Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.34singletonON1295129563810.0
Kpol_1066.33singletonON41540915610.0
Smik_40.1singletonON93056415990.0
YNL054W-BsingletonOFF174956416460.0
SAKL0B11583g2singletonON175556416150.0
SAKL0C11913g1singletonON175556416110.0
SAKL0F06809g2singletonON175556416080.0
Smik_45.1singletonON75650514650.0
NDAI0B06160singletonON140356214521e-177
KNAG0F03765singletonON109555613971e-172
Kwal_1.414singletonON58655613421e-170
Kwal_55.19796singletonON74755613501e-169
NDAI0D03060singletonON130347513191e-159
Kpol_1066.30singletonON26226212121e-156
Smik_49.2singletonON55048611491e-143
Kwal_12.670singletonON40839410261e-127
TDEL0E00260singletonON124843210481e-121
NDAI0G00600singletonON4884179821e-119
KNAG0A01870singletonON77645910031e-119
KAFR0B06620singletonON118548810071e-115
NCAS0A05800singletonON3193189321e-115
Skud_12.300singletonON3983719131e-111
TPHA0H01270singletonON13653409571e-108
NDAI0B00750singletonON3583378551e-103
Kwal_54.19470singletonON5424488691e-103
Kwal_27.12438singletonON6414488731e-102
Kwal_39.16409singletonON7344488671e-100
Kwal_13.691singletonON8654488751e-100
KAFR0K02290singletonON2992868151e-98
Kwal_27.11219singletonON7444138481e-97
TDEL0H04520singletonON6122998039e-93
Kwal_55.19799singletonON3543617729e-92
Kwal_20.2719singletonON4723067681e-89
Kwal_14.764singletonON3583507501e-88
Kwal_50.19415singletonON3072757442e-88
Kwal_33.15089singletonON4783577505e-87
NDAI0G00550singletonON4123377331e-85
Kwal_36.16338singletonON6043577457e-85
KNAG0E03750singletonON2942797132e-84
Kwal_33.15087singletonON3462567024e-82
Kwal_14.773singletonON3283176943e-81
Kwal_23.3719singletonON3283176854e-80
Kwal_47.17030singletonON3283176774e-79
NDAI0A01430singletonON2532476572e-77
Kwal_39.16413singletonON2572126381e-74
Kwal_26.7891singletonON3102666323e-73
Kwal_9.621singletonON2942066287e-73
Kwal_47.17031singletonON5832096423e-71
Kwal_54.19476singletonON2152105882e-68
TDEL0H00110singletonON2941955934e-68
Kwal_60.24910singletonON5243216092e-67
Kwal_50.19418singletonON3482555881e-66
Smik_89.1singletonON2512505771e-66
Kwal_13.689singletonON2712595571e-63
Kwal_47.17665singletonON6252555862e-63
Kwal_2.424singletonON2392365505e-63
Kwal_13.685singletonON2352235354e-61
Kpol_414.5singletonON12895525904e-61
Kwal_34.16313singletonON2282155292e-60
NDAI0G00400singletonON18295315773e-59
Kwal_47.19348singletonON2692615211e-58
Kpol_1066.31singletonON1081094986e-58
Kwal_39.16415singletonON2312315108e-58
TPHA0B03640singletonON10255285544e-57
TPHA0O01190singletonON7025285424e-57
TPHA0P01400singletonON16445285532e-56
TPHA0K02100singletonON16385285504e-56
Kwal_9.616singletonON3472744981e-54
Skud_46.2singletonON3791924992e-54
NDAI0D00680singletonON2342284816e-54
Kpol_423.17singletonON5164855058e-54
TBLA0B08200singletonON4572534902e-52
TBLA0B05400singletonON18185375193e-52
Skud_82.1singletonON1691634562e-51
Kpol_1046.15singletonON9125345042e-51
Kwal_27.12442singletonON1991674541e-50
Kwal_47.17664singletonON2081854532e-50
Kwal_27.11215singletonON2132124515e-50
TPHA0L01530singletonON15244344961e-49
TPHA0I02520singletonON15094344932e-49
Smik_31.1singletonON11814054806e-48
TPHA0G01020singletonON14244264745e-47
TBLA0E02360singletonON3451874397e-47
KNAG0B03890singletonON2681964274e-46
KAFR0K02295singletonON1901734133e-45
Kwal_47.19342singletonON2462363982e-42
