ON70665527310.0
ZYRO0A01870g2.285ON70765427220.0
Suva_14.3262.285ON70665527190.0
Smik_14.3102.285ON70665527180.0
SAKL0E07700g2.285ON71265626840.0
KNAG0H020102.285ON69365626820.0
TDEL0G021602.285ON71465526800.0
CAGL0J03454g2.285ON69365626690.0
Kwal_27.115372.285ON70865826350.0
KLTH0G10340g2.285ON70865626350.0
Ecym_33242.285ON70665625830.0
KAFR0H033202.285ON70265825740.0
KLLA0E08383g2.285ON70465625590.0
TPHA0C033902.285ON70165525190.0
ADL216C2.285ON70565925040.0
TBLA0B069502.285ON79543218840.0
Kpol_1003.372.285ON57828612511e-165
TPHA0H003208.153ON4503553861e-39
NCAS0B054808.153ON4513583807e-39
SAKL0H25124g8.153ON4483653781e-38
TDEL0B045808.153ON4463753762e-38
Ecym_23468.153ON4853423748e-38
AFR172C8.153ON4493323711e-37
NDAI0B027108.153ON4533683693e-37
KAFR0C029208.153ON4533553674e-37
Kpol_246.58.153ON4533583675e-37
KLTH0E06446g8.153ON4493583641e-36
KLLA0F09119g8.153ON4523583622e-36
ZYRO0G19316g8.153ON4484173612e-36
TBLA0D021408.153ON4563553595e-36
Skud_7.798.153ON4523293586e-36
CAGL0A03322g8.153ON4503623587e-36
Kwal_55.207908.153ON4493583571e-35
YGL194C (HOS2)8.153ON4523303561e-35
Smik_7.798.153ON4523303543e-35
KNAG0G013508.153ON4513353534e-35
Suva_7.718.153ON4523293525e-35
KAFR0A086303.8ON4333263312e-32
TBLA0I005603.8ON4333263293e-32
Kpol_1038.113.8ON4333263286e-32
TPHA0A003003.8ON4333263269e-32
KNAG0A011603.8ON4333143261e-31
Suva_14.113.8ON4333163251e-31
KLLA0E01981g3.8ON4323143223e-31
NDAI0G037403.8ON4333273223e-31
Ecym_20103.8ON4333143214e-31
AGR395W3.8ON4333143214e-31
Skud_14.113.8ON4333163206e-31
ZYRO0C03498g3.8ON4333263206e-31
SAKL0C13706g3.8ON4333263171e-30
KLTH0F19668g3.8ON4323403171e-30
Kwal_55.221423.8ON4323403171e-30
CAGL0B01441g3.8ON4333263162e-30
YNL330C (RPD3)3.8ON4333163143e-30
Smik_14.23.8ON4333163143e-30
NCAS0C043203.8ON4343143143e-30
TDEL0A002703.8ON4333273056e-29
TDEL0C050403.362ON4542482071e-16
SAKL0B07854g3.362ON4892292054e-16
NCAS0A111803.362ON4902081921e-14
TBLA0B023903.362ON5791851894e-14
Suva_16.3963.362ON4771831868e-14
CAGL0D01430g3.362ON4452341841e-13
Skud_16.3533.362ON4711821841e-13
Ecym_82908.607ON7093251832e-13
KAFR0H008903.362ON4742131813e-13
NDAI0A051203.362ON5082111804e-13
ZYRO0C16390g3.362ON4362271794e-13
Kwal_23.37243.362ON4732291786e-13
YPR068C (HOS1)3.362ON4701831778e-13
ADL339W3.362ON4372361761e-12
Smik_16.3093.362ON4701821742e-12
KLTH0F10582g3.362ON4741821723e-12
KLLA0B09394g3.362ON4412391706e-12
Kpol_376.153.362ON5182091681e-11
Ecym_34653.362ON4452301653e-11
TDEL0A055208.607ON6743071654e-11
KNAG0H006303.362ON4562331625e-11
KLTH0D09592g8.607ON7053281611e-10
SAKL0H08338g8.607ON6903321611e-10
Kwal_26.85058.607ON7083321601e-10
ADL265W8.607ON6942651547e-10
Kpol_479.68.607ON6883051547e-10
ZYRO0F10780g8.607ON6683321475e-09
TBLA0E040808.607ON6943311475e-09
KAFR0H027908.607ON717951467e-09
TPHA0A011208.607ON6982551459e-09
Suva_16.1948.607ON6991351451e-08
NCAS0C017608.607ON7001641441e-08
YPL116W (HOS3)8.607ON6971351413e-08
KLLA0F00858g8.607ON715651413e-08
NDAI0E024808.607ON6841081404e-08
Smik_6.3158.607ON6971351395e-08
Skud_16.1648.607ON6971241332e-07
TPHA0M015903.362ON4941511313e-07
KNAG0J013008.607ON6771401262e-06
CAGL0J06974g8.607ON678541216e-06
AGR201C8.563ON60071761.5
Kwal_33.13556singletonOFF580147707.4
Kwal_YGOB_33.135561.119ON591147707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1039.32
         (659 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1369   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1068   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1062   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1057   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1056   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1053   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1051   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1051   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1038   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1037   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1036   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1032   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1019   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1019   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...   999   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...   996   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...   990   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   974   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...   969   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   730   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   486   e-165
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   153   1e-39
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   150   7e-39
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   150   1e-38
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   149   2e-38
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   148   8e-38
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   147   1e-37
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    146   3e-37
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   145   4e-37
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   145   5e-37
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   144   1e-36
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   144   2e-36
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   143   2e-36
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   142   5e-36
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   142   6e-36
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   142   7e-36
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   142   1e-35
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   141   1e-35
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   140   3e-35
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   140   4e-35
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   140   5e-35
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   132   2e-32
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   131   3e-32
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   130   6e-32
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   130   9e-32
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   130   1e-31
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   129   1e-31
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   128   3e-31
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   128   3e-31
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   128   4e-31
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   128   4e-31
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   127   6e-31
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   127   6e-31
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   126   1e-30
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   126   1e-30
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   126   1e-30
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   126   2e-30
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   125   3e-30
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   125   3e-30
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      125   3e-30
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   122   6e-29
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    84   1e-16
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    84   4e-16
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    79   1e-14
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    77   4e-14
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    76   8e-14
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    75   1e-13
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    75   1e-13
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    75   2e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    74   3e-13
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    74   4e-13
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    74   4e-13
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    73   6e-13
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    73   8e-13
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    72   1e-12
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    72   2e-12
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    71   3e-12
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    70   6e-12
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    69   1e-11
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    68   3e-11
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    68   4e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    67   5e-11
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    67   1e-10
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    67   1e-10
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    66   1e-10
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    64   7e-10
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    64   7e-10
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    61   5e-09
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    61   5e-09
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    61   7e-09
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    60   9e-09
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    60   1e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    60   1e-08
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    59   3e-08
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    59   3e-08
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    59   4e-08
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    58   5e-08
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    56   2e-07
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    55   3e-07
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    53   2e-06
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    51   6e-06
AGR201C Chr7 complement(1129966..1131768) [1803 bp, 600 aa] {ON}...    34   1.5  
Kwal_33.13556 s33 (280291..282030) [1740 bp, 580 aa] {OFF} YNL24...    32   7.4  
Kwal_YGOB_33.13556 s33 (280291..282063) [1773 bp, 591 aa] {ON} A...    32   7.5  

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1369 bits (3543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/659 (100%), Positives = 659/659 (100%)

Query: 1   MMSSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDP 60
           MMSSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDP
Sbjct: 1   MMSSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDP 60

Query: 61  ALSGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYF 120
           ALSGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYF
Sbjct: 61  ALSGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYF 120

Query: 121 NNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATK 180
           NNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATK
Sbjct: 121 NNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATK 180

Query: 181 NILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQ 240
           NILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQ
Sbjct: 181 NILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQ 240

Query: 241 VGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG 300
           VGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG
Sbjct: 241 VGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG 300

Query: 301 KCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPD 360
           KCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPD
Sbjct: 301 KCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPD 360

Query: 361 KDPKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQI 420
           KDPKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQI
Sbjct: 361 KDPKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQI 420

Query: 421 QYLTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSS 480
           QYLTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSS
Sbjct: 421 QYLTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSS 480

Query: 481 ASLYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPN 540
           ASLYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPN
Sbjct: 481 ASLYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPN 540

Query: 541 VNKIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTS 600
           VNKIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTS
Sbjct: 541 VNKIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTS 600

Query: 601 LLFADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659
           LLFADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE
Sbjct: 601 LLFADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1068 bits (2761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/656 (73%), Positives = 577/656 (87%)

Query: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62
           + LSYTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI+DP L
Sbjct: 69  AELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTL 128

Query: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNN 122
           SGI+DIGDLM KIPVR+AT EEILEVH KE  +++EKT  +NR+ELL  TE GDSVYFNN
Sbjct: 129 SGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNN 188

Query: 123 DSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNI 182
           DS+ SAKL  GG+IEACKA+V+G+VKNSLA+VRPPGHH+EP+ AGGFCLFSNVA+A KNI
Sbjct: 189 DSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNI 248

Query: 183 LKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVG 242
           LKNYP+ V+++MI+DWDIHHGNGTQKAFY+DDRVLY+SLHRFELGKYYPGTI+GQYDQ G
Sbjct: 249 LKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTG 308

Query: 243 EGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKC 302
           EGKGEGFNCNI W VGG+GDAEYIWAFEQ+VMPM REF+PDLVI+SSGFDAADGD+IG+C
Sbjct: 309 EGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQC 368

Query: 303 HVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362
           HVTPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIARSAL+VAK+LIGEPPDELP P +D
Sbjct: 369 HVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRD 428

Query: 363 PKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQY 422
           PKPEAIE+ID+VI L+SKYWKCFKR+  N+ C +K  I+ES  +K FP+Q AIR QQ+  
Sbjct: 429 PKPEAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNT 488

Query: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482
           L+ D+    LPL+   LP+DTV+CS ++ QS   II  HDTPEIW+KRD I G ID S+S
Sbjct: 489 LSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSS 548

Query: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542
           + +D++L F  WA ++ YG+ID+NIPQ L+EQ+NYSA +T+QEVL  +WDN LKYFPNV 
Sbjct: 549 IIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVE 608

Query: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602
           K+A+IG+G+AYSG+VHLLGHRDTRSVVKSVI F+ +K L+ALVPLV+ESL+DWYFK SL+
Sbjct: 609 KVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLV 668

Query: 603 FADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
           F+DK+H+ WG+ ++KKPRK+YGR+LRC++DGI +++EERFEEATDFI+DS +EW++
Sbjct: 669 FSDKSHTYWGDKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSD 724

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/658 (72%), Positives = 577/658 (87%)

Query: 2   MSSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPA 61
           M  + Y+PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP 
Sbjct: 48  MPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPT 107

Query: 62  LSGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFN 121
           LSG+DD+GDLM KIPVR ATSEEILEVH KE LE++E T+ ++R+ELL +TE GDSVYFN
Sbjct: 108 LSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKGDSVYFN 167

Query: 122 NDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKN 181
           NDSY SA+L CGGAIEACKA+V+G+VKNSLA+VRPPGHH+EP+ AGGFCLFSNVAVA KN
Sbjct: 168 NDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKN 227

Query: 182 ILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQV 241
           ILKNYP+ V+++MI+DWDIHHGNGTQK+FY DD+VLYVSLHRFE+GKYYPGTI GQYDQ 
Sbjct: 228 ILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQT 287

Query: 242 GEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGK 301
           GEGKGEGFNCNI W VGG+GDAEY+WAFEQ+VMPMGREF+PDLVI+SSGFDAADGDTIG+
Sbjct: 288 GEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQ 347

Query: 302 CHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDK 361
           CHVTPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIARSAL+VAKVLIGEPPDELP P  
Sbjct: 348 CHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLS 407

Query: 362 DPKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQ 421
           DPKPE IEMID+VI L+SKYW CF+R+  NS C +  PI++S  +K FP+Q AIR QQ  
Sbjct: 408 DPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQQH 467

Query: 422 YLTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSA 481
           YL++++N V LPL++ +LP++TV+C+ +I +SN  II VHDT +IW+KR+ I+G ID S+
Sbjct: 468 YLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSS 527

Query: 482 SLYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNV 541
           S+ +D SL F  W LDR YGIIDVNIP TL+E DNYS  +T+QEVLI LWDN +KYFP+V
Sbjct: 528 SVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSV 587

Query: 542 NKIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSL 601
            KIA+IG+G++YSG+VHLLGHRDTR+V K+VI F+G K LK LVPLV+E+L++WYFK SL
Sbjct: 588 AKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSL 647

Query: 602 LFADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659
           +F++ +H CW EN+S+KPRK++GRVLRCD+DG+ ++IEERFEEATDFI+DS +EW++E
Sbjct: 648 IFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDE 705

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1057 bits (2734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/656 (72%), Positives = 576/656 (87%)

Query: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62
           + + YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI+DP L
Sbjct: 32  AQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTL 91

Query: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNN 122
           SGIDDIGDLM KIPVREATSEEILEVH KE L+++E T  +NR++LL  TE GDSVYFN+
Sbjct: 92  SGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNS 151

Query: 123 DSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNI 182
           DSY SAKL  GGAIEACKA+V+G+VKN+LA+VRPPGHH+EPE AGGFCLFSNVA+A KNI
Sbjct: 152 DSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNI 211

Query: 183 LKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVG 242
           LKNYP+ V+K++I+DWDIHHGNGTQKAFY+DDR+LYVSLHRF++GKYYPGTIHG+YDQ G
Sbjct: 212 LKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTG 271

Query: 243 EGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKC 302
           EGKGEGFNCNI W VGG+GDAEY+WAFEQIVMPMGREF+PDLVI+S+GFDAADGDTIG+C
Sbjct: 272 EGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQC 331

Query: 303 HVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362
           HVTPSCYGHMTHMLKSLA G + VVLEGGYNLD+IA SAL+VAK+LIGEPPDELP   +D
Sbjct: 332 HVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPPDELPDVTRD 391

Query: 363 PKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQY 422
           PKPE IEMID+V+ ++SKYWKCFK +  N+ C+++  I+ S   K FP+Q AIR QQ++ 
Sbjct: 392 PKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQSAIRQQQVRN 451

Query: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482
           L+ ++N   LP+  S LPEDT++CS++I +SN  II VHDTPEIW+KRDAI G ID S+S
Sbjct: 452 LSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTIDPSSS 511

Query: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542
           + +D+SL    WA++R YG+ID+NIPQ L EQ+NY + +TAQEVLI LWDN LKYFPNVN
Sbjct: 512 IIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDNYLKYFPNVN 571

Query: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602
           KIA++G+G+AYSG+VHLLGHRDTRSVVK+VI FVG+K LK LVPLV+ESL +WYFK SL+
Sbjct: 572 KIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLV 631

Query: 603 FADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
           F++KNH  WG+ ++KKPRK+YGRVLRCD+DGI +++EERFEEATDFI+DS +EW++
Sbjct: 632 FSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSD 687

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/655 (71%), Positives = 573/655 (87%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           + Y+PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 51  IHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG 110

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +DDIGDLM KIPVR ATSEEILEVH KE LE++E T+ ++R++LL +TE GDSVYFNNDS
Sbjct: 111 VDDIGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDS 170

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           Y SA+L CGGAIEACKA+V+G+VKNSLA+VRPPGHH+EP+ AGGFCLFSNVAVA KNILK
Sbjct: 171 YASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILK 230

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+++MI+DWDIHHGNGTQK+FY DD+VLYVSLHRFE+GKYYPGTI GQYDQ GEG
Sbjct: 231 NYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEG 290

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNI W VGG+GDAEY+WAFEQ+VMPMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 291 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHV 350

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           +PSCYGHMTHMLKSLA G LCVVLEGGYNLDAIARSAL+VAKVLIGEPPDELP    DPK
Sbjct: 351 SPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPK 410

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PE IEMID+VI L+SKYW CF+R+  NS C +  PI++S  +K FP+Q AIR QQ+QYL+
Sbjct: 411 PEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLS 470

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
           N+++ V LPL+N  LP++T +C+ ++ +SN  ++ VHDT ++W+KR+ I+G ID S+S+ 
Sbjct: 471 NEFSFVTLPLINMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVI 530