NCAS0E00690singletonON2471383911e-41
Kwal_9.622singletonON1791593841e-41
NDAI0B00740singletonON5822324142e-41
NCAS0A09640singletonON5011614065e-41
Kpol_1055.48singletonON1041043664e-40
Kwal_12.676singletonON1291203651e-39
Kwal_1.407singletonON1861833701e-39
Smik_5.284singletonOFF2923183782e-39
Skud_62.1singletonON3383433733e-38
Kpol_464.1singletonON11795103885e-37
Kpol_440.15singletonON3373573541e-35
Kpol_1066.34singletonON120843287e-35
NDAI0I02670singletonON15305133663e-34
Suva_10.195singletonON1201213234e-34
Suva_3.98singletonON1471473246e-34
Smik_1.82singletonON5033373472e-33
Kpol_462.1singletonON17265103583e-33
Kwal_47.17033singletonON1171153163e-33
TPHA0I03315singletonON1401233174e-33
Kwal_23.3714singletonON2761613295e-33
Kwal_23.3717singletonON1731263188e-33
Suva_4.242singletonON9793563511e-32
YPL060C-AsingletonOFF11043243385e-31
Kwal_34.16304singletonON3112183113e-30
Kwal_47.19344singletonON125962803e-28
Suva_10.196singletonON1351122794e-28
Kwal_13.687singletonON100732722e-27
KNAG0G00960singletonON10085243063e-27
Kwal_33.14867singletonON7205303033e-27
KNAG0L00780singletonON15484893047e-27
Kpol_377.1singletonON4794242893e-26
TBLA0B08350singletonON4363912865e-26
Skud_7.460singletonON1701442675e-26
TBLA0E02365singletonON153942612e-25
Kwal_47.17294singletonON79712472e-24
TPHA0O01180singletonON3202992592e-23
TDEL0H00120singletonON106912413e-23
TPHA0G00155singletonON1231222415e-23
TBLA0C00570singletonON4783242637e-23
Kpol_381.2singletonON4034202572e-22
KNAG0M01670singletonON2722592492e-22
Kwal_39.16392singletonON1751792412e-22
Smik_13.226singletonON100992307e-22
Kwal_2.432singletonON90872298e-22
TBLA0F03530singletonON8785112581e-21
Kwal_33.15086singletonON89862262e-21
TPHA0I00530singletonON3783432472e-21
Smik_118.1singletonON1811642316e-21
Kwal_23.3713singletonON78742208e-21
Kwal_39.16423singletonON74742191e-20
TBLA0A10570singletonON473932451e-20
Smik_13.224singletonON1201112222e-20
TPHA0B03180singletonON7894462482e-20
KNAG0M01680singletonON2442462303e-20
TBLA0A00240singletonON2711732271e-19
TDEL0H00100singletonON1291012161e-19
Kwal_2.426singletonON2941012263e-19
Kwal_14.771singletonON112862105e-19
NDAI0G00540singletonON2751082226e-19
Kwal_34.16307singletonON77732067e-19
Skud_12.513singletonON1701442084e-18
Smik_12.565singletonON1081022034e-18
Kpol_1026.3singletonON1541382041e-17
Kpol_489.22singletonON2292192091e-17
Skud_2.338singletonOFF1361771984e-17
Kwal_34.16311singletonON88681928e-17
Skud_57.1singletonON1121071931e-16
TBLA0B08190singletonON3791692082e-16
Kwal_55.22271singletonON1631611952e-16
Skud_57.3singletonON1421321923e-16
NDAI0D01220singletonON2882211981e-15
TBLA0F01880singletonON2241691941e-15
Smik_12.567singletonON1911881911e-15
Kwal_47.17669singletonOFF1331131852e-15
KAFR0B06625singletonON5221662023e-15
Suva_10.194singletonON106581796e-15
Smik_3.3singletonON4054131967e-15
Kwal_1.410singletonON2101171877e-15
Kwal_39.16421singletonOFF1211131791e-14
Kwal_26.7403singletonON1911161813e-14
NDAI0B04850singletonON73721688e-14
Smik_124.1singletonON1671761742e-13
TBLA0E03550singletonON9611781863e-13
TBLA0C00120singletonON6101351801e-12
Kpol_202.1singletonON2112021701e-12
TPHA0M02160singletonON5661771792e-12
NDAI0D00670singletonON1071061593e-12
Skud_12.299singletonON66611537e-12
Suva_14.55singletonON5851321731e-11
Kwal_12.672singletonON156621582e-11
KNAG0G00963singletonON3281821653e-11
Kwal_54.19474singletonOFF214621585e-11
TBLA0F03190singletonON3222161635e-11
Kpol_1054.13singletonON8154981676e-11
Kwal_12.680singletonOFF1121001507e-11
Smik_12.566singletonON1231211491e-10
Kwal_34.16309singletonON344621592e-10
KNAG0G02840singletonON4142191602e-10
Kwal_50.19421singletonON177981503e-10
KNAG0C06675singletonON2822281544e-10
TBLA0D02690singletonON1761241486e-10
Kwal_2.422singletonOFF101921427e-10
TBLA0A06870singletonON1861131461e-09
Skud_14.332singletonON306691465e-09
Kpol_322.9singletonON2492231446e-09
KAFR0A01750singletonON5391361488e-09
Kpol_137.2singletonON1421271361e-08
Smik_12.38singletonOFF2971251422e-08
Kpol_377.2singletonON10991741462e-08
Kpol_267.2singletonON3183101395e-08
Kpol_248.1singletonON3183101395e-08
Skud_46.1singletonON98711276e-08
KLTH0B04686gsingletonON104781277e-08
Skud_14.331singletonON100731251e-07
Kwal_12.679singletonOFF63531211e-07
Kwal_47.19345singletonON99931241e-07
Kwal_34.15661singletonOFF95891214e-07
Smik_13.225singletonON40401155e-07
KNAG0D03630singletonON51391112e-06
Skud_46.3singletonON32311103e-06
NCAS0B05650singletonON292691234e-06
Kwal_27.11216singletonOFF64491104e-06
YCL074WsingletonOFF3083181235e-06
Kpol_381.1singletonON11972151257e-06
Smik_108.1singletonON1631481168e-06
TBLA0B08195singletonON3501521211e-05
TBLA0D04530singletonON4714171211e-05
Kpol_1018.175singletonON8161761221e-05
TBLA0B06380singletonON165481113e-05
Kpol_1035.1singletonON2592481111e-04
Kpol_272.2singletonON87711021e-04
Kwal_36.16337singletonOFF85871011e-04
Kpol_1036.29singletonON110711032e-04
Suva_6.192singletonON6002681122e-04
Kwal_34.16308singletonOFF87391002e-04
Kwal_14.769singletonOFF128501014e-04
Kpol_1061.17singletonON2952341074e-04
Kwal_26.7895singletonOFF8676940.002
Kpol_455.14singletonON278871000.003
Kpol_2000.35singletonON7041381010.003
NCAS0G02330singletonON6571091000.005
Kwal_55.19798singletonOFF10245880.013
Kpol_1059.43singletonON20572920.016
Kwal_12.675singletonON13245890.016
KNAG0J01130singletonON246165930.018
Smik_12.315singletonON11281870.018
Suva_6.194singletonON14692880.031
Kwal_26.7889singletonON28142910.032
Kwal_9.619singletonON17345880.041
Suva_10.197singletonON3229780.047
Smik_3.59singletonOFF13849860.050
Kwal_14.767singletonON18345870.056
Kwal_1.406singletonOFF10069810.11
CAGL0G07183g2singletonON1504207880.13
Skud_110.1singletonON186196840.14
NDAI0F01730singletonON138116820.15
Kwal_33.15092singletonOFF17689830.16
TBLA0I028504.233ON70669840.33
NCAS0A05290singletonON92678840.45
NCAS0H03510singletonON122078830.51
Kwal_56.237998.262ON48851781.9
Kwal_23.3711singletonOFF11164722.1
Skud_63.2singletonON10972695.4
NCAS0H024705.505ON30675735.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.34
         (1295 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON} (80237...  2462   0.0  
Kpol_1066.33 s1066 complement(54660..55907) [1248 bp, 415 aa] {O...   605   0.0  
Smik_40.1 Chr40 (1..2793) [2793 bp, 930 aa] {ON} YNL054W-B (REPEAT)   620   0.0  
YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 a...   638   0.0  
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...   626   0.0  
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...   625   0.0  
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...   624   0.0  