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
           +D  + F  W LDR YGIIDVNIP TL+E DNYS  +T+QEVLI LWDN +KYFPNV KI
Sbjct: 531 IDNCIDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKI 590

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           A+IG+G+++SG+VHLLGHRDTR+V K+VI F+G K LK LVPLV+E+L++WYFK SL+F+
Sbjct: 591 AFIGIGDSHSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFS 650

Query: 605 DKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659
           + +H CW EN+S+KPRK++GRVLRCD+DG+ + IEERFEEATDFI+DS +EW+++
Sbjct: 651 NNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDD 705

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1053 bits (2722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/654 (72%), Positives = 573/654 (87%), Gaps = 1/654 (0%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           + YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 53  IHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG 112

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
            DDIG+LM KIPVREAT EE+L+VH KE LE++EKT  +NR+ELL +TE GDSVYFN+DS
Sbjct: 113 EDDIGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDS 172

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           Y +AKL CGGAIEACKA+V+G+VKN+LA++RPPGHH+EPE+AGGFCLFSNVAVA +NILK
Sbjct: 173 YSAAKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILK 232

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V++++I+DWDIHHGNGTQKAFYNDDRVLY+SLHRFELGKYYPGTIHGQYDQ GEG
Sbjct: 233 NYPESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEG 292

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNI W VGG+GDAEY+ AFEQIVMPM RE+RPDLVI+SSGFDAADGDTIG+CHV
Sbjct: 293 KGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHV 352

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           +PSCYGHMTHMLKSLA G LCV LEGGYNLDAIA SAL+VAK+LIGEPP+ELP P K+PK
Sbjct: 353 SPSCYGHMTHMLKSLARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPK 412

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
            EAIEMID+VI ++SKYWKCF+R + NS C +K P++ES   K FP+Q AIR +Q   L 
Sbjct: 413 LEAIEMIDKVIHVQSKYWKCFRR-LGNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLE 471

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
            +Y  V LP+    LPEDTV+CS D+ Q +  II+VHDTPEIW+KRD I G+ID S S+ 
Sbjct: 472 KEYGFVTLPVPKLELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSIT 531

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
           +D+ L F  W+L R YG+IDVNIPQ+L+EQDNYSA +T+QEVLI LWDN +KYFP+++K+
Sbjct: 532 VDSPLDFIKWSLARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKV 591

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           A++GVG+AYSG+VHLLGHRDTRSVVK+VI FVG+K LK LVPLV+ESL DWYFK SL+F+
Sbjct: 592 AFVGVGDAYSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFS 651

Query: 605 DKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
           D+N+ CW +N++KKPR+++GRVLRC+SDGI + +EERF+EATDFI+DS +EW++
Sbjct: 652 DRNNPCWVDNENKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSD 705

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/655 (71%), Positives = 569/655 (86%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           L YTPL+TGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 51  LHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG 110

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +DD+GDLM KIPVR ATSEEILEVH KE LE++E T+ ++R++LL +TE GDSVYFNNDS
Sbjct: 111 VDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDS 170

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           Y SA+L CGGAIEACKA+V+G+VKNSLA+VRPPGHH+EP+ AGGFCLFSNVAVA KNILK
Sbjct: 171 YASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILK 230

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+++MI+DWDIHHGNGTQK+FY DD+VLY+SLHRFE+GKYYPGTI GQYDQ GEG
Sbjct: 231 NYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEG 290

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNI W VGG+GDAEY+WAFEQ+VMPMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 291 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHV 350

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           TPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIA SAL+VAKVLIGEPPDELP P  DPK
Sbjct: 351 TPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPK 410

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PE IEMID+V+ L+SKYW CF+R+  NS C +  PI++S  +K FP+Q AIR QQ+ YL+
Sbjct: 411 PEVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLS 470

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
           +++N V LPL+N  LP++ V+C+ ++ +S+  ++ VHDT ++W+KR+ I+G ID S+S+ 
Sbjct: 471 DEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVV 530

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
           +D  L F  W LDR YGIIDVNIP TL+E DNYS  +T+QEVLI LWDN +KYFP V KI
Sbjct: 531 IDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKI 590

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           AYIG+G++YSG+VHLLGHRDTR+V K+VI F+G K LK LVPLV+E+L +WYFK SL+F 
Sbjct: 591 AYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFT 650

Query: 605 DKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659
           + +H CW EN+S+KPRK++GRVLRCD+DG+ + +EERFEEATDFI+DS +EW++E
Sbjct: 651 NNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDE 705

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1051 bits (2718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/655 (71%), Positives = 572/655 (87%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           + Y+PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 51  IHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG 110

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +DD+GDLM KIPVR ATSEEILEVH KE LE++E T+ ++R++LL +TE GDSVYFNNDS
Sbjct: 111 VDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDS 170

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           Y SA+L CGGAIEACKA+V+G+VKNSLA+VRPPGHH+EP+ AGGFCLFSNVAVA KNILK
Sbjct: 171 YASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILK 230

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+++MI+DWDIHHGNGTQK+FY DD+VLYVSLHRFE+GKYYPGTI GQYDQ GEG
Sbjct: 231 NYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEG 290

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNI W VGG+GDAEY+WAFEQ+VMPMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 291 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHV 350

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           TPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIARSAL+VAKVLIGEPPDELP    DPK
Sbjct: 351 TPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPK 410

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PE IEMID+VI L+SKYW CF+R+  NS C +  PI++S  +K FP+Q AIR QQ  YL+
Sbjct: 411 PEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLS 470

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
           +++N+V LPL+N +LP++TV+C+ ++ +S   ++ VHDT +IW+KR+ I+G ID S+S+ 
Sbjct: 471 DEFNLVTLPLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVI 530

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
           +D  L F  W LDR YGIIDVNIP +L+E DNYS  +T+QEVLI LWDN +KYFP V KI
Sbjct: 531 IDNCLDFIKWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKI 590

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           A++G+G++YSG+VHLLGHRDTR+V K+VI F+G K LK LVPLV+E+L++WYFK SL+F+
Sbjct: 591 AFVGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFS 650

Query: 605 DKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659
           + +H CW EN+S+KPRK++GRVLRCD+DG+ + IEERFEEATDFI+DS +EW++E
Sbjct: 651 NNSHQCWKENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDE 705

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/656 (70%), Positives = 565/656 (86%), Gaps = 2/656 (0%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           + YT LKTGLCYDVRMRYHAKIYTSY+EYIDPHPEDPRRIYRIYKILAENGLIRDP LSG
Sbjct: 55  IHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSG 114

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +D+IG+LM KIPVREAT+EEIL+VH KE L +LEKT  + R++LL +TE GDSVYFNNDS
Sbjct: 115 VDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDS 174

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
             SAKLSCGGAIEACKA+V+G+VKN+LA++RPPGHH+EPE+AGGFCLFSNVAVA +NILK
Sbjct: 175 LLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILK 234

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+++MI+DWDIHHGNGTQKAFY+D+RVLYVSLHR+ELGKYYPGT+HG Y+Q GEG
Sbjct: 235 NYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEG 294

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNIPW  GG+GDAEY+WAF+Q+VMPMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 295 KGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHV 354

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           +PSCYGHMTHMLKSLA G LCVVLEGGYNLD+IA+SAL VAK+LIGEPPDELP P + PK
Sbjct: 355 SPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPK 414

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PEAIE I+ VI  +SKYW CFK   +N  C +K  ++ES  +K FP+Q AIR +Q+Q L+
Sbjct: 415 PEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLS 474

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
             +  V LPL+N  +P+DTV+CS +I  +   ++ VHDTPEIW++R+ I G ID S S+ 
Sbjct: 475 EKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSII 534

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
           +D +L    W+L R Y +IDVNIPQ+L+EQDNYSA +T+QEVL+ +WDN LKYFP++ K+
Sbjct: 535 VDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKV 594

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           A+IGVG+AYSG+VHLLGHRDTRSVVK+ + FV  KPLK+LVPLV+ESL +WYFK SL+F 
Sbjct: 595 AFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFT 654

Query: 605 DKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
            KNHSCWG   N++KKPRKR+GRVL+CD+ G+ +++EERF+EATDFI+DS +EW++
Sbjct: 655 SKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSD 710

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/656 (71%), Positives = 563/656 (85%), Gaps = 2/656 (0%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           L YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 36  LRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSG 95

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           IDDIGDLM KIPVREATS+E+LEVH KE LE++E    ++ DELL  TE GDSVYFNNDS
Sbjct: 96  IDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDS 155

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
             SAKLSCGGAIEACKA+V+G+VKN+ A+VRPPGHHSEPE AGGFCLFSNVAVA+KNIL+
Sbjct: 156 SSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILR 215

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+++MI+DWDIHHGNGTQKAFY+DDRVLY+SLHRFELGKYYPGT  G YD+ GEG
Sbjct: 216 NYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEG 275

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNI W VGG+GDAEY+WAFEQ+VMPM REFRPDLVI+S+GFDAADGDTIG+CHV
Sbjct: 276 KGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHV 335

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           +PSCYGHMTHMLKSLANG LCVVLEGGYNLDAIARSAL+VAKVLIGEPP+EL  P KDPK
Sbjct: 336 SPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPK 395

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PEAIE+I++VI L+SKYWKCF+R+  NS C ++  ++ES     FP+Q AIR QQ   L+
Sbjct: 396 PEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALS 455

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
            ++  V  PL    L +DTV+CS ++   +  II V DTPEIW+KRD I G ID SAS+ 
Sbjct: 456 KEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASII 515

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
            DA+L F  WA++R YG+IDVNIPQ+L+EQDNYSA +TAQEV+  +WDN +++F + +KI
Sbjct: 516 TDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKI 575

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           A++GVG+A SG+VHLLGHRDTRS VKSVI F+ +K LK L+PLV+E+L DWYFK SL+F+
Sbjct: 576 AFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFS 635

Query: 605 DKNHSCWG--ENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
           DKNH+CWG  EN++KKPRK++GRVLRC+SDG+ ++IEERFEEATDF++DS +EW+E
Sbjct: 636 DKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSE 691

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1036 bits (2680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/655 (70%), Positives = 563/655 (85%)

Query: 4   SLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALS 63
           +L YTPLKT LCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYR+YKILAENGLI DP LS
Sbjct: 58  NLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLS 117

Query: 64  GIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNND 123
           GID+IGDLM KIPVREAT EEILEVH KE LE++E++  + R+ELL +TE GDSVYFNND
Sbjct: 118 GIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNND 177

Query: 124 SYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNIL 183
           SY SAKLSCGG I+ACKA+V+G+VKN+LA+VRPPGHH+EPE  GGFCLFSNVAVA +NIL
Sbjct: 178 SYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNIL 237

Query: 184 KNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGE 243
           K YP+ V++++I+DWDIHHGNGTQKAFYND RVLY+SLHRFE+GKYYPGTI+G+YDQ GE
Sbjct: 238 KQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGE 297

Query: 244 GKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCH 303
           GKGEGFNCNI W VGG+GDAEY+ AFEQIVMPM REF+PDLVI+SSGFDAADGDTIG+CH
Sbjct: 298 GKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCH 357

Query: 304 VTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDP 363
           VTPSCYG MTHMLKSLA G LCV LEGGYNLDAIA SAL+VAKVLIGEPPDELP P KDP
Sbjct: 358 VTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDP 417

Query: 364 KPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYL 423
           K EAIEMID VI  +SKYWKCF+R+  N+ C +  P++E+  +K FP+Q AIR +Q + L
Sbjct: 418 KLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQL 477

Query: 424 TNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASL 483
           + +Y  V LP+    +P+D+V+CS ++ Q +  +I VHDTPEIW+KRD I GVID S S+
Sbjct: 478 SKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSI 537

Query: 484 YMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNK 543
            +D+ L F  W ++R YG+IDVNIPQ+L+EQDNYSA +T+QEVL+ +WDN +KYFP++ K
Sbjct: 538 IVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAK 597

Query: 544 IAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLF 603
           +A++G G+AY+G+VHLLGHRDTR+ VK+V+ F+G+K LK LVPLV+ESL+DWYFK SL+F
Sbjct: 598 VAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIF 657

Query: 604 ADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
            DKNH CW +N+SKKPRK++GRVLRCD+DG+ S +EERFEEATDFI+D  +EW++
Sbjct: 658 TDKNHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSD 712

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1032 bits (2669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/656 (69%), Positives = 567/656 (86%)

Query: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62
           + + YTPLKTG+CYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP L
Sbjct: 36  AQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTL 95

Query: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNN 122
           SG++DIGDLM KIP+R AT+EEILEVH KE LE++EKT+ +NR+ELL +TE GDSVYFNN
Sbjct: 96  SGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNN 155

Query: 123 DSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNI 182
           DSY +++L CGGAIEACKA+V+G+VKNSLA+VRPPGHH+EPE AGGFCLFSNVAVA KNI
Sbjct: 156 DSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNI 215

Query: 183 LKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVG 242
           LKNYP+ V++++I+DWD+HHGNGTQKAFY+DDRVLY+SLHRFELGKYYPGTI GQYDQ+G
Sbjct: 216 LKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIG 275

Query: 243 EGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKC 302
           EGKG+GFNCNI W VGG+GDAEY+WAFEQ+VMPMGREF+PDLVI+SSGFDAADGDTIG+C
Sbjct: 276 EGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQC 335

Query: 303 HVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362
           HVTPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIA SAL+VAK+LIGEPPDELP P ++
Sbjct: 336 HVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLRE 395

Query: 363 PKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQY 422
           PK EA+E+ID+VI L+SKYWKCF ++  N     +  +     +K FP+Q AIR +Q   
Sbjct: 396 PKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQ 455

Query: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482
           L+ D+  V LPL+N  +P+D+V+CS ++      ++ VHDTPEIW+KR+ I G ID S S
Sbjct: 456 LSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTS 515

Query: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542
           L +D+  +F  W L+R YGI+D+NIPQ+L+EQ+NY+A LT+QE+LI +WDN LK+FP++ 
Sbjct: 516 LVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLT 575

Query: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602
           K+A+IG+G+A +G+VHLLGHRDTRSVVKSV+ F+GKK LK LVPLV ESL DWYFK SL+
Sbjct: 576 KVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLV 635

Query: 603 FADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
           F D +HSCWG+N+++KPRK++GRVLRCD++G+ ++IEER EE+TDFI+DS +EW++
Sbjct: 636 FTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSD 691

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/658 (69%), Positives = 560/658 (85%), Gaps = 3/658 (0%)

Query: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62
           + L YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP L
Sbjct: 50  AKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTL 109

Query: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNN 122
           SG+DDIGDLM KIP REAT EEIL+VH  E LE+L KT  + R++LL +TE GDSVYFNN
Sbjct: 110 SGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNN 169

Query: 123 DSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNI 182
           DSY SAKLSCGGAIEAC+A+V+G+VKN+LA+VRPPGHH+EP++AGGFCLFSNVAVA +NI
Sbjct: 170 DSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNI 229

Query: 183 LKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVG 242
           LKNYP+ VKK+MI+DWD+HHGNGTQKAFYNDDRVLYVSLHR ELGKYYPGTIHG  D+VG
Sbjct: 230 LKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVG 289

Query: 243 EGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKC 302
           EGKGEGFNCNIPW   G+GDAEYIWAFEQ+V+PMGREF+PDLVI+SSGFDAADGDT+G+C
Sbjct: 290 EGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQC 349

Query: 303 HVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362
           HVTPSCYGHMTHMLKSLA G +C VLEGGY+LD+IA+SAL VAKVLIGEPPDELP   K 
Sbjct: 350 HVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVV-KQ 408

Query: 363 PKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQY 422
           PKPEA+E+ID VI ++S+YW+CFK    N  C +K P++E+   + FP+Q AIR QQ++ 
Sbjct: 409 PKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRL 468

Query: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482
           LT +YN V LPL+   LP+DT +CS +I  S   I+ VHDTPEIW++R    G ID S S
Sbjct: 469 LTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTS 528

Query: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542
           + +D +L    WA  R YG+ID+NIPQ+L+EQDNYSA LTAQEVL+ +WD+ LKYF +++
Sbjct: 529 IIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLS 588

Query: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602
           K+A++ +G+AYSG+VHLLGHRDTR+VVK+ I F+ ++PL+ LVPLV+ESLADWYFK SL+
Sbjct: 589 KVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLV 648

Query: 603 FADKNHSCWGEN--DSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
           FA   H+CWG +  ++KKPRK++GRVL+C+SDG+ +++EERFEEATDFI+D+ +EW++
Sbjct: 649 FASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSD 706

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/656 (69%), Positives = 557/656 (84%), Gaps = 3/656 (0%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           L YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 52  LHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSG 111

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +D IGDLM KIPVREAT EEIL+VH KE LE++ KT  + RD+LL +TE GDSVYFNNDS
Sbjct: 112 VDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDS 171

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           Y SAKLSCGGAIEACKA+V+G+VKN+LA+VRPPGHH+EPEVAGGFCLFSNVAVA +NILK
Sbjct: 172 YLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILK 231

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+K+M++DWD+HHGNGTQKAFY+DDRVLY+SLHR ELGKYYPGTIHG  D+VGEG
Sbjct: 232 NYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEG 291

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNIPW   G+GD+EY+WAFEQ++MPMGREFRPDLVI+SSGFDAADGDT+G+CHV
Sbjct: 292 KGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHV 351

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           TPSCYGHMTHMLKSLA G LC VLEGGY+LD+IA+SALAVAKVLIGEPPDELP   K PK
Sbjct: 352 TPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVV-KQPK 410

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
            EA+E+ID VI  +SKYWKCFK    N  C +K   +++   K FP+Q+AIR QQ++ L 
Sbjct: 411 LEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLA 470

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
           N++  V LPL    LP+DT +CS +I  ++  I+ VHDTP IW++R    G ID S S+ 
Sbjct: 471 NEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSII 530

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
           +D +L    WA  R YG+ID+NIPQ+L+EQDNYSA +TAQEVL+ +WDN LKYFP++N++
Sbjct: 531 VDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRV 590

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           A++ +G+A+SG+VHLLGHRDTRSVVKS + FV ++PL+ L+PLV+E+LADWYFK SL+FA
Sbjct: 591 AFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFA 650

Query: 605 DKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
              H+CWG   N++KKPRK++GRVL+CDSDGI +++EERFEEATDFI+D+ +EW++
Sbjct: 651 SAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSD 706

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/656 (68%), Positives = 554/656 (84%), Gaps = 2/656 (0%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           + Y PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 49  IHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSG 108

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +DDIG+LM KIP+REAT +EIL VH KE +E+L+ T  ++R++LL +TE GDSVY+NNDS
Sbjct: 109 VDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDS 168

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
             SAKLSCGGAIEACKA+V+G+VKN+LA+VRPPGHH+EPEVAGGFCLFSNVAVA +NILK
Sbjct: 169 LVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILK 228

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+KVMI+DWDIHHGNGTQ+AFYND+RVLYVSLHR+ELG+YYPGT +G Y+Q GEG
Sbjct: 229 NYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEG 288

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNIPWS GG+GDAEY+WAFEQIV+PMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 289 KGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 348

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           +P+CYGHMTHMLKSLA G +CVVLEGGYNLD+IA+SAL V KVLIGEPPDELP P K PK
Sbjct: 349 SPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPK 408

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PEAI  I+ VI  ++KYW CFK +  N    +K P+ ES   K FP+Q A+R +Q + L+
Sbjct: 409 PEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLS 468

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
            +Y  V LPL++  L  DT++CS +I +++  II VHDTPE+W+KR+ + G ID S S+ 
Sbjct: 469 KEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSII 528

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
           +D +L   +WAL R YGIID+NIPQ+L+E DNYSA LT+QEVL  LWD+ LK+F  + ++
Sbjct: 529 VDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRV 588

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           A++G+G+AYSG VHLLGHRDTRS+VK  I F  KK L+ LVPLV+ES++DWYFK SL+F 
Sbjct: 589 AFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFT 648

Query: 605 DKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
            K HSCWG   NDSKKPRK++GRVL+C+SDG+ +++EERFEEATDFI+DS +EW++
Sbjct: 649 SKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSD 704

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/658 (69%), Positives = 548/658 (83%), Gaps = 4/658 (0%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           + Y PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI D  LSG
Sbjct: 43  VHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSG 102

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +DDIGD+M KIPVREAT++EILEVH +E LE+LE T  +NR+ LL +TE GDSVYFNNDS
Sbjct: 103 VDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDS 162

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           Y SAKLSCGGAIEACKA+V+GKVKN+LA+VRPPGHHSEPE +GGFCLFSNVAVA KNILK
Sbjct: 163 YMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILK 222

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+K+MI+DWDIHHGNGTQKAFY D+RVLYVSLHRFE GKYYPGT+ GQYDQ GEG
Sbjct: 223 NYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEG 282

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNI W  GG+GDAEY+WAFEQIVMPMGREF+PDLVI+SSGFDAADGD IG+CHV
Sbjct: 283 KGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHV 342

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           TPSCYGHMTHMLKSLA G L VVLEGGYNLD+IA SAL+VAK LIGEPPDELP P KDPK
Sbjct: 343 TPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPK 402

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PEA+EMI +VI ++SKYWKCFKR+  N N  +    S++   K FP+Q AIR QQ   L 
Sbjct: 403 PEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLF 462

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
            +Y+ V  P  N  LP+D ++CS +I  +   II VHDTP+IW ++D I+  +D  +S+ 
Sbjct: 463 KEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSII 522

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLY----EQDNYSASLTAQEVLIKLWDNNLKYFPN 540
           +D++L F  WA +R YGIIDVNIPQ+L       DNYS+ + AQE+L+ LWDN++K+   
Sbjct: 523 IDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNE 582

Query: 541 VNKIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTS 600
           VNKIA+IGVG++ SG+VHLLGHRDT+  VK+VI F+  K LK LVPLV+ESL+DWYFK S
Sbjct: 583 VNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNS 642

Query: 601 LLFADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
           L+F+++ H CWG+ ++KKPRK+YGRVLRCD+DG+ S IEERF+EATDFI+DS +EW++
Sbjct: 643 LVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSD 700

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/656 (67%), Positives = 547/656 (83%), Gaps = 2/656 (0%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           + Y+ LKTG+CYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYR+YKILAENGLI+DP LSG
Sbjct: 47  IRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSG 106

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
            D IGDLM K+PVREA  EEIL+VH ++ L+++ +T+ L R+ LL +TE GDSVYFNNDS
Sbjct: 107 ADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDS 166

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           Y SAKLSCGGAIEACKA+V+G+VKNS+A+VRPPGHH+EPE+AGGFCLFSNVAVA  N+LK
Sbjct: 167 YLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLK 226

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           +YP+ V+K+MIVDWDIHHGNGTQKAFY+DDRVLYVSLHR++LGKYYPGTIHG YDQ GEG
Sbjct: 227 SYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEG 286

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNI W  GG+GDAEY+WAFEQ++MPMGREF PDLV++SSGFDAADGDTIG+CHV
Sbjct: 287 KGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHV 346

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           TP+CYGHMTHML SLA G LCVVLEGGYNLD+IA+SAL V KVL+GEPPDELPAP K P 
Sbjct: 347 TPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPT 406

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PEA +MI+ VI  +SKYW CFK +  N    +K  I+ +   + FP+Q+AIR  Q+  L+
Sbjct: 407 PEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLS 466

Query: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484
           + +N V LP+++ NLP +T++C++ I  S   ++ VHDTPEIWS+RD   G+ID S+S+ 
Sbjct: 467 SQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSII 526

Query: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544
           +D +L+  +WA+DR YGIID+NIPQTL+E  NY    ++QE+LI LWDN LK+F N+ K+
Sbjct: 527 VDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKV 586

Query: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604
           A+IG+G+AY G+VHLLGHRDTRSVVK  I F+ KKPLK +VPL++E+L DWYFK SL+F 
Sbjct: 587 AFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFT 646

Query: 605 DKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
              HSCWG   N++KK RK+YGRVL+ D DG+ ++ +ERFEEATDFI+DS +EW+E
Sbjct: 647 SSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSE 702

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/655 (67%), Positives = 548/655 (83%), Gaps = 2/655 (0%)

Query: 4   SLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALS 63
           +L YTPLKTG+CYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP+L+
Sbjct: 45  NLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLT 104

Query: 64  GIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNND 123
           G+ DIGDLM KIPVREAT EEIL+VH +E +++LE T+ + R+ELLSKTE GDSVY NND
Sbjct: 105 GVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNND 164

Query: 124 SYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNIL 183
           SY SA+LSCGGAIEACKA+V+G+VKN+LAIVRPPGHH+EP+ AGGFCLFSNV+VA K+IL
Sbjct: 165 SYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSIL 224

Query: 184 KNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGE 243
           K YP+ V+K++IVDWDIHHGNGTQKAFY DD VLY+SLHRFELGK+YPG   G YD+VG+
Sbjct: 225 KTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGD 284

Query: 244 GKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCH 303
           GKG+GFNCNI W V G+GD EYIWAFEQIV+PM REFRPDLVIVSSGFDAA GDTIG+CH
Sbjct: 285 GKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCH 344

Query: 304 VTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDP 363
           VTP+CYG+MTHMLKSLA G LCVVLEGGYNLD+I+ SALAVAK+LIGEPPDE+P  D+DP
Sbjct: 345 VTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDP 404

Query: 364 KPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYL 423
           KP  +EMI++VI ++SKYWKCF+R+  N   EY+  I ES   K FP+QDAIR  Q+ + 
Sbjct: 405 KPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHY 463

Query: 424 TNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASL 483
            +D+ M+ L L N NLP+++++CS++  ++    + +HDTPE+W  RD I G+ID S S+
Sbjct: 464 YDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSI 523

Query: 484 YMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNK 543
             D+SL+F +WA++R   +ID+NIP++ +E DNYS++L +Q+V+I LWDN+ KY  ++ K
Sbjct: 524 IFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEK 583

Query: 544 IAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLF 603
           + +IG+GEA SG+VHLLG RDTR+V K+ I FVG   LK +VP ++ESL DWYFK SL+F
Sbjct: 584 LCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVF 643

Query: 604 ADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
            D  H CW END KKPRK+YGRVLRCD+DGI ++IEERFEEATDFI+D+ DEW++
Sbjct: 644 TDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSD 697

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/659 (67%), Positives = 546/659 (82%), Gaps = 5/659 (0%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           +SY PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 45  ISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSG 104

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           ID+IG+LM KIPVREAT EEIL VH KE +E+L+ T  ++R++LL +TE GDSVY+NNDS
Sbjct: 105 IDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDS 164

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
             SA+LSCGGAIEACKA+V+G+VKN++A+VRPPGHH+EP VAGGFCLFSNVAVA +NILK
Sbjct: 165 LISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILK 224

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V++VMI+DWDIHHGNGTQKAFY D+RVLYVSLHR+ELGKYYPGT +G YDQ G+G
Sbjct: 225 NYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDG 284

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNIPWS  G+GDAEY+WAFEQ+V+PMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 285 KGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 344

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           +P+CYGH+THMLKSLA G +CVVLEGGYNLD+IA+SAL VAKVLIGEPPDELP P K PK
Sbjct: 345 SPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPK 404

Query: 365 PEAIEMIDR-VIDLKSKYWKCFKRQITNSNCEYK-GPISESFFAKKFPIQDAIR-AQQIQ 421
           PEAI  ID  ++  +SKYW CFK +  N    ++ G +++S  +K FP+Q       Q +
Sbjct: 405 PEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFR 464

Query: 422 YLTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSA 481
            L  +Y  V LPL+N  LP DT++CS +I  ++  II VHDTPEIW++RD++ G ID S 
Sbjct: 465 RLAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPST 524

Query: 482 SLYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNV 541
           S+ +D ++   +WAL R YG+ID+NIPQ+L+EQDNYSA L++QEV+  LWD+ LK FP++
Sbjct: 525 SIIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHL 584

Query: 542 NKIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSL 601
            ++A++G+G+AYSG VHLLGHRDTRSVVK  I F  KK L+ LVPLV+ESL DWYFK SL
Sbjct: 585 ARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSL 644

Query: 602 LFADKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658
           +F    H CWG   NDSKKPRK++GRVLR   DG+ +++EER EEATDFI+DS +EW+E
Sbjct: 645 VFTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSE 703

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/432 (76%), Positives = 380/432 (87%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           + Y PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 52  IHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG 111

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +D+IGDLM K+P+REAT  EILEVH  E  +YLEKT   NR++LL +TE GDSVYFNNDS
Sbjct: 112 VDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDS 171

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           + SAKLSCGGAIEACKA+V+G+VKN++A+VRPPGHHSEPE AGGFCLFSNVAVATKNILK
Sbjct: 172 FQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILK 231

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
           NYP+ V+KV+I+DWDIHHGNGTQKAFYNDD VLY+SLHRFELGKYYPGTI GQYDQ GEG
Sbjct: 232 NYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEG 291

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           KGEGFNCNI W +G +GDAEY+WAFEQ+VMPM REF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 292 KGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHV 351

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364
           +PSCYGHMTHMLKSLA G LCVVLEGGYNLDAIARSAL+V+K+LIGEPPDELP P KDPK
Sbjct: 352 SPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPK 411

Query: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424
           PE IEMID++I L+SKYWKCF+R+  N  C +K  I++S  +K FP+Q AIR  Q + L 
Sbjct: 412 PEVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLF 471

Query: 425 NDYNMVPLPLMN 436
           ++ N + LP+ N
Sbjct: 472 DELNFLTLPIKN 483

 Score =  318 bits (815), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 185/223 (82%)

Query: 437 SNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLYMDASLQFYDWAL 496
           S L E+T++CS  I++S   ++ VHD+P++W+KRD   GV+D S+++ +D++L F  W+L
Sbjct: 572 SPLNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSL 631

Query: 497 DRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKIAYIGVGEAYSGL 556
           DR YG+ID+NIPQTL+EQDNYS+ L AQE L+  WDN LKYFP + KI +IG G+A++G+
Sbjct: 632 DRNYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGI 691

Query: 557 VHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFADKNHSCWGENDS 616
           VHLLGHRDTRSVVKSVI F+GKKPLKALVPLV+E+L+DWYFK SL+F DKNH  W +N++
Sbjct: 692 VHLLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNEN 751

Query: 617 KKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659
           KKPRK++GRVLR   DGI +LIEERF+EATDFI+DS +EW++E
Sbjct: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDE 794

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  486 bits (1251), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 215/286 (75%), Positives = 255/286 (89%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           L YTPLKTGLCYDVRMRYHAKI+TS +EYIDPHPEDPRR+YRIYKILAENGLI+D  LSG
Sbjct: 64  LHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSG 123

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124
           +DDIGD+M KIPVR AT EEIL VH +E L+++E  +  +R+EL+  TE  DSVY+NNDS
Sbjct: 124 LDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKADSVYYNNDS 183

Query: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184
           Y+SAKLSCGG IEAC+A+V+G+VKNSLAIVRPPGHH+EP+ AGGFCLFSNV+VA ++IL+
Sbjct: 184 YYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILR 243

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
            YP+ V+K++I+DWDIHHGNGTQKAFY D+ VLY+SLHR+E   +YPGTIHG+YDQVGEG
Sbjct: 244 TYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEG 303

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSG 290
           KGEGFNCNI W VGG+GDAEY+WAFE +VMP+GREFRPDLVIVSSG
Sbjct: 304 KGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  259 bits (662), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 162/219 (73%)

Query: 441 EDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLYMDASLQFYDWALDRGY 500
           E  V+ S  I ++   +I VHDTPE+W  RD I GV+D S S+ +D S++F  WA DR Y
Sbjct: 357 EKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNY 416

Query: 501 GIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKIAYIGVGEAYSGLVHLL 560
            I+D+NIP++  E++ +S+S  A E+++ LWDN+L+Y   + KI +IG+GE+Y G+VHL+
Sbjct: 417 SILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLI 476

Query: 561 GHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFADKNHSCWGENDSKKPR 620
           G RD R + K+VI FVG  PLK+L    +E++ DWYFK SL+F + +H+CW E++ K+PR
Sbjct: 477 GERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPR 536

Query: 621 KRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659
           K++GRVL+ DSDGI S+I ERF+EATDFI+D+ +EW++E
Sbjct: 537 KKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDE 575