Smik_45.1 Chr45 complement(3..2270) [2268 bp, 756 aa] {ON}  YNL0...   568   0.0  
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}           563   e-177
KNAG0F03765 Chr6 (715917..716089,716091..719205) [3288 bp, 1095 ...   542   e-172
Kwal_1.414 s1 (3588..5348) [1761 bp, 586 aa] {ON} YCL074W - Psue...   521   e-170
Kwal_55.19796 s55 complement(129910..132153) [2244 bp, 747 aa] {...   524   e-169
NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON}             512   e-159
Kpol_1066.30 s1066 complement(52257..53045) [789 bp, 262 aa] {ON...   471   e-156
Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B (RE...   447   e-143
Kwal_12.670 s12 complement(38284..39510) [1227 bp, 408 aa] {ON} ...   399   e-127
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...   408   e-121
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...   382   e-119
KNAG0A01870 Chr1 (132203..134533) [2331 bp, 776 aa] {ON}              390   e-119
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...   392   e-115
NCAS0A05800 Chr1 (1141745..1142704) [960 bp, 319 aa] {ON}             363   e-115
Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {...   356   e-111
TPHA0H01270 Chr8 (284616..288713) [4098 bp, 1365 aa] {ON}             373   e-108
NDAI0B00750 Chr2 (169331..170407) [1077 bp, 358 aa] {ON}              333   e-103
Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -...   339   e-103
Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR3...   340   e-102
Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A ...   338   e-100
Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON} YB...   341   e-100
KAFR0K02290 Chr11 (467694..468593) [900 bp, 299 aa] {ON}              318   1e-98
Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {...   331   1e-97
TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {O...   313   9e-93
Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {...   301   9e-92
Kwal_20.2719 s20 complement(2073..3491) [1419 bp, 472 aa] {ON} Y...   300   1e-89
Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A ...   293   1e-88
Kwal_50.19415 s50 complement(2..922) [921 bp, 307 aa] {ON} YLR03...   291   2e-88
Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {...   293   5e-87
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...   286   1e-85
Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A ...   291   7e-85
KNAG0E03750 Chr5 (743927..744811) [885 bp, 294 aa] {ON}               279   2e-84
Kwal_33.15087 s33 complement(955836..956876) [1041 bp, 346 aa] {...   275   4e-82
Kwal_14.773 s14 (35373..36359) [987 bp, 328 aa] {ON} YBL101W-B -...   271   3e-81
Kwal_23.3719 s23 (402936..403922) [987 bp, 328 aa] {ON} YLR410W-...   268   4e-80
Kwal_47.17030 s47 complement(215874..216860) [987 bp, 328 aa] {O...   265   4e-79
NDAI0A01430 Chr1 (320300..321061) [762 bp, 253 aa] {ON}               257   2e-77
Kwal_39.16413 s39 (9645..10418) [774 bp, 257 aa] {ON} YER160C - ...   250   1e-74
Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON...   248   3e-73
Kwal_9.621 s9 (2869..3753) [885 bp, 294 aa] {ON} YJL113W - TyB G...   246   7e-73
Kwal_47.17031 s47 complement(216862..218613) [1752 bp, 583 aa] {...   251   3e-71
Kwal_54.19476 s54 (2448..3092) [645 bp, 215 aa] {ON} YBL101W-B -...   231   2e-68
TDEL0H00110 Chr8 (2134..3018) [885 bp, 294 aa] {ON}                   233   4e-68
Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B ...   239   2e-67
Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON} ...   231   1e-66
Smik_89.1 Chr89 complement(2..754) [753 bp, 251 aa] {ON} YNL054W...   226   1e-66
Kwal_13.689 s13 complement(1951..2763) [813 bp, 271 aa] {ON} YLR...   219   1e-63
Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {...   230   2e-63
Kwal_2.424 s2 (2177..2896) [720 bp, 239 aa] {ON} YBL101W-B - TyB...   216   5e-63
Kwal_13.685 s13 complement(731..1438) [708 bp, 235 aa] {ON} YLR4...   210   4e-61
Kpol_414.5 s414 (15737..19603) [3867 bp, 1289 aa] {ON} (15737..1...   231   4e-61
Kwal_34.16313 s34 (283644..284327) [684 bp, 228 aa] {ON} YAR009C...   208   2e-60
NDAI0G00400 Chr7 (78577..79731,79733..84067) [5490 bp, 1829 aa] ...   226   3e-59
Kwal_47.19348 s47 (1201985..1202794) [810 bp, 269 aa] {ON} YJL11...   205   1e-58
Kpol_1066.31 s1066 complement(53055..53135,53139..53381) [324 bp...   196   6e-58
Kwal_39.16415 s39 (10712..11407) [696 bp, 231 aa] {ON} YAR009C -...   201   8e-58
TPHA0B03640 Chr2 complement(851392..854469) [3078 bp, 1025 aa] {...   218   4e-57
TPHA0O01190 Chr15 (230494..232602) [2109 bp, 702 aa] {ON}             213   4e-57
TPHA0P01400 Chr16 complement(285031..289965) [4935 bp, 1644 aa] ...   217   2e-56
TPHA0K02100 Chr11 (449107..454023) [4917 bp, 1638 aa] {ON}            216   4e-56
Kwal_9.616 s9 (909..1952) [1044 bp, 347 aa] {ON} YLR410W-B - TyB...   196   1e-54
Skud_46.2 Chr46 complement(436..1575) [1140 bp, 379 aa] {ON}  YN...   196   2e-54
NDAI0D00680 Chr4 (145699..146403) [705 bp, 234 aa] {ON}               189   6e-54
Kpol_423.17 s423 complement(41262..42812) [1551 bp, 516 aa] {ON}...   199   8e-54
TBLA0B08200 Chr2 (1957742..1959115) [1374 bp, 457 aa] {ON}  poss...   193   2e-52
TBLA0B05400 Chr2 (1268360..1269490,1269492..1273817) [5457 bp, 1...   204   3e-52
Skud_82.1 Chr82 complement(248..757) [510 bp, 169 aa] {ON} YNL05...   180   2e-51
Kpol_1046.15 s1046 complement(34637..37375) [2739 bp, 912 aa] {O...   198   2e-51
Kwal_27.12442 s27 (1221132..1221728) [597 bp, 199 aa] {ON} YER16...   179   1e-50
Kwal_47.17664 s47 complement(504858..505484) [627 bp, 208 aa] {O...   179   2e-50
Kwal_27.11215 s27 complement(689663..690304) [642 bp, 213 aa] {O...   178   5e-50
TPHA0L01530 Chr12 (320935..325509) [4575 bp, 1524 aa] {ON}            195   1e-49
TPHA0I02520 Chr9 (556711..561240) [4530 bp, 1509 aa] {ON}             194   2e-49
Smik_31.1 Chr31 complement(2..3544) [3543 bp, 1181 aa] {ON}  YPL...   189   6e-48
TPHA0G01020 Chr7 complement(201378..205652) [4275 bp, 1424 aa] {...   187   5e-47
TBLA0E02360 Chr5 (589208..590245) [1038 bp, 345 aa] {ON}              173   7e-47
KNAG0B03890 Chr2 (747968..748774) [807 bp, 268 aa] {ON}               169   4e-46
KAFR0K02295 Chr11 complement(469108..469680) [573 bp, 190 aa] {ON}    163   3e-45
Kwal_47.19342 s47 (1199239..1199979) [741 bp, 246 aa] {ON} YOR34...   157   2e-42
NCAS0E00690 Chr5 complement(124188..124931) [744 bp, 247 aa] {ON}     155   1e-41
Kwal_9.622 s9 (3778..4317) [540 bp, 179 aa] {ON} YLR410W-B - TyB...   152   1e-41
NDAI0B00740 Chr2 (166514..168262) [1749 bp, 582 aa] {ON}              164   2e-41
NCAS0A09640 Chr1 (1924869..1926374) [1506 bp, 501 aa] {ON}            160   5e-41