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 103/355 (29%), Positives = 179/355 (50%), Gaps = 33/355 (9%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  Y  R+ YH     S Y Y   HP  P      ++ +  + L+    L  I D+ +  
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKP------FRFMLTDHLVSSYGLHNIMDLYE-- 73

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSA 128
                REAT EE+L+ H ++ +E+L K    N  ++      K  +GD      + Y   
Sbjct: 74  ----TREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYEYC 129

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
           KL  G +++A + +++ +  + +AI    G HH++     GFC  +++ +AT N+L+ +P
Sbjct: 130 KLYAGASLDASRKLINDQ--SDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYHP 187

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G YD++G  +G+
Sbjct: 188 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAEGK 240

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F  N+P +  GI D  YI  F+ ++ P+   F+P  +I   G D+   D +G  ++   
Sbjct: 241 HFAMNVPLN-DGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLNIK 299

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELP 357
            +G     ++S     + VV  GGY    ++R     + +    +L  E P+++P
Sbjct: 300 AHGECVKFIRSFGI-PMVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDMP 353

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  150 bits (380), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 178/358 (49%), Gaps = 33/358 (9%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  Y  R+ YH     S Y Y   HP  P R+     +++  GL +            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSA 128
                REAT EE+ + H ++ +E+L K    N  ++    L K  +GD      + Y  +
Sbjct: 71  DLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNIYDYS 130

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
            L  G +++A + +++ +  + +AI    G HH++     GFC  +++ ++  N+L+ +P
Sbjct: 131 TLYTGASLDASRKLINDQ--SDIAINWSGGLHHAKKNNPSGFCYVNDIVLSILNLLRYHP 188

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  +S H+F  G+++PGT  G +D++G  KG+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDFDEIGCAKGK 241

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F  N+P    GI D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++   
Sbjct: 242 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLGHDRLGCFNLNIK 300

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELPAPD 360
            +G     +KS     + VV  GGY    ++R     + +    +L  E P+E+P  D
Sbjct: 301 AHGECVKFVKSFGI-PMLVVGGGGYTPRNVSRLWTYETGVLNNVLLPSEIPEEIPFRD 357

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  150 bits (378), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/365 (29%), Positives = 178/365 (48%), Gaps = 33/365 (9%)

Query: 6   SYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGI 65
           +Y P + G  Y   + YH     S Y Y   HP  P R+     +++  GL +       
Sbjct: 13  TYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGLHK------- 65

Query: 66  DDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFN 121
                +M     REAT +E+LE H  + +E+L K       ++    L K  +GD     
Sbjct: 66  -----IMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIF 120

Query: 122 NDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATK 180
              +  + L  G +++A + ++ G+  + +AI    G HH++     GFC  +++ +A  
Sbjct: 121 QGIFEYSSLYAGASLDASRKLIAGQ--SEIAINWSGGLHHAKKAKPSGFCYVNDIVLAIL 178

Query: 181 NILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQ 240
           N+L+ +P    +V+ VD D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G +D+
Sbjct: 179 NLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFDE 231

Query: 241 VGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG 300
           +G  +G+ F  N+P    GI D  YI  F+ I+ P+   ++P ++I   G D+   D +G
Sbjct: 232 IGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLG 290

Query: 301 KCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDE 355
             ++    +G     +KS     L VV  GGY    ++R     + L    +L  E P+ 
Sbjct: 291 CFNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSRLWTYETGLLNDVLLPQEIPEN 349

Query: 356 LPAPD 360
           +P  D
Sbjct: 350 IPFRD 354

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  149 bits (376), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 113/375 (30%), Positives = 187/375 (49%), Gaps = 41/375 (10%)

Query: 1   MMSSLSY-------TPL-KTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILA 52
           M S+ SY        PL + G  Y  R+ YH     S Y Y   HP  P      +++L 
Sbjct: 1   MSSTFSYDVKTKSEQPLFEFGSAYCPRVSYHFNPKVSNYHYGVRHPMKP------FRLLL 54

Query: 53  ENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL---- 108
            + L+    L  I D+ +       R ATSEEI E H ++ +++L K    N  ++    
Sbjct: 55  TDHLVSSYGLHKIMDLYE------TRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGT 108

Query: 109 LSKTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAG 167
           L K  +GD      + +   KL  G +++A + +++ +  + +AI    G HH++     
Sbjct: 109 LEKFNIGDDCPIFQNLFNYCKLYAGASLDAARKLINDQ--SDIAINWSGGLHHAKKSNPS 166

Query: 168 GFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELG 227
           GFC  +++ +A  N+L+ +P    +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G
Sbjct: 167 GFCYVNDIVLAILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-G 221

Query: 228 KYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIV 287
           +++PGT  G +D+VG   G+ F  N+P    GI D  YI  F+ I+ P+   ++P ++I 
Sbjct: 222 EFFPGT--GNHDEVGCANGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQ 278

Query: 288 SSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SAL 342
             G D+   D IG  ++T   +G     ++S     L VV  GGY    ++R     + +
Sbjct: 279 QCGADSLGHDRIGCFNLTIKGHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWAYETGV 337

Query: 343 AVAKVLIGEPPDELP 357
               +L  E P+E+P
Sbjct: 338 LNNVLLSKELPEEIP 352

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  148 bits (374), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 101/342 (29%), Positives = 173/342 (50%), Gaps = 28/342 (8%)

Query: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62
           +S    P + G  Y  ++ YH     S Y Y   HP  P      ++++  + L+   + 
Sbjct: 47  TSQQQLPFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLV---SC 97

Query: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSV 118
            G+  I DL      REAT EE+LE H  + +E+L      N ++L    L K  +GD  
Sbjct: 98  YGLHKIMDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDC 154

Query: 119 YFNNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAV 177
                 +  + L  G +++A + +++ +  + +AI    G HH++     GFC  +++ +
Sbjct: 155 PIFQGMFDYSILYAGASLDAARKLINNQ--SEIAINWSGGLHHAKKSNPSGFCYVNDIVL 212

Query: 178 ATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQ 237
           A  ++L+ +P    +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G 
Sbjct: 213 AIISLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GD 265

Query: 238 YDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGD 297
            D++G  KG+ F+ N+P    GI D  YI  F+ I+ P+   ++P ++I   G D+   D
Sbjct: 266 LDEIGCSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHD 324

Query: 298 TIGKCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR 339
            +G  ++    +G     +KS     LCV   GGY    ++R
Sbjct: 325 RLGCFNLNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  147 bits (371), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/332 (29%), Positives = 167/332 (50%), Gaps = 28/332 (8%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  Y  R+ YH     S Y Y   HP  P R+     +++  GL +            +M
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGLHK------------VM 68

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSA 128
                R AT EE+L  H ++ +++L      N ++L    L K  +GD        +  +
Sbjct: 69  DLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFEYS 128

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
            L  G +++A + +++G+  + +AI    G HH++     GFC  +++ +A  N+L+ +P
Sbjct: 129 MLYAGASLDASRKLINGQ--SEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G  D++G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 239

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F+ N+P +  GI D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++   
Sbjct: 240 HFSLNVPLN-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNIR 298

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR 339
            +G     +KS     LCV   GGY    ++R
Sbjct: 299 AHGECVKFVKSFGIPMLCVG-GGGYTPRNVSR 329

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 105/368 (28%), Positives = 181/368 (49%), Gaps = 42/368 (11%)

Query: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62
           +S SYTP         R+ YH     S Y Y   HP  P R+     +++  GL +    
Sbjct: 24  NSSSYTP---------RVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK---- 70

Query: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSV 118
                   +M     R AT+EE+++ H ++ L++L K    N  ++    L K  +GD  
Sbjct: 71  --------IMDLYETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDC 122

Query: 119 YFNNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAV 177
               + Y  + L  G +++A + +++ +  + +AI    G HH++     GFC  +++ +
Sbjct: 123 PIFQNLYDYSTLYTGASLDATRKLINDQ--SDIAINWSGGLHHAKKNNPSGFCYINDIVL 180

Query: 178 ATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQ 237
           +  N+L+ +P    +V+ +D D+HHG+G Q+AFY  DRV  +S H+F  G+++PGT  G 
Sbjct: 181 SIVNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GD 233

Query: 238 YDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGD 297
           YD+ G  KG+ F  N+P    GI D  YI  F+ I+ P+   ++P +++   G D+   D
Sbjct: 234 YDETGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHD 292

Query: 298 TIGKCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEP 352
            +G  ++    +G     +KS     L VV  GGY    ++R     + +    +L  E 
Sbjct: 293 RLGCFNLNIKGHGECVKFIKSFGIPML-VVGGGGYTPRNVSRLWTYETGILNNVLLPNEL 351

Query: 353 PDELPAPD 360
           P+ +P  D
Sbjct: 352 PEGIPFRD 359

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  145 bits (367), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 103/355 (29%), Positives = 176/355 (49%), Gaps = 33/355 (9%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  Y  R+ YH     S Y Y   HP  P R+     +++  GL +            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQ--YLNR--DELLSKTELGDSVYFNNDSYFSA 128
                REAT EE+ + H  + L++LEK     LN+     L K  +G       + Y  +
Sbjct: 71  DLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFENIYDYS 130

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
            L  G +++A + +++G+  + +AI    G HH++     GFC  +++ ++  N+L+ +P
Sbjct: 131 TLYTGASLDASRKLINGQ--SEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYHP 188

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G YD++G   G+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGGK 241

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F  N+P +  GI D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++   
Sbjct: 242 HFAMNVPLN-DGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNIK 300

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELP 357
            +G     + S     + VV  GGY    ++R     + +    +L  E P+ELP
Sbjct: 301 AHGECVKFVSSFGI-PMLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  145 bits (367), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 100/358 (27%), Positives = 177/358 (49%), Gaps = 33/358 (9%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  Y  R+ YH     S Y Y   HP  P R+     +++  GL +            +M
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 72

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSA 128
                R AT +E+L+ H  + + +L+K    N  ++    L K  +GD      + Y  +
Sbjct: 73  DLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYDYS 132

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
            L  G +++A + +++ +  + +AI    G HH++     GFC  +++ +A  N+L+ +P
Sbjct: 133 ALYAGASLDASRKLINNQ--SDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYHP 190

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G YD++G  +G+
Sbjct: 191 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQGK 243

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F  N+P    GI D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++   
Sbjct: 244 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNIK 302

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELPAPD 360
            +G     ++S     L VV  GGY    ++R     + +    +L  E P+++P  D
Sbjct: 303 AHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIPFRD 359

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  144 bits (364), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 174/358 (48%), Gaps = 33/358 (9%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  Y+  + YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSA 128
                R AT EE+ E H  + +E+L K    N  +L    L K  +GD        Y  +
Sbjct: 69  DLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
            L  G +++A + +++G+  + +AI    G HH++     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLINGQ--SEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F  N+P    GI D  YI  F+ I+ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELPAPD 360
            +G     +KS     L V+  GGY    ++R     +AL     +  E P+++P  D
Sbjct: 299 AHGECVRFVKSFGIPML-VLGGGGYTPRNVSRLWTYETALLNGVSVPQEIPEDIPFRD 355

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 174/358 (48%), Gaps = 33/358 (9%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  Y  R+ YH     S Y Y   HP  P R+     +++  GL +            +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGLHK------------VM 71

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSA 128
                R AT +E+ + H ++ + +L K      ++L    L K  +GD        +  A
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
            L  G +++A + +++G+  + +AI    G HH++     GFC  +++ +A  N+L+ +P
Sbjct: 132 ALYAGASLDASRKLLNGQ--SEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G  D++G  +G+
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 242

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F  N+P    GI D  YI  F+ I+ P+   FRP ++I   G D+   D +G  ++   
Sbjct: 243 HFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIK 301

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELPAPD 360
            +G     +KS     L VV  GGY    ++R     + L    +L  + P+ +P  D
Sbjct: 302 AHGECVRFVKSFGVPML-VVGGGGYTPRNVSRLWTYETGLLNGVLLQPKLPEGIPFRD 358

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 112/417 (26%), Positives = 203/417 (48%), Gaps = 36/417 (8%)

Query: 10  LKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIG 69
            + G  Y  R+ YH     S Y Y   HP  P R+     +++  GL +           
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGLHK----------- 65

Query: 70  DLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSY 125
            +M     R AT EE+   H +E ++++++    N ++L    L K  +GD      + Y
Sbjct: 66  -IMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 126 FSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILK 184
             + L  G +++A + +++ +  + +AI    G HH++     GFC  +++ +AT N+L+
Sbjct: 125 DYSSLYAGASLDASRKLINDQ--SDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
            +P    +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G +D+VG  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCA 235

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
           +G+ F  N+P    GI D  YI  F+ I+ P+   ++P +++   G D+   D +G  ++
Sbjct: 236 RGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNL 294

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELPAP 359
               +G   + ++S     + VV  GGY    ++R     + +    +L  + P+ +P  
Sbjct: 295 NVKAHGECVNFVRSFG-LPMLVVGGGGYTPRNVSRLWTYETGILNNVLLPKDLPEGIPFR 353

Query: 360 DK-DPKPEAIEMIDRVIDLKS--KYWKCFKRQITNSNCEYKGPISESFFAKKFPIQD 413
           D+  P      ++D + + K+  KY +  + +   S    KG  S    A+  P QD
Sbjct: 354 DRFGPDYSLYPVLDELYENKNGKKYLEDIRIRSLESIRYMKGAPSVWMDAEIIPTQD 410

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/355 (28%), Positives = 177/355 (49%), Gaps = 33/355 (9%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  Y  R+ YH     S Y +   HP  P R+           ++ D  +SG   +  +M
Sbjct: 23  GSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLVSGYG-LHKIM 70

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSA 128
                R+A+ +E+LE H  + + +L+K    N +++    L K  +GD     ++ Y  +
Sbjct: 71  DLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDCPIFHNLYEYS 130

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
            L  G +++A + +++G+  + +AI    G HH++     GFC  +++ ++  N+L+ +P
Sbjct: 131 SLYTGASLDASRKLLNGQ--SDIAINWSGGLHHAKKTSPSGFCYINDIVLSILNLLRFHP 188

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G YD+ G   G+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNYDETGCSNGK 241

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F  N+P    GI D  YI  F+ I+ P+   + P ++I   G D+   D +G  ++   
Sbjct: 242 HFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHDRLGCFNLNIK 300

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELP 357
            +G     +KS     L VV  GGY    ++R     + +    +L  E P ++P
Sbjct: 301 AHGECVKFVKSFGIPML-VVGGGGYTPKNVSRLWTYETGILNNVLLSPELPSDIP 354

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  142 bits (358), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 95/329 (28%), Positives = 163/329 (49%), Gaps = 28/329 (8%)

Query: 16  YDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKI 75
           Y  R+ YH     S+Y Y   HP  P R+     +++  GL +            +M   
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 76  PVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSAKLS 131
             R AT +E+LE H ++ + +L K    N ++L    L    +GD      + Y    L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 132 CGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKV 190
            G +++A + +++ +  + +AI    G HH++     GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 191 KKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFN 250
            +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   ++G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 251 CNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYG 310
            N+P    GI D  YI  F+ IV P+   F+P L++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 311 HMTHMLKSLANGKLCVVLEGGYNLDAIAR 339
                +KS     L VV  GGY    ++R
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  142 bits (358), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 180/362 (49%), Gaps = 34/362 (9%)

Query: 7   YTPL-KTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGI 65
           + PL + G  Y  R+ YH     S+Y Y   HP  P R+           ++ D  +SG 
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGY 62

Query: 66  DDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFN 121
             +  +M     R+AT+EE+ E H ++ + +L K    N  +L    L K  +GD     
Sbjct: 63  G-LHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 122 NDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATK 180
            + +  + L  G +++A + +++ +  + +AI    G HH++     GFC  +++ +A  
Sbjct: 122 PNIFQYSSLYTGASLDASRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYINDIVLAIL 179

Query: 181 NILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQ 240
           N+L+ +P    +V+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+ D+
Sbjct: 180 NLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDE 232

Query: 241 VGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG 300
            G   G+ F  N+P    GI D  YI  F+ I+ P+   F+P +++   G D+   D +G
Sbjct: 233 TGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLG 291