Kpol_1055.48 s1055 complement(119033..119347) [315 bp, 104 aa] {...   145   4e-40
Kwal_12.676 s12 complement(40672..41061) [390 bp, 129 aa] {ON} Y...   145   1e-39
Kwal_1.407 s1 (1976..2536) [561 bp, 186 aa] {ON} YAR009C - TyB G...   147   1e-39
Smik_5.284 Chr5 complement(444948..445094,445098..445289,445293....   150   2e-39
Skud_62.1 Chr62 complement(2..1015) [1014 bp, 338 aa] {ON} YNL05...   148   3e-38
Kpol_464.1 s464 complement(2019..5558) [3540 bp, 1179 aa] {ON} c...   154   5e-37
Kpol_440.15 s440 (39287..39952,39954..40301) [1014 bp, 337 aa] {...   140   1e-35
Kpol_1066.34 s1066 complement(55995..56357) [363 bp, 120 aa] {ON...   130   7e-35
NDAI0I02670 Chr9 (625423..630015) [4593 bp, 1530 aa] {ON}             145   3e-34
Suva_10.195 Chr10 (373045..373104,373108..373407) [360 bp, 120 a...   129   4e-34
Suva_3.98 Chr3 complement(142812..143252) [441 bp, 147 aa] {ON} ...   129   6e-34
Smik_1.82 Chr1 complement(155637..157145) [1509 bp, 503 aa] {ON}...   138   2e-33
Kpol_462.1 s462 complement(798..5978) [5181 bp, 1726 aa] {ON} co...   142   3e-33
Kwal_47.17033 s47 complement(218594..218947) [354 bp, 117 aa] {O...   126   3e-33
TPHA0I03315 Chr9 (735235..735657) [423 bp, 140 aa] {ON}               126   4e-33
Kwal_23.3714 s23 (401122..401952) [831 bp, 276 aa] {ON} YJL113W ...   131   5e-33
Kwal_23.3717 s23 (402155..402676) [522 bp, 173 aa] {ON} YER160C ...   127   8e-33
Suva_4.242 Chr4 complement(428432..431371) [2940 bp, 979 aa] {ON...   139   1e-32
YPL060C-A Chr16 complement(439428..442742) [3315 bp, 1104 aa] {O...   134   5e-31
Kwal_34.16304 s34 (280776..281711) [936 bp, 311 aa] {ON} YOL103W...   124   3e-30
Kwal_47.19344 s47 (1199885..1200262) [378 bp, 125 aa] {ON} YAR00...   112   3e-28
Suva_10.196 Chr10 (373428..373835) [408 bp, 135 aa] {ON} YNL054W...   112   4e-28
Kwal_13.687 s13 complement(1533..1835) [303 bp, 100 aa] {ON} YAR...   109   2e-27
KNAG0G00960 Chr7 complement(191524..192205,192207..194551) [3027...   122   3e-27
Kwal_33.14867 s33 (850184..852346) [2163 bp, 720 aa] {ON} YLR035...   121   3e-27
KNAG0L00780 Chr12 complement(133367..138013) [4647 bp, 1548 aa] ...   121   7e-27
Kpol_377.1 s377 (245..1684) [1440 bp, 479 aa] {ON} (245..1684) [...   115   3e-26
TBLA0B08350 Chr2 (1999702..2001012) [1311 bp, 436 aa] {ON}            114   5e-26
Skud_7.460 Chr7 (755906..756418) [513 bp, 170 aa] {ON}  YNL054W-...   107   5e-26
TBLA0E02365 Chr5 (590561..591022) [462 bp, 153 aa] {ON}               105   2e-25
Kwal_47.17294 s47 complement(332940..333179) [240 bp, 79 aa] {ON...   100   2e-24
TPHA0O01180 Chr15 (229525..230487) [963 bp, 320 aa] {ON}              104   2e-23
TDEL0H00120 Chr8 complement(3213..3533) [321 bp, 106 aa] {ON}          97   3e-23
TPHA0G00155 Chr7 (9997..10368) [372 bp, 123 aa] {ON}                   97   5e-23
TBLA0C00570 Chr3 (103399..104835) [1437 bp, 478 aa] {ON}              105   7e-23
Kpol_381.2 s381 (6975..8186) [1212 bp, 403 aa] {ON} (6975..8186)...   103   2e-22
KNAG0M01670 Chr13 complement(303081..303899) [819 bp, 272 aa] {O...   100   2e-22
Kwal_39.16392 s39 (2047..2574) [528 bp, 175 aa] {ON} YOR343C-B -...    97   2e-22
Smik_13.226 Chr13 (361115..361414) [300 bp, 100 aa] {ON} YNL054W...    93   7e-22
Kwal_2.432 s2 (4434..4706) [273 bp, 90 aa] {ON} YDR098C-B - TyB ...    93   8e-22