Query: 301 KCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDE 355
             ++    +G     ++S     L VV  GGY    ++R     + +    +L  E PD 
Sbjct: 292 CFNLNIKAHGECVKFVRSFGIPML-VVGGGGYTPRNVSRLWTYETGILNNVLLPEELPDN 350

Query: 356 LP 357
           LP
Sbjct: 351 LP 352

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 102/358 (28%), Positives = 174/358 (48%), Gaps = 33/358 (9%)

Query: 13  GLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLM 72
           G  +   + YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 73  CKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSA 128
                R AT EE+ E H ++ +E+L +    N  +L    L K  +GD        Y  +
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
            L  G +++A + +++G+  + +AI    G HH++     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLINGQ--SEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
               +V+ +D D+HHG+G Q+AFY  DRV  VS H++  G+++PGT  G  D++G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
            F  N+P    GI D  YI  F+ I+ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 308 CYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR-----SALAVAKVLIGEPPDELPAPD 360
            +G     +KS     L VV  GGY    ++R     + L    +L  E P+ +P  D
Sbjct: 299 AHGECVKYVKSFGLPML-VVGGGGYTPRNVSRLWAYETGLLNGVLLPEEIPEGIPFRD 355

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 163/330 (49%), Gaps = 28/330 (8%)

Query: 15  CYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCK 74
            Y  R+ YH     S+Y Y   HP  P R+     +++  GL +            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 75  IPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSAKL 130
              R AT +E+L+ H ++ + +L K    N ++L    L    +GD      + Y    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 131 SCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDK 189
             G +++A + +++ +  + +AI    G HH++     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 190 VKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGF 249
             +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   ++G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 250 NCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCY 309
             N+P    GI D  YI  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 310 GHMTHMLKSLANGKLCVVLEGGYNLDAIAR 339
           G     +KS     L VV  GGY    ++R
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 93/330 (28%), Positives = 163/330 (49%), Gaps = 28/330 (8%)

Query: 15  CYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCK 74
            Y  R+ YH     S+Y Y   HP  P R+     +++  GL +            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 75  IPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSAKL 130
              R AT +E+L+ H ++ + +L K    N ++L    L    +GD      + Y    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 131 SCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDK 189
             G +++A + +++ +  + +AI    G HH++     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 190 VKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGF 249
             +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   ++G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 250 NCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCY 309
             N+P    GI D  YI  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 310 GHMTHMLKSLANGKLCVVLEGGYNLDAIAR 339
           G     +KS     + VV  GGY    ++R
Sbjct: 301 GECVKFVKSFG-LPMLVVGGGGYTPRNVSR 329

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  140 bits (353), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 97/335 (28%), Positives = 166/335 (49%), Gaps = 28/335 (8%)

Query: 10  LKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIG 69
            + G    +R+ YH     S+Y Y   HP  P R+           ++ D  +SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MH 66

Query: 70  DLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSY 125
            +M     R AT++E+ E H ++ + +L+K    N  +L    L K  +GD      + Y
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 126 FSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILK 184
             A L  G +++A + +++G+  + +AI    G HH++     GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLINGQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244
            +P    +V+ +D D+HHG+G Q+AFY  DRV  +S H++  G ++PGT  G  D+ G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304
            GE F  N+P    GI D  YI  F+ ++ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIAR 339
               +G     +KS     L VV  GGY    ++R
Sbjct: 297 NIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 330

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  140 bits (352), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 94/329 (28%), Positives = 161/329 (48%), Gaps = 28/329 (8%)

Query: 16  YDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKI 75
           Y  R+ YH     S+Y Y   HP  P R+     +++  GL +            +M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 76  PVREATSEEILEVHPKEQLEYLEKTQYLNRDEL----LSKTELGDSVYFNNDSYFSAKLS 131
             R AT +E+ E H ++ + +L K    N ++L    L    +GD      + Y    L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 132 CGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKV 190
            G  ++A + +++ +  + +AI    G HH++     GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 191 KKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFN 250
            +V+ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   ++G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 251 CNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYG 310
            N+P    GI D  YI  F+ IV P+   F+P +++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 311 HMTHMLKSLANGKLCVVLEGGYNLDAIAR 339
                +KS     L VV  GGY    ++R
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPKNVSR 329

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  132 bits (331), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        Y Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGA 135
            AT +E+ + H  E +++L +    N D       K  +GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 136 IEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVM 194
           +E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 195 IVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIP 254
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 255 WSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTH 314
               GI DA Y   FE ++  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 315 MLKSLANGKLCVVLEGGYNLDAIARS 340
            +KS  N  + VV  GGY +  +AR+
Sbjct: 297 YVKSF-NIPMMVVGGGGYTMRNVART 321

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  131 bits (329), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        Y Y   HP  P RI   + ++   GL ++            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGA 135
            AT +E+ + H  E +++L +    N D       K  +GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 136 IEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVM 194
           +E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 195 IVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIP 254
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 255 WSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTH 314
               GI DA Y   FE ++  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 315 MLKSLANGKLCVVLEGGYNLDAIARS 340
            +KS  N  + VV  GGY +  +AR+
Sbjct: 297 FVKSF-NIPMMVVGGGGYTMRNVART 321

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  130 bits (328), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        Y Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGA 135
            AT +E+ + H  E +++L +    N D       K  +GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 136 IEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVM 194
           +E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 195 IVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIP 254
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 255 WSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTH 314
               GI DA Y   FE ++  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 315 MLKSLANGKLCVVLEGGYNLDAIARS 340
            +KS     L VV  GGY +  +AR+
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  130 bits (326), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        Y Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGA 135
            AT +E+ + H  E +++L +    N D       K  +GD     +  +    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 136 IEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVM 194
           +E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 195 IVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIP 254
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   VG GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 255 WSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTH 314
               G+ DA Y   FE ++  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 315 MLKSLANGKLCVVLEGGYNLDAIARS 340
            +KS  N  + VV  GGY +  +AR+
Sbjct: 297 FVKSF-NIPMMVVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 155/314 (49%), Gaps = 28/314 (8%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 32  YAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 91  KEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDGKV 147
            E +++L +    N +       K  +GD     +  Y    +S GG++E+   +  GK 
Sbjct: 80  DEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGSMESAARLNRGKC 139

Query: 148 KNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGT 206
              +AI    G HH++   A GFC  +++ +    +L+ +P    +V+ +D D+HHG+G 
Sbjct: 140 --DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGV 193

Query: 207 QKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYI 266
           ++AFY  DRV+  S H++  G+++PGT  G+   +G GKG+ +  N+P    GI DA Y 
Sbjct: 194 EEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVPLR-DGIDDATYR 248

Query: 267 WAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCV 326
             FE +V  +   ++P  V++  G D+  GD +G  +++   +    + +KS  N  + V
Sbjct: 249 SVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVNYVKSF-NIPMMV 307

Query: 327 VLEGGYNLDAIARS 340
           V  GGY +  +AR+
Sbjct: 308 VGGGGYTMRNVART 321

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 158/316 (50%), Gaps = 32/316 (10%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 32  YAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 91  KEQLEYLEKT-----QYLNRDELLSKTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDG 145
            E +++L +      +   R+ +  K  +GD     +  Y    +S GG++E    +  G
Sbjct: 80  DEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRG 137

Query: 146 KVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGN 204
           K    +A+    G HH++   A GFC  +++ +    +L+ +P    +V+ VD D+HHG+
Sbjct: 138 KC--DVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYVDIDVHHGD 191

Query: 205 GTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAE 264
           G ++AFY  DRV+  S H++  G+++PGT  G+   VG GKG+ ++ N+P    GI DA 
Sbjct: 192 GVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVPLR-DGIDDAT 246

Query: 265 YIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKL 324
           Y   FE +V  +   ++P  V++ +G D+  GD +G  +++   + +  + +KS     +
Sbjct: 247 YRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGI-PM 305

Query: 325 CVVLEGGYNLDAIARS 340
            VV  GGY +  +AR+
Sbjct: 306 MVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 153/314 (48%), Gaps = 28/314 (8%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 32  YAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 91  KEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDGKV 147
            E +++L +    N D       K  +GD     +  Y    +S GG++E    +  GK 
Sbjct: 80  DEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKC 139

Query: 148 KNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGT 206
              +AI    G HH++   A GFC  +++ +    +L+ +P    +V+ +D D+HHG+G 
Sbjct: 140 --DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGV 193

Query: 207 QKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYI 266
           ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ +  N+P    GI DA Y 
Sbjct: 194 EEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVPLR-DGIDDATYK 248

Query: 267 WAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCV 326
             FE ++  +   ++P  V++  G D+  GD +G  +++   + +  + +KS     L +
Sbjct: 249 SVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVNYMKSFGV-PLMI 307

Query: 327 VLEGGYNLDAIARS 340
           V  GGY +  +AR+
Sbjct: 308 VGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 159/327 (48%), Gaps = 30/327 (9%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        Y Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLSKT----ELGDSVYFNNDSYFSAKLSCGG 134
            AT +E+ + H  E +++L +    N  EL  K      +GD     +  Y    +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNL-ELFKKESVKFNVGDDCPVFDGLYEYCSISGGG 126

Query: 135 AIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKV 193
           ++E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V
Sbjct: 127 SMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 194 MIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNI 253
           + +D D+HHG+G ++AFY+ DRV+  S H++  G+++PGT  G+   VG GKG+ +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNV 236

Query: 254 PWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMT 313
           P    GI DA Y   FE +V  +   ++P  V++  G D+  GD +G  +++   + +  
Sbjct: 237 PLR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCV 295

Query: 314 HMLKSLANGKLCVVLEGGYNLDAIARS 340
           + +KS     + VV  GGY +  +AR+
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  128 bits (321), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 154/314 (49%), Gaps = 28/314 (8%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 32  YAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 91  KEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDGKV 147
            E +++L +    N D       K  +GD     +  Y    +S GG++E    +  GK 
Sbjct: 80  DEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKC 139

Query: 148 KNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGT 206
              +AI    G HH++   A GFC  +++ +    +L+ +P    +V+ +D D+HHG+G 
Sbjct: 140 --DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGV 193

Query: 207 QKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYI 266
           ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ ++ N+P    GI DA Y 
Sbjct: 194 EEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPLR-DGIDDATYK 248

Query: 267 WAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCV 326
             FE ++  +   ++P  V++  G D+  GD +G  +++   + +  + +KS     + V
Sbjct: 249 SVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNYVKSFGI-PMMV 307

Query: 327 VLEGGYNLDAIARS 340
           V  GGY +  +AR+
Sbjct: 308 VGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  128 bits (321), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 154/314 (49%), Gaps = 28/314 (8%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 32  YAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 91  KEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDGKV 147
            E +++L +    N D       K  +GD     +  Y    +S GG++E    +  GK 
Sbjct: 80  DEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKC 139

Query: 148 KNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGT 206
              +AI    G HH++   A GFC  +++ +    +L+ +P    +V+ +D D+HHG+G 
Sbjct: 140 --DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGV 193

Query: 207 QKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYI 266
           ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ ++ N+P    GI DA Y 
Sbjct: 194 EEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPLR-DGIDDATYK 248

Query: 267 WAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCV 326
             FE ++  +   ++P  V++  G D+  GD +G  +++   + +  + +KS     + V
Sbjct: 249 SVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNYVKSFGI-PMMV 307

Query: 327 VLEGGYNLDAIARS 340
           V  GGY +  +AR+
Sbjct: 308 VGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  127 bits (320), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 157/316 (49%), Gaps = 32/316 (10%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 32  YAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 91  KEQLEYLEKT-----QYLNRDELLSKTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDG 145
            E +++L +      +   R+ +  K  +GD     +  Y    +S GG++E    +  G
Sbjct: 80  DEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRG 137

Query: 146 KVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGN 204
           K    +A+    G HH++   A GFC  +++ +    +L+ +P    +V+ +D D+HHG+
Sbjct: 138 KC--DVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGD 191

Query: 205 GTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAE 264
           G ++AFY+ DRV+  S H++  G+++PGT  G+   +G G G+ +  N+P    GI DA 
Sbjct: 192 GVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVPLR-DGIDDAT 246

Query: 265 YIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKL 324
           Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +G+  + +KS     +
Sbjct: 247 YRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVNYVKSFGI-PM 305

Query: 325 CVVLEGGYNLDAIARS 340
            VV  GGY +  +AR+
Sbjct: 306 MVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  127 bits (320), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        Y Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGA 135
            AT +E+ + H  E +++L +    N D       K  +GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 136 IEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVM 194
           +E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 195 IVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIP 254
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 255 WSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTH 314
               GI DA Y   FE +V  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 315 MLKSLANGKLCVVLEGGYNLDAIARS 340
            +KS     + +V  GGY +  +AR+
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  126 bits (317), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        Y Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGA 135
            AT +E+ + H  E +++L +    N +       K  +GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 136 IEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVM 194
           +E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 195 IVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIP 254
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 255 WSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTH 314
               GI DA Y   FE ++  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 315 MLKSLANGKLCVVLEGGYNLDAIARS 340
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  126 bits (317), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 92/340 (27%), Positives = 161/340 (47%), Gaps = 28/340 (8%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           L +  LK       R+ Y      S Y Y   HP  P RI   + ++   GL +      
Sbjct: 6   LPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK----- 60

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFN 121
                  M     + AT +E+ + H  E +++L +    N +       K  +GD     
Sbjct: 61  -------MEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVF 113

Query: 122 NDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATK 180
           +  Y    +S GG++E    +  GK    +AI    G HH++   A GFC  +++ +   
Sbjct: 114 DGLYEYCSISGGGSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGII 171

Query: 181 NILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQ 240
            +L+ +P    +V+ +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   
Sbjct: 172 ELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRD 223

Query: 241 VGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG 300
            G GKG+ ++ N+P    GI D  Y   FE ++  +   ++P  V++  G D+  GD +G
Sbjct: 224 TGVGKGKYYSVNVPLR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLG 282

Query: 301 KCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARS 340
             +++   + +  + +KS     + VV  GGY +  +AR+
Sbjct: 283 CFNLSMRGHANCVNYVKSFGI-PMLVVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  126 bits (317), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 92/340 (27%), Positives = 161/340 (47%), Gaps = 28/340 (8%)

Query: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64
           L +  LK       R+ Y      S Y Y   HP  P RI   + ++   GL +      
Sbjct: 6   LPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK----- 60

Query: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFN 121
                  M     + AT +E+ + H  E +++L +    N +       K  +GD     
Sbjct: 61  -------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVF 113

Query: 122 NDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATK 180
           +  Y    +S GG++E    +  GK    +AI    G HH++   A GFC  +++ +   
Sbjct: 114 DGLYEYCSISGGGSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGII 171

Query: 181 NILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQ 240
            +L+ +P    +V+ +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   
Sbjct: 172 ELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRD 223

Query: 241 VGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG 300
            G GKG+ +  N+P    GI D+ Y   FE ++  +   ++P  V++  G D+  GD +G
Sbjct: 224 TGVGKGKYYAVNVPLR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLG 282

Query: 301 KCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARS 340
             +++   + +  + +KS     + VV  GGY +  +AR+
Sbjct: 283 CFNLSMRGHANCVNYVKSFGI-PMLVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        Y Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGA 135
            AT +E+ + H  E +++L +    N +       K  +GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 136 IEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVM 194
           +E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 195 IVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIP 254
            +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 255 WSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTH 314
               GI DA Y   FE ++  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 315 MLKSLANGKLCVVLEGGYNLDAIARS 340
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  125 bits (314), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 155/316 (49%), Gaps = 32/316 (10%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 32  YAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 91  KEQLEYLEKT-----QYLNRDELLSKTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDG 145
            E +++L +      +   R+ +  K  +GD     +  Y    +S GG++E    +  G
Sbjct: 80  DEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRG 137

Query: 146 KVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGN 204
           K    +A+    G HH++   A GFC  +++ +    +L+ +P    +V+ +D D+HHG+
Sbjct: 138 KC--DVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGD 191

Query: 205 GTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAE 264
           G ++AFY  DRV+  S H++  G+++PGT  G+   +G G G+ +  N+P    GI DA 
Sbjct: 192 GVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVPLR-DGIDDAT 246

Query: 265 YIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKL 324
           Y   FE ++  +   ++P  V++  G D+  GD +G  +++   + +  + +KS     +
Sbjct: 247 YRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGI-PM 305

Query: 325 CVVLEGGYNLDAIARS 340
            VV  GGY +  +AR+
Sbjct: 306 MVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  125 bits (314), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 155/316 (49%), Gaps = 32/316 (10%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 32  YAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAKPATKQEMCQFHT 79

Query: 91  KEQLEYLEKT-----QYLNRDELLSKTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDG 145
            E +++L +      +   R+ +  K  +GD     +  Y    +S GG++E    +  G
Sbjct: 80  DEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRG 137

Query: 146 KVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGN 204
           K    +A+    G HH++   A GFC  +++ +    +L+ +P    +V+ +D D+HHG+
Sbjct: 138 KC--DVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGD 191

Query: 205 GTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAE 264
           G ++AFY  DRV+  S H++  G+++PGT  G+   +G G G+ +  N+P    GI DA 
Sbjct: 192 GVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVPLR-DGIDDAT 246

Query: 265 YIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKL 324
           Y   FE ++  +   ++P  V++  G D+  GD +G  +++   + +  + +KS     +
Sbjct: 247 YRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGI-PM 305

Query: 325 CVVLEGGYNLDAIARS 340
            VV  GGY +  +AR+
Sbjct: 306 MVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  125 bits (314), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 153/314 (48%), Gaps = 28/314 (8%)

Query: 31  YEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVREATSEEILEVHP 90
           Y Y   HP  P RI   + ++   GL +             M     + AT +E+ + H 
Sbjct: 33  YAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAKPATKQEMCQFHT 80

Query: 91  KEQLEYLEKTQYLNRDELLS---KTELGDSVYFNNDSYFSAKLSCGGAIEACKAIVDGKV 147
            E +++L +    N +       K  +GD     +  Y    +S GG++E    +  GK 
Sbjct: 81  DEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKC 140

Query: 148 KNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGT 206
              +AI    G HH++   A GFC  +++ +    +L+ +P    +V+ +D D+HHG+G 
Sbjct: 141 --DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVLYIDIDVHHGDGV 194

Query: 207 QKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYI 266
           ++AFY  DRV+  S H++  G+++PGT  G+    G GKG+ +  N+P    GI DA Y 
Sbjct: 195 EEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVPLR-DGIDDATYR 249

Query: 267 WAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCV 326
             FE ++  +   ++P  V++  G D+  GD +G  +++   + +  + +KS     + V
Sbjct: 250 NVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVNYVKSFGI-PMMV 308

Query: 327 VLEGGYNLDAIARS 340
           V  GGY +  +AR+
Sbjct: 309 VGGGGYTMRNVART 322

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  122 bits (305), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 89/327 (27%), Positives = 157/327 (48%), Gaps = 30/327 (9%)

Query: 19  RMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGIDDIGDLMCKIPVR 78
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 79  EATSEEILEVHPKEQLEYLEKTQYLNRDELLSKT----ELGDSVYFNNDSYFSAKLSCGG 134
            AT +E+ + H  E +++L +    N  EL  K      +GD     +  Y    +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNL-ELFKKESVKFNVGDDCPVFDGLYEYCSISGGG 126

Query: 135 AIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKV 193
           ++E    +  GK    +AI    G HH++   A GFC  +++ +    +L+ +P    +V
Sbjct: 127 SMEGAARLNRGKC--DVAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 194 MIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNI 253
           + +D D+HHG+G ++AFY  DRV+  S H++  G+++PGT  G+   +G G G+ +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNV 236

Query: 254 PWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMT 313
           P    GI DA +   FE +V  +   ++P  V++  G D+  GD +G  +++   + +  
Sbjct: 237 PLR-DGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCV 295

Query: 314 HMLKSLANGKLCVVLEGGYNLDAIARS 340
           + +KS     + VV  GGY +  +AR+
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 111/248 (44%), Gaps = 26/248 (10%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+  + A GFC  +++ +  + + +      +K+  +D+D+HHG+G +KAF     V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRRK---GFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGR 278
           +SLH FE+G ++PGT       + E        NIP  + G+ D       EQIV P+  
Sbjct: 263 ISLHLFEVG-FFPGT-----GNLSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 279 EFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCVVL---EGGYNLD 335
              PD++++  G D   GD   +  +  S  G    + + + N K C V+    GGYN+ 
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQL--SIRGLAKCITELINNTKDCPVILLGGGGYNVT 373

Query: 336 AIAR----SALAVAKVLIGEPPDELPAPDKDPKPEAIEMIDRVIDLKSKYWK------CF 385
            ++R        + +    +        D    PE  E ID   D + K+W         
Sbjct: 374 LMSRLYTYLTWKIVRTYCSDSSSICEIDDDALVPEH-EFIDVYADEEYKFWAYEQEGGLR 432

Query: 386 KRQITNSN 393
           K+Q+ N N
Sbjct: 433 KKQLRNDN 440

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 104/229 (45%), Gaps = 16/229 (6%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HHS    A GFC  +++ +A + + +N+ +    +  VD+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGR 278
           +SLH  E G ++PGT   +  Q G         NIP   G   D   +   E +V+P  +
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-----INIPLRHGADDDC-LMKITESVVIPCIQ 350

Query: 279 EFRPDLVIVSSGFDAADGDTIGKCHVT-PSCYGHMTHMLKSLANGKLCVVLEGGYNLDAI 337
           +  P ++++  G D   GD   +  +T       +  +L SL +  + ++  GGYN   +
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRVM 410

Query: 338 ARS----ALAVAKVLIGEPPDELPAPDKDPKPEAIEMIDRVIDLKSKYW 382
           +R        V       PP++ P  D +      E +D   D   K+W
Sbjct: 411 SRFYTYLTWKVCDQFSKSPPEDPPFIDDEDLIPDHEFLDLYTDEHYKFW 459

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 98/208 (47%), Gaps = 12/208 (5%)

Query: 134 GAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKK 192
           GA  +    +    + S+AI    G HH+    A GFC  +++ +  + I KN     K 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 193 VMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCN 252
           +  VD+D+HHG+G QKAF     V  VSLH FE G ++P T       + E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCT-----GSLQEAKAGSSIVN 299

Query: 253 IPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVT-PSCYGH 311
           IP  + G+         + I++P+  +  P+++++  G D   GD   +  +T     G 
Sbjct: 300 IPL-LHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGA 358

Query: 312 MTHMLKSLANGKLCVVLEGGYNLDAIAR 339
           +  ++ +  +  + ++  GGYN   ++R
Sbjct: 359 IMKLINTFPSCSVVLLGGGGYNEKVMSR 386

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 96/185 (51%), Gaps = 17/185 (9%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HHS  + A GFC  +++ +    I K      +K+  +D+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFN-CNIPWSVGGIGDAEYIWAFEQIVMPMG 277
           +S+H FE G ++P T  G  ++       GFN  NIP ++ G+ D    +   ++++P+ 
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNIVNIP-TLHGLDDNYLTYLLNRVIIPLI 407

Query: 278 REFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCVVL---EGGYNL 334
           ++ +P+ ++V  G D   GD   +  +T S  G   +++  L N   C V+    GGYN 
Sbjct: 408 KKHKPECLVVQCGGDGLIGDRYKEWQMTIS--GLTKNIMLVLQNFPECSVVLLGGGGYNE 465

Query: 335 DAIAR 339
             ++R
Sbjct: 466 RVMSR 470

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 93/183 (50%), Gaps = 13/183 (7%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+  + A GFC  ++V +  + + K    K+ KV  +D+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYI-WAFEQIVMPMG 277
           +S+H +E G ++PGT  G  +    GK      NIP   G   D  Y+     +I+ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI---VNIPLKHG--CDDNYLNLVASKIIHPLI 320

Query: 278 REFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGH-MTHMLKSLANGKLCVVLEGGYNLDA 336
           +   P+++I+  G D   GD   +  +T       + +++KS     + ++  GGYN   
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYNDLL 380

Query: 337 IAR 339
           ++R
Sbjct: 381 MSR 383

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 110/234 (47%), Gaps = 12/234 (5%)

Query: 130 LSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPD 188
           +S G  +   + I++G  + ++AI    G HHS    A GFC  +++A+    + +    
Sbjct: 174 VSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG--- 229

Query: 189 KVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEG 248
            V ++  VD+D+HHG+G +KAF    +V  +SLH +E G ++P +  G  +    GK   
Sbjct: 230 GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSSGKSI- 285

Query: 249 FNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSC 308
              NIP  + G+ D+      ++I++P   + +P+++++  G D   GD   +  ++   
Sbjct: 286 --VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQLSIKG 342

Query: 309 YGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362
                  L    N  + ++  GGYN   ++R    +   +  +   E   P  D
Sbjct: 343 LTSTITSLIEQFNCHIVLLGGGGYNNLLMSRFYTYLTWSICHQYASEYSTPIDD 396

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 92/182 (50%), Gaps = 11/182 (6%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+  + A GFC  ++V +  + + K    K+ K+  VD+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRKM---KLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGR 278
           +S+H +E G ++PGT  G  +   +GK      NIP    G  D+       +I+ P+ +
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV---VNIPLK-HGCDDSYLDLVASKIISPLIK 321

Query: 279 EFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGH-MTHMLKSLANGKLCVVLEGGYNLDAI 337
              PD++I+  G D   GD   +  +T       + +++K      + ++  GGYN   +
Sbjct: 322 RHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYNDLLM 381

Query: 338 AR 339
           +R
Sbjct: 382 SR 383

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/325 (25%), Positives = 141/325 (43%), Gaps = 74/325 (22%)

Query: 82  SEEILEVH----PKEQLEYLE-KTQYLNRDELLSKTE--LGDSVYFNNDSYFSAKLSCGG 134
           S  +L+VH    PKE L       + + R ++    E  +GD +Y   ++ ++ + S G 
Sbjct: 105 SSHVLKVHGSDWPKELLRLCRGAKEKIGRKQVEVPDEWNVGD-IYLCEETVYALRGSIGA 163

Query: 135 AIEACKAIVDGKVKNSLA-----IVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDK 189
                 +I  G+V    A      +RPPGHHS      GFCL +N  +A +     Y   
Sbjct: 164 VEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--G 221

Query: 190 VKKVMIVDWDIHHGNGTQ------KAFYNDD-------------------RVLYVSLHRF 224
           V   +I+D+D+HHG+GTQ        F  DD                   +V Y S+H  
Sbjct: 222 VTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSMH-- 279

Query: 225 ELGKYYPGTIHGQYDQVGEGKG---EGFNCNIPWSVGGI---GDAEY----------IWA 268
           ++  +     +   D+V +      +  + NI W++  +    + E+          ++A
Sbjct: 280 DINSFPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLPYETEEEFNKLYQTRYRTLFA 338

Query: 269 -----FEQIVMPMGREFRP--DLVIVSSGFDAADGDTIGK----CHVTPSCYGHMTHMLK 317
                F+   + M ++ +P   LV++S+GFDA++ + +       +V  S Y   T    
Sbjct: 339 KADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKDAL 398

Query: 318 SLA----NGKLCVVLEGGYNLDAIA 338
            LA    NGK+  +LEGGY+  AIA
Sbjct: 399 KLAQMHTNGKIISLLEGGYSDAAIA 423

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 101/213 (47%), Gaps = 13/213 (6%)

Query: 129 KLSCGGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYP 187
           +++ G  +   K +V      ++ I    G HH+  + A GFC  +++ +  + + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 188 DKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGE 247
              KK+  +D+D+HHG+G +KAF     +  +SLH FE G ++PGT  G        KG 
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGT--GGL----SNKGS 297

Query: 248 GFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS 307
               +IP S  G+ D       +QI++P       + +++  G D   GD   +  +T  
Sbjct: 298 RDLIDIPLS-HGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTIK 356

Query: 308 CYGH-MTHMLKSLANGKLCVVLEGGYNLDAIAR 339
                +  ++   ++ ++ ++  GGYN   ++R
Sbjct: 357 GLTQCIIDVIGKFSDCQIVLLGGGGYNELLVSR 389

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 102/211 (48%), Gaps = 16/211 (7%)

Query: 133 GGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVK 191
           G  +   K I     + ++A+    G HH+    A GFC  +++ +  + +  N     K
Sbjct: 206 GATLSLAKHITAVANERTIAVNWDGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYK 262

Query: 192 KVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNC 251
           ++  +D+D+HHG+G Q++F     V  +S H FE G ++P T  G   +   GK      
Sbjct: 263 RITYIDFDLHHGDGVQRSFQYSTSVQTISAHMFEPG-FFPCT--GSLKESKMGKNI---V 316

Query: 252 NIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGH 311
           NIP  + G+ D       E++++P  + + P+++++  G D   GD   +  +T   +G 
Sbjct: 317 NIPL-LHGVDDMLMNEIVEKVMIPCVKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGL 373

Query: 312 MTHMLKSLANGKLCVVL---EGGYNLDAIAR 339
           + ++LK L     C V+    GGYN   ++R
Sbjct: 374 VNNILKLLRIFPGCPVVLLGGGGYNETVMSR 404

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 104/227 (45%), Gaps = 19/227 (8%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+  + A GFC  +++ +    I K      +++  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGR 278
           +S+H FE G ++P +  G  +   +GK      NIP +  G+ D        Q+V+P+  
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NIPLA-HGLNDEYLNEIVTQVVIPLTD 304

Query: 279 EFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCVVL---EGGYNLD 335
              P ++I+  G D   GD   +  +T    G   ++LK +   K C ++    GGYN  
Sbjct: 305 RHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYNPT 362

Query: 336 AIARSALAVAKVLIGEPPDELPAPDKDPKPEAIEMIDRVIDLKSKYW 382
            ++R        L G+  D     D+D      + ID   D   K+W
Sbjct: 363 VMSR----FYTYLTGKLIDPNFLQDEDTIIPEHKFIDAYHDEHYKFW 405

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 106/229 (46%), Gaps = 15/229 (6%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+    A GFC  +++A+  + + +     + K+  +D+D+HHG+G ++AF +   V  
Sbjct: 224 HHAFKSKASGFCYVNDIAILIQKLRRR---GIHKISYLDFDLHHGDGVERAFQHSANVQT 280

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGR 278
           +S+H +E G ++PGT  G       G+      NIP  + G+ D        ++V+P   
Sbjct: 281 ISIHMYEEG-FFPGT--GTLKDASSGRNI---VNIP-VLHGMDDTFLNEVVNRVVIPCLH 333

Query: 279 EFRPDLVIVSSGFDAADGDTIGKCHVT-PSCYGHMTHMLKSLANGKLCVVLEGGYNLDAI 337
              P++VI+  G D   GD   +  +T       +  +++   +  + ++  GGYN   +
Sbjct: 334 NHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDTIMKVVEDFPSSNIVLLGGGGYNEKLM 393

Query: 338 ARSALAVAKVLIGEPPDELPAPDKDPKPEAI----EMIDRVIDLKSKYW 382
           +R    +   ++ +  +  P  +   + + +    E ID   D   K+W
Sbjct: 394 SRFYTYLTWRIVSKYSENAPTDNPFDRHDDVIPDHEFIDSYKDEFYKFW 442

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 91/183 (49%), Gaps = 13/183 (7%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+  + A GFC  ++V +  + + K    K+ K+  VD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRKA---KLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAF-EQIVMPMG 277
           +S+H +E G ++PGT       + + + +    NIP   G   D  Y+     +IV P+ 
Sbjct: 267 ISVHLYEPG-FFPGT-----GSLSDSRKDKNVVNIPLKHG--CDDNYLELIASKIVNPLI 318

Query: 278 REFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGH-MTHMLKSLANGKLCVVLEGGYNLDA 336
               P+ +I+  G D   GD   +  +T       + +++KS     + ++  GGYN   
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYNDLL 378

Query: 337 IAR 339
           ++R
Sbjct: 379 MSR 381

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 107/236 (45%), Gaps = 32/236 (13%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+    A GFC  +++A+  + + +       +V  VD+D+HHG+G + AF     V  
Sbjct: 193 HHALKARASGFCYVNDIALLIQTLRRQ---GFLRVSYVDFDLHHGDGVENAFRYSKNVQT 249

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNC------NIPWSVGGIGDAEYIWAFEQI 272
            SLH FE G ++PGT            G   NC      N+P  + G+ D+      + I
Sbjct: 250 CSLHLFEPG-FFPGT------------GACKNCTDNSVLNVPL-LHGVDDSTLDHVVDHI 295