TBLA0F03530 Chr6 (867978..870614) [2637 bp, 878 aa] {ON}              103   1e-21
Kwal_33.15086 s33 complement(955326..955595) [270 bp, 89 aa] {ON...    92   2e-21
TPHA0I00530 Chr9 (104925..106061) [1137 bp, 378 aa] {ON}              100   2e-21
Smik_118.1 Chr118 complement(1..543) [543 bp, 181 aa] {ON} YPL06...    94   6e-21
Kwal_23.3713 s23 (400838..401074) [237 bp, 78 aa] {ON} YLR035C-A...    89   8e-21
Kwal_39.16423 s39 (13455..13676) [222 bp, 74 aa] {ON} YDR261W-B ...    89   1e-20
TBLA0A10570 Chr1 (2614203..2615624) [1422 bp, 473 aa] {ON}             99   1e-20
Smik_13.224 Chr13 (360633..360995) [363 bp, 120 aa] {ON}  YNL054...    90   2e-20
TPHA0B03180 Chr2 complement(728704..731073) [2370 bp, 789 aa] {O...   100   2e-20
KNAG0M01680 Chr13 (304150..304884) [735 bp, 244 aa] {ON}               93   3e-20
TBLA0A00240 Chr1 complement(34706..35521) [816 bp, 271 aa] {ON}        92   1e-19
TDEL0H00100 Chr8 (1355..1744) [390 bp, 129 aa] {ON}                    88   1e-19
Kwal_2.426 s2 (3117..4001) [885 bp, 294 aa] {ON} YLR035C-A - Ty ...    92   3e-19
Kwal_14.771 s14 (34780..35118) [339 bp, 112 aa] {ON} YBL101W-B -...    86   5e-19
NDAI0G00540 Chr7 (116135..116962) [828 bp, 275 aa] {ON}                90   6e-19
Kwal_34.16307 s34 (281659..281892) [234 bp, 77 aa] {ON} YAR009C ...    84   7e-19
Skud_12.513 Chr12 complement(912157..912666) [510 bp, 170 aa] {O...    85   4e-18
Smik_12.565 Chr12 complement(995800..996096,996100..996126) [324...    83   4e-18
Kpol_1026.3 s1026 complement(6141..6605) [465 bp, 154 aa] {ON} c...    83   1e-17
Kpol_489.22 s489 (62613..62927,62930..63304) [690 bp, 229 aa] {O...    85   1e-17
Skud_2.338 Chr2 complement(611182..611319,611323..611421,611425....    81   4e-17
Kwal_34.16311 s34 (283168..283434) [267 bp, 88 aa] {ON} YER160C ...    79   8e-17
Skud_57.1 Chr57 (3..341) [339 bp, 112 aa] {ON} YNL054W-B (REPEAT)      79   1e-16
TBLA0B08190 Chr2 complement(1954681..1955820) [1140 bp, 379 aa] ...    85   2e-16
Kwal_55.22271 s55 (1177701..1178192) [492 bp, 163 aa] {ON} YOR34...    80   2e-16
Skud_57.3 Chr57 (686..1111) [426 bp, 142 aa] {ON} YNL054W-B (REP...    79   3e-16
NDAI0D01220 Chr4 complement(291053..291919) [867 bp, 288 aa] {ON}      81   1e-15
TBLA0F01880 Chr6 (471887..472561) [675 bp, 224 aa] {ON}                79   1e-15
Smik_12.567 Chr12 complement(996596..997171) [576 bp, 191 aa] {O...    78   1e-15
Kwal_47.17669 s47 complement(507896..508297) [402 bp, 133 aa] {O...    76   2e-15
KAFR0B06625 Chr2 (1380125..1381207,1381209..1381694) [1569 bp, 5...    82   3e-15
Suva_10.194 Chr10 (372743..373060) [318 bp, 106 aa] {ON} YNL054W...    74   6e-15
Smik_3.3 Chr3 (1903..3120) [1218 bp, 405 aa] {ON} YCL074W (REPEAT)     80   7e-15
Kwal_1.410 s1 (2688..3320) [633 bp, 210 aa] {ON} YJL113W - TyB G...    77   7e-15
Kwal_39.16421 s39 (12905..13270) [366 bp, 121 aa] {OFF} [contig ...    74   1e-14
Kwal_26.7403 s26 complement(347312..347884) [573 bp, 191 aa] {ON...    74   3e-14
NDAI0B04850 Chr2 complement(1188719..1188940) [222 bp, 73 aa] {O...    69   8e-14
Smik_124.1 Chr124 complement(1..501) [501 bp, 167 aa] {ON} YNL05...    72   2e-13
TBLA0E03550 Chr5 complement(885508..888024,888026..888394) [2886...    76   3e-13
TBLA0C00120 Chr3 (6741..8573) [1833 bp, 610 aa] {ON}                   74   1e-12
Kpol_202.1 s202 complement(2237..2872) [636 bp, 211 aa] {ON} com