Query: 273 VMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLAN---GKLCVVLE 329
           V P  +   P+++I+  G D   GD  G+  +  S +G   ++LK +      K+ ++  
Sbjct: 296 VTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIHGLTRNILKLVQAHKFKKIALLGG 353

Query: 330 GGYNLDAIARSALAVAKVLIGEP---PDELPAPDKDPKPEAIEMIDRVIDLKSKYW 382
           GGYN    +R    +  +L+ +    P E+   D+D      E+I+       K+W
Sbjct: 354 GGYNGRLQSRFYAYLTSMLLAQCKGIPTEI-GDDEDELIRDHELIEMYEQEDYKFW 408

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 91/182 (50%), Gaps = 11/182 (6%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+  + A GFC  ++V +  + + K    K+ K+  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGR 278
           +S+H +E G ++PGT  G  D    GK      NIP    G  D+       +I+ P+  
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV---VNIPLK-HGCDDSYLNLIASKIINPLID 319

Query: 279 EFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGH-MTHMLKSLANGKLCVVLEGGYNLDAI 337
           +  P+++I+  G D   GD   +  +T       + + +K  +   + ++  GGYN   +
Sbjct: 320 KHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYNDLLM 379

Query: 338 AR 339
           +R
Sbjct: 380 SR 381

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 91/182 (50%), Gaps = 11/182 (6%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+    A GFC  +++A+  + + +     ++++  +D+D+HH +G ++AF +   V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRRR---GIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGR 278
           +S+H  E G ++PGT  G   +   GK      NIP    G+ D       ++++MP  R
Sbjct: 278 ISVHLHEPG-FFPGT--GSLKEASVGKNV---VNIPVQ-HGMDDTFLNQIVQRVIMPCIR 330

Query: 279 EFRPDLVIVSSGFDAADGDTIGKCHVT-PSCYGHMTHMLKSLANGKLCVVLEGGYNLDAI 337
              P+++++  G D   GD   +  +T      ++ ++++      + ++  GGYN   +
Sbjct: 331 SHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYNERLM 390

Query: 338 AR 339
           +R
Sbjct: 391 SR 392

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 105/239 (43%), Gaps = 16/239 (6%)

Query: 150 SLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQK 208
           S+AI    G HH+    A GFC  +++ +  +++ +      K+V  +D+D+H+G+G  K
Sbjct: 183 SIAINWDGGRHHALKHYASGFCYVNDIVLLIQSLRRK---GWKRVTYIDFDLHYGDGVAK 239

Query: 209 AFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWA 268
           AF   + V  +S+H +E G ++PGT       + E +      N+P  + G+ D   +  
Sbjct: 240 AFRFSENVQTISVHLYEPG-FFPGT-----GSLEETRNSKQMVNLP-VLHGMDDKYLLEL 292

Query: 269 FEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCVVL 328
              ++ P+   F  + +++  G D   GD   +  ++     H    +  +   K   +L
Sbjct: 293 ISSVITPLIETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLL 352

Query: 329 -EGGYNLDAIAR-SALAVAKVLI---GEPPDELPAPDKDPKPEAIEMIDRVIDLKSKYW 382
             GGYN   ++R      +KVL          +P  D +      E I+   D   +YW
Sbjct: 353 GGGGYNELLVSRFYTYLTSKVLELYGNNISSSIPEDDSEVLLRDHEFIELYKDENYRYW 411

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 98/209 (46%), Gaps = 12/209 (5%)

Query: 133 GGAIEACKAIVDGKVKNSLAIVRPPG-HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVK 191
           G ++     I     + ++AI    G HH+    A GFC  +++ +  + + K     + 
Sbjct: 196 GASLMLSDFIEKSSSQRTIAINWDGGRHHAIKNKASGFCYINDIVILIQKLRKK---GIS 252

Query: 192 KVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNC 251
           KV  +D+D+HHG+G +KAF     +  +S+H +E G ++P T  G  +    GK      
Sbjct: 253 KVSYIDFDLHHGDGVEKAFRYSSNIQTISMHMYEPG-FFPCT--GSLEDTLNGKNI---V 306

Query: 252 NIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVTPS-CYG 310
           N+P    G+ D        +++ P+     P+++++  G D   GD   +  +T S    
Sbjct: 307 NVPL-YHGVDDNYMTEIVNELIKPLIERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTR 365

Query: 311 HMTHMLKSLANGKLCVVLEGGYNLDAIAR 339
           ++ ++++      + ++  GGYN   ++R
Sbjct: 366 NIQNLIEWFPKSDIILLGGGGYNELVMSR 394

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 104/230 (45%), Gaps = 20/230 (8%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+    A GFC  +++ +  + + KN      +V  VD+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 219 VSLHRFELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGR 278
            SLH FE G ++PGT  G +    E        NIP    G+ D       + I++P   
Sbjct: 252 CSLHLFEAG-FFPGT--GSFKNCRETNV----VNIPL-FHGLDDESLDEIVDNILIPCVN 303

Query: 279 EFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSL---ANGKLCVVLEGGYNLD 335
           +  P+++++  G D   GD   +  +T   +G   ++LK +   +  K+ ++  GGYN  
Sbjct: 304 KHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGGGYNPT 361

Query: 336 AIARSALAVAKVLIGEPPDELPAPDKDPKPEAI---EMIDRVIDLKSKYW 382
             +R    V   L+ +    +P+   D + E I    +ID       K+W
Sbjct: 362 LQSRFYTYVTVCLL-KYHKGIPSLISDSEDEHIIEHHLIDFYRKEAYKFW 410

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 126/307 (41%), Gaps = 75/307 (24%)

Query: 106 DELLSKTELGDSVYFNN-DSYFSAKL--SCGGAIEACKAIVDG--------KVKN-SLAI 153
           DE L+K E+     +N+ D Y S+K   +  G+I A +  VD          V N +  +
Sbjct: 128 DEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGALETGVDSIFEGPSPEHVSNRAFVV 187

Query: 154 VRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQ------ 207
           +RPPGHH       GFCL +N  V+ +     Y   +   +++D+D+HHG+GTQ      
Sbjct: 188 IRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITHAVVLDFDLHHGDGTQDICWKR 245

Query: 208 -------------------KAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKG-- 246
                              K F    RV Y S+H  ++  +   + +   D +       
Sbjct: 246 AGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMH--DINSFPTESGYATKDNIKSASTCI 303

Query: 247 -EGFNCNIPWSV--------------------GGIGDAEYIWAFEQIVMPM-GREFRPDL 284
             G + NI W+V                         A+  +   +I M   G++F+  L
Sbjct: 304 MNGHDLNI-WNVHLSAWETEEDFNKLYQSKYRTLFAKADEFFKNAKIEMSAKGKKFK-GL 361

Query: 285 VIVSSGFDAADGDTIGK----CHVTPSCYGHMTHMLKSLAN----GKLCVVLEGGYNLDA 336
           V++S+GFDA++ + +       +V  + Y   T     LA     GK+  VLEGGY+  A
Sbjct: 362 VVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQMHSEGKVLSVLEGGYSDKA 421

Query: 337 IARSALA 343
           I     A
Sbjct: 422 ITSGVFA 428

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 108/233 (46%), Gaps = 28/233 (12%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLY 218
           HH+    A GFC  +++ +  + + K       KV  +D+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRKQ---GTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 219 VSLHRFELGKYYP--GTIHGQYDQVGEGKGEGFNC-NIPWSVGGIGDAEYIWAFEQIVMP 275
           +SLH +E G ++P  G++ G           GF+  N+P    G+ D+      +Q+V P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFDTVNLPLQ-HGLTDSFLQGLVDQVVNP 311

Query: 276 MGREFRPDLVIVSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLANGKLCVVL---EGGY 332
           + +   P+++++  G D   GDT  +  +  S  G    +L  +++     V+    GGY
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQL--SIRGLTKCILDVMSHSTQAHVILLGGGGY 369

Query: 333 NLDAIARSALAVAKVLIGEPPDELPAPDKDPKPEAIEMIDRVIDLKSKYWKCF 385
           N   ++R    +   ++ +  +  P P  +   E   + D       KY +C+
Sbjct: 370 NPTLMSRFYTYLTGRILHQFKNTDPFPGMNGAQEESLIRDH------KYIECY 416

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 127/328 (38%), Gaps = 70/328 (21%)

Query: 82  SEEILEVH----PKEQLEYLEKTQYL---NRDELLSKTELGDSVYFNNDSYFSAKLSCGG 134
           S+ +L+VH    P+E L+  + +Q      + E+     +GD +Y +  +  + + S G 
Sbjct: 106 SDHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGD-IYLSRQTISALEGSIGA 164

Query: 135 AIEACKAIVDG-----KVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDK 189
                 +I  G         +   +RPPGHHS      GFCL +N  +A +     Y   
Sbjct: 165 LETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--G 222

Query: 190 VKKVMIVDWDIHHGNGTQ-------------------------KAFYNDDRVLYVSLHRF 224
           V   +++D+D+HHG+GTQ                         K F    +V Y SLH  
Sbjct: 223 VTHAVVLDFDLHHGDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDI 282

Query: 225 -----ELGKYYPGTIHGQYDQVGEG--------------KGEGFN--CNIPWSVGGIGDA 263
                ELG      +      + +                 E F       +        
Sbjct: 283 NSFPTELGYATKENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKAD 342

Query: 264 EYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG----KCHVTPSCYGHMTHMLKSL 319
           EY    +Q +  +G+ F+  LV++S+GFDA++ +         +V    Y   T     L
Sbjct: 343 EYFRTAKQNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKL 401

Query: 320 A----NGKLCVVLEGGYNLDAIARSALA 343
           A    +GKL  VLEGGY+  AI+    A
Sbjct: 402 AQMHSHGKLLSVLEGGYSDGAISSGVFA 429

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 79/332 (23%), Positives = 141/332 (42%), Gaps = 79/332 (23%)

Query: 82  SEEILEVH----PKEQLEYLEKTQ---YLNRDELLSKTELGDSVYFNNDSYFSAKLSCGG 134
           S  +L+VH    PKE L+  +++       + E+     +GD +Y +  +  + + S G 
Sbjct: 106 SPHVLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGD-IYLSQQTIAALEGSIGA 164

Query: 135 AIEACKAIVDGKVKNSLA-----IVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDK 189
                 +I  G  +  +A      VRPPGHHS      GFCL +N  +A +     +   
Sbjct: 165 LETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--N 222

Query: 190 VKKVMIVDWDIHHGNGTQ-----KAFYNDD-------------------RVLYVSLHRF- 224
           V   +++D+D+HHG+GTQ     +A +N D                   +V Y S+H   
Sbjct: 223 VTHAVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDIN 282

Query: 225 ----ELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSVG-----------GIGDAEYIWAF 269
               ELG      I      +        + NI W+V             +  ++Y   F
Sbjct: 283 SFPTELGYATKENIKNASTCI----MNAHDLNI-WNVHLSHYETEEDFVKLYQSKYRSLF 337

Query: 270 EQI----------VMPMGREFRPDLVIVSSGFDAADGD--TIGKCHVT-PSCYGHM---- 312
            +           +   G++F+  LV++S+GFDA++ +  ++ +  V  P+C+ +M    
Sbjct: 338 AKADEFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKD 396

Query: 313 -THMLKSLANGKLCVVLEGGYNLDAIARSALA 343
              + +   +GK+  V+EGGY+  AI+    +
Sbjct: 397 ALKLAQMHTSGKVLSVMEGGYSDGAISSGVFS 428

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 79/332 (23%), Positives = 137/332 (41%), Gaps = 79/332 (23%)

Query: 82  SEEILEVH----PKEQLEYLEKTQ-YLNRDEL--LSKTELGDSVYFNNDSYFSAKLSCGG 134
           ++ +L+VH    P E L+  +++Q  L+R E+       +GD +Y +  +  + + S G 
Sbjct: 108 ADHVLKVHGADWPHELLKLCQQSQKALDRGEVEVPESWNVGD-IYLSQQTIGALEGSIGA 166

Query: 135 AIEACKAIVDGKV-----KNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDK 189
                 +I  G         +   +RPPGHHS      GFCL +N  +A +     Y   
Sbjct: 167 LETGIDSIFAGPTPEETSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--N 224

Query: 190 VKKVMIVDWDIHHGNGTQ------------------------KAFYNDDRVLYVSLHRF- 224
           V   +++D+D+HHG+GTQ                        K F    +V Y S+H   
Sbjct: 225 VTHAVVLDFDLHHGDGTQDICWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDIN 284

Query: 225 ----ELGKYYPGTIHGQYDQVGEGKGEGFNCNIPWSV-----------GGIGDAEYIWAF 269
               ELG      I      +     +  + NI W+V             +   +Y   F
Sbjct: 285 SFPTELGYATKENIRNAATCI----MDAHDVNI-WNVHLQPYDSEEAFTKLYQTKYRTLF 339

Query: 270 ----------EQIVMPMGREFRPDLVIVSSGFDAADGD--TIGKCHVTPSCYGHMTHMLK 317
                     +Q +  +G+ F+  LV++S+GFDA++ +  ++ +  V    + + T    
Sbjct: 340 AKADEFFRISKQTMKALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKD 398

Query: 318 SL------ANGKLCVVLEGGYNLDAIARSALA 343
           +L      ++GK+  V+EGGY+  AI     A
Sbjct: 399 ALKLAQMHSHGKVLSVMEGGYSDGAITSGVFA 430

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 102/265 (38%), Gaps = 65/265 (24%)

Query: 134 GAIEA-CKAIVDGKVKNS-----LAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYP 187
           GA+E+   +I DG    S        +RPPGHHS      GFCL +N  +A +     Y 
Sbjct: 162 GALESGVDSIFDGPSAASTPNRAFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY- 220

Query: 188 DKVKKVMIVDWDIHHGNGTQ-------------------------KAFYNDDRVLYVSLH 222
             V    I+D+D+HHG+GTQ                         K F    +V Y SLH
Sbjct: 221 -GVTHAAILDFDLHHGDGTQDICWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLH 279

Query: 223 RFELGKYYPGTIH-GQYDQVGEGKGEGFNCNIPWSVGGIG-------------------- 261
                    G  H            +  + NI W++                        
Sbjct: 280 DINSFPTEQGYAHKTSIKDASVCIMDSHDVNI-WNIHLTAYETEEEFNKLYQTKYRAIFA 338

Query: 262 -DAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGK----CHVTPSCYGHMTHML 316
              E++   ++ +   G+ ++  L+I+S+GFDA++ + +       HV  S Y   T   
Sbjct: 339 KADEFLRVSQKRMASEGKNYK-GLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDA 397

Query: 317 KSLA----NGKLCVVLEGGYNLDAI 337
             LA     GKL  +LEGGY+  A+
Sbjct: 398 LKLAQMHTQGKLLSLLEGGYSDAAL 422

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 117/305 (38%), Gaps = 71/305 (23%)

Query: 106 DELLSKTELGDSVYFN-NDSYFSAKL--SCGGAIEACKAIVDG--------KVKN-SLAI 153
           DE L+K E+     +N  D Y S++   +  G+I A +  VD          + N +   
Sbjct: 129 DEKLAKGEIEVPASWNAGDIYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVA 188

Query: 154 VRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQ------ 207
           +RPPGHH   +   GFCL +N  +A +     Y   +   +I+D+D+HHG+GTQ      
Sbjct: 189 IRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKR 246

Query: 208 -------------------KAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGKG-- 246
                              K F    +V Y S+H  ++  +   + +   + +       
Sbjct: 247 AGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMH--DINSFPTESQYATKENIRNASTCV 304

Query: 247 -EGFNCNI------PWSVGGIGDAEYIWAFEQIVMPMGREFR-------------PDLVI 286
               + NI      PW      D  Y   +  +       FR               LV+
Sbjct: 305 MNAHDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQGLVV 364

Query: 287 VSSGFDAADGDTIGKCHVTPSCYGHMTHMLKSLA--------NGKLCVVLEGGYNLDAIA 338
           +S+GFDA++ +       + +   H   M    A        +GK+  ++EGGY+  AIA
Sbjct: 365 ISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIA 424

Query: 339 RSALA 343
               +
Sbjct: 425 SGVFS 429

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 85/332 (25%), Positives = 129/332 (38%), Gaps = 78/332 (23%)

Query: 82  SEEILEVHPKE---QLEYLEKTQYLNRDELLSKTELGDSVYFN-NDSYFSAKL------S 131
           S  +L+VH K+   QL  L K      D  L+  E+     +N  D Y S+K       S
Sbjct: 103 SPHVLKVHGKDWPPQLLRLCK----EADAKLAAKEVEVPASWNAGDIYLSSKTVEALQGS 158

Query: 132 CGGAIEACKAIVDGKV-----KNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNY 186
            G    A  +I DG         +   +RPPGHH       GFCL +N  VA +     +
Sbjct: 159 IGALETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF 218

Query: 187 PDKVKKVMIVDWDIHHGNGTQ-------------------------KAFYNDDRVLYVSL 221
              V    I+D+D+HHG+GTQ                         K F    RV Y S+
Sbjct: 219 --GVTHAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSM 276

Query: 222 HRFELGKYYPGTIHGQYDQVGEGKG---EGFNCNI------PWSV----GGIGDAEY--- 265
           H  ++  +   + +   + V           + NI      PW        +   +Y   
Sbjct: 277 H--DINSFPTESGYATKENVKNASTCIMNAHDVNIWNIHLSPWETEEDFAKLYHTKYRSL 334

Query: 266 -IWA---FEQIVMPMGREFRP--DLVIVSSGFDAADGDTIGK----CHVTPSCYGHMTHM 315
            + A   F+Q  + M  + +P   LV++SSGFDA++ +         +V    Y   T  
Sbjct: 335 FVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKD 394

Query: 316 LKSLA----NGKLCVVLEGGYNLDAIARSALA 343
              L+    +GK+  ++EGGY+  AI     A
Sbjct: 395 ALKLSQMHCHGKVLSIMEGGYSDKAIVSGVFA 426

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 132/331 (39%), Gaps = 76/331 (22%)

Query: 82  SEEILEVH----PKEQLEYLEKTQYLNRDELLSKTELGDSVYFN-NDSYFSAKL--SCGG 134
           S  +L+VH    P+  LE  ++      D  L   E+     +N  D Y S+K   +  G
Sbjct: 108 SPHVLKVHGNDWPRNLLEICKQA-----DTKLQNNEIEVPDNWNAGDIYLSSKTIEALEG 162

Query: 135 AIEACKAIVDGKVK---------NSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKN 185
           +I A +  +D              +   +RPPGHH +     GFCL +N  ++ +    +
Sbjct: 163 SIAAIETGIDSIFNGPSPEHICNRAFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADH 222

Query: 186 YPDKVKKVMIVDWDIHHGNGTQ-------------------------KAFYNDDRVLYVS 220
           Y   +   +I+D+D+HHG+GTQ                         K F    +V Y S
Sbjct: 223 Y--GITHAVILDFDLHHGDGTQDICWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFS 280

Query: 221 LH---RFELGKYYPGTIHGQYDQVGEGKGEGFNC-NI---PWSV----GGIGDAEY--IW 267
           +H    F     Y   ++ +        G   N  NI   PW+       +  ++Y  ++
Sbjct: 281 MHDINSFPTETGYATKVNIRNASTCIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLF 340

Query: 268 A-----FEQIVMPMGREFRP--DLVIVSSGFDAADGDTIG----KCHVTPSCYGHMTHML 316
           A     F      M +E +P   LV++S+GFDA++ +         +V  + Y   T   
Sbjct: 341 AKADDYFRNAKYQMAQEGKPFKGLVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDA 400

Query: 317 KSLA----NGKLCVVLEGGYNLDAIARSALA 343
             LA     GK+  +LEGGY+  A+     A
Sbjct: 401 LKLAQIHCQGKVLSLLEGGYSDKALTSGVFA 431

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 7/95 (7%)

Query: 118 VYFNNDSYFSAKLSCGGAIEACKAIVDGK-----VKNSLAIVRPPGHHSEPEVAGGFCLF 172
           +Y N+D+  + K S G       +I +G         +   +RPPGHH    +  GFCL 
Sbjct: 148 IYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGMPSGFCLL 207

Query: 173 SNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQ 207
           +N  +  +     Y   V  V+++D+D+HHG+GTQ
Sbjct: 208 NNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 9/88 (10%)

Query: 264 EYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG----KCHVTPSCYGHMTHMLKSL 319
           E+  A +  +  MG+ ++  LV++SSGFDA++ + +       +V  + Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 320 A----NGKLCVVLEGGYNLDAIARSALA 343
           A    +GK+  ++EGGY+  AI     A
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAITSGVFA 432

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 102/255 (40%), Gaps = 67/255 (26%)

Query: 150 SLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGT--- 206
           +   +RPPGHH       GFCL +N  +A +   + Y   V   +I+D+D+HHG+GT   
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 207 ---QKAFYNDD-----------------------RVLYVSLHRFELGKYYPGTIHGQYDQ 240
              +  F  DD                       +V Y S+H  ++  +   + +   D 
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMH--DINSFPTESGYATKDN 301

Query: 241 VGEGKG---EGFNCNIPWSV-----------GGIGDAEYIWAFEQI----------VMPM 276
           +        +  + NI W+V             +   +Y   F +           +  M
Sbjct: 302 IKNASTCVMDAHDLNI-WNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEM 360

Query: 277 GREFRPDLVIVSSGFDAADGDTIG----KCHVTPSCYGHMTHMLKSLA----NGKLCVVL 328
            + F+  LV++S+GFDA++ +         +V  S Y   T     LA    NGK+  VL
Sbjct: 361 NKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVL 419

Query: 329 EGGYNLDAIARSALA 343
           EGGY+  AIA    +
Sbjct: 420 EGGYSDKAIASGVFS 434

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 65/135 (48%), Gaps = 15/135 (11%)

Query: 85  ILEVHPKE-QLEYLEKTQYLNRDELLSKTELGDSVYFNNDSYFSAKL--SCGGAIEACKA 141
           +L+VH      E +E  Q  +   L  + E+ D+ + + D Y S+K   +  G I A + 
Sbjct: 110 VLKVHGSHWPTELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIQALQGTIGAIET 168

Query: 142 IVDGKVK---------NSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKK 192
            VD   K          +   +RPPGHH       GFCL +N  VA +     Y   V  
Sbjct: 169 GVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTH 226

Query: 193 VMIVDWDIHHGNGTQ 207
           V+++D+D+HHG+GTQ
Sbjct: 227 VVVLDFDLHHGDGTQ 241

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 73/164 (44%), Gaps = 28/164 (17%)

Query: 60  PALSGIDDIGDLMCKIPVREATSEEILEVH----PKEQLEYLEKTQYLNRDELLSKTELG 115
           PAL  +      M  I      S  + +VH    PKE ++  ++      DE L+K E+ 
Sbjct: 88  PALFTLKSSNQRMGSI-----MSPHVYKVHGKEWPKEVIQLCKEA-----DEKLAKGEIE 137

Query: 116 DSVYFN-NDSYFSAKL--SCGGAIEACKAIVDGKVK---------NSLAIVRPPGHHSEP 163
               +N  D Y S+K   +  G I A +  VD   K          +   +RPPGHH   
Sbjct: 138 VPESWNAGDIYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAFVAIRPPGHHCHF 197

Query: 164 EVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQ 207
               GFCL +N  VA +     Y   V  V ++D+D+HHG+GTQ
Sbjct: 198 ATPSGFCLLNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQ 239

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 65/135 (48%), Gaps = 15/135 (11%)

Query: 85  ILEVHPKE-QLEYLEKTQYLNRDELLSKTELGDSVYFNNDSYFSAKL--SCGGAIEACKA 141
           +L+VH      E +E  Q  +   L  + E+ D+ + + D Y S+K   +  G I A + 
Sbjct: 110 VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGAIET 168

Query: 142 IVDGKVK---------NSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKK 192
            VD   K          +   +RPPGHH       GFCL +N  VA +     Y   V  
Sbjct: 169 GVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 193 VMIVDWDIHHGNGTQ 207
           V+++D+D+HHG+GTQ
Sbjct: 227 VVVLDFDLHHGDGTQ 241

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 10/85 (11%)

Query: 269 FEQIVMPMGREFRP--DLVIVSSGFDAADGDTIG----KCHVTPSCYGHMTHMLKSLA-- 320
           F    + M ++ RP   LV++S+GFDA++ +         +V  S Y   T     LA  
Sbjct: 345 FRSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQM 404

Query: 321 --NGKLCVVLEGGYNLDAIARSALA 343
             +GK+  ++EGGY+  AI     A
Sbjct: 405 HCHGKVLSLMEGGYSDKAICSGVFA 429

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 143 VDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHH 202
           V+     +   +RPPGHHS      GFCL +N  +A +   + Y   V   +I+D+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 203 GNGTQ 207
           G+GTQ
Sbjct: 234 GDGTQ 238

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 111 KTELGDSVYFNNDSYFSAKL--SCGGAIEACKAIVDGKVK---------NSLAIVRPPGH 159
           K E+ DS + + D Y S+K   +  G+I A +  VD   K          +   +RPPGH
Sbjct: 135 KLEVPDS-WNSGDIYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGH 193

Query: 160 HSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQ 207
           H       GFC+ +N  VA +    +Y   V  V ++D+D+HHG+GTQ
Sbjct: 194 HCHFATPSGFCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 66/135 (48%), Gaps = 15/135 (11%)

Query: 85  ILEVHPKE-QLEYLEKTQYLNRDELLSKTELGDSVYFNNDSYFSAKL--SCGGAIEACKA 141
           +L+VH      E +E  Q  +   L  + E+ D+ + + D Y S+K   +  G I A + 
Sbjct: 110 VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGAIET 168

Query: 142 IVDG--------KVKN-SLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKK 192
            VD          + N +   +RPPGHH       GFCL +N  VA +     Y   V  
Sbjct: 169 GVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 193 VMIVDWDIHHGNGTQ 207
           V+++D+D+HHG+GTQ
Sbjct: 227 VVVLDFDLHHGDGTQ 241

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 60/124 (48%), Gaps = 14/124 (11%)

Query: 95  EYLEKTQYLNRDELLSKTELGDSVYFNNDSYFSAKL--SCGGAIEACKAIVDGKVK---- 148
           E ++  Q  +   L  + E+ D+ + + D Y S+K   +  G I A +  VD   K    
Sbjct: 121 ELIKLCQEADSKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGAIETGVDSIFKGPSP 179

Query: 149 -----NSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHG 203
                 +   +RPPGHH       GFCL +N  VA +     Y   V  V+++D+D+HHG
Sbjct: 180 EHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHG 237

Query: 204 NGTQ 207
           +GTQ
Sbjct: 238 DGTQ 241

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 74/151 (49%), Gaps = 12/151 (7%)

Query: 159 HHSEPEVAGGFCLFSNVAVATKNILKNYPDKV---KKVMIVDWDIHHGNGTQKAFYNDDR 215
           HH+    A GFC  +++ V+  N L+  P +    +K+  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 216 VLYVSLHRFELGKYYPGTIHGQYDQVGEGKGEGFN-CNIPWSVGGIGDAEYIWAFEQIVM 274
           +  +S+H FE G +YP T   ++     GK +  N  N+P    G+ ++        I++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNIINLPVK-HGLSNSNMFELVTNIII 317

Query: 275 PMGREFRPDLVIVSSGFDAADGDTIGKCHVT 305
           P+    + D +++  G D  + D   +  +T
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT 348

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 25/140 (17%)

Query: 85  ILEVH----PKEQLEYLEKTQYLNRDELLSKTEL--------GDSVYFNNDSYFSAKLSC 132
           +L+VH    P+E  +  ++      DE L++ E+        GD +Y ++ +  + + + 
Sbjct: 107 VLKVHGSRWPREVYKLCKRA-----DEKLARGEIEVPKEWNAGD-IYLSSATLTALRGTI 160

Query: 133 GGAIEACKAIVDGKVKNSLA-----IVRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYP 187
           G        I  G     ++     +VRPPGHH       GFCL +N  ++ +     Y 
Sbjct: 161 GALETGVDTIFTGASPEHISNRVFVVVRPPGHHCHVTGPSGFCLLNNAHISIEYAADTY- 219

Query: 188 DKVKKVMIVDWDIHHGNGTQ 207
             V    I+D+D+HHG+GTQ
Sbjct: 220 -GVTHAAILDFDLHHGDGTQ 238

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 154 VRPPGHHSEPEVAGGFCLFSNVAVATKNILKNYPDKVKKVMIVDWDIHHGNGTQ 207
           +RPPGHH       GFCL +N  +  +     Y   V   +I+D+D+HHG+GTQ
Sbjct: 186 IRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQ 237

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 9/76 (11%)

Query: 276 MGREFRPDLVIVSSGFDAADGDTIG----KCHVTPSCYGHMTHMLKSLA----NGKLCVV 327
           +G+ F+  LV++S+GFDA++ +         +V  S Y   T     LA     GK+  +
Sbjct: 351 LGKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSL 409

Query: 328 LEGGYNLDAIARSALA 343
           LEGGY+  AI     +
Sbjct: 410 LEGGYSDKAITSGVFS 425

>AGR201C Chr7 complement(1129966..1131768) [1803 bp, 600 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL086C
           (ELP3)
          Length = 600

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 10/71 (14%)

Query: 43  RIYRIYKIL--------AENGLIRDPALSGIDDIGDLMCKIPVREATSEEI-LEVHPKEQ 93
           RIYR+ + +         ENG +R+ AL+ + D G     +  RE   +E+  +VHP EQ
Sbjct: 412 RIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTREVGIQEVHHKVHP-EQ 470

Query: 94  LEYLEKTQYLN 104
           +E + +  Y N
Sbjct: 471 VELIRRDYYAN 481

>Kwal_33.13556 s33 (280291..282030) [1740 bp, 580 aa] {OFF} YNL243W
           (SLA2) - transmembrane protein [contig 115] PARTIAL
          Length = 580

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 17/147 (11%)

Query: 487 ASL-QFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKIA 545
           ASL + Y    + GYG I     Q L ++ N+  S        K ++   +Y   ++ ++
Sbjct: 90  ASLGRIYSVGSNDGYGRIIEEYVQLLLKKLNFHRSH-------KGFNGTFEYEEYMSLVS 142

Query: 546 YIGVGEAYSGLVHLLGHRDTRSVVKSVI------GFVGKKPLKALVPLVEESLADWYFKT 599
                E Y  ++ L+  +D       ++      G   +  + ALVPLV ES   + F T
Sbjct: 143 TSNPDEGYETILDLMDLQDALDAFGRILFASISSGRRNECKISALVPLVSESYGIYKFIT 202

Query: 600 SLLFADKNHSCWGENDSKKP-RKRYGR 625
           S++ A   H   GE+ + +P   RY R
Sbjct: 203 SMIRA--MHKQTGEDGALEPLHDRYSR 227

>Kwal_YGOB_33.13556 s33 (280291..282063) [1773 bp, 591 aa] {ON}
           ANNOTATED BY YGOB - YNL243W (SLA2) - transmembrane
           protein [contig 115] PARTIAL
          Length = 591

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 17/147 (11%)

Query: 487 ASL-QFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKIA 545
           ASL + Y    + GYG I     Q L ++ N+  S        K ++   +Y   ++ ++
Sbjct: 90  ASLGRIYSVGSNDGYGRIIEEYVQLLLKKLNFHRSH-------KGFNGTFEYEEYMSLVS 142

Query: 546 YIGVGEAYSGLVHLLGHRDTRSVVKSVI------GFVGKKPLKALVPLVEESLADWYFKT 599
                E Y  ++ L+  +D       ++      G   +  + ALVPLV ES   + F T
Sbjct: 143 TSNPDEGYETILDLMDLQDALDAFGRILFASISSGRRNECKISALVPLVSESYGIYKFIT 202

Query: 600 SLLFADKNHSCWGENDSKKP-RKRYGR 625
           S++ A   H   GE+ + +P   RY R
Sbjct: 203 SMIRA--MHKQTGEDGALEPLHDRYSR 227

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,502,915
Number of extensions: 3508734
Number of successful extensions: 8963
Number of sequences better than 10.0: 114
Number of HSP's gapped: 8891
Number of HSP's successfully gapped: 127
Length of query: 659
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 543
Effective length of database: 40,180,143
Effective search space: 21817817649
Effective search space used: 21817817649
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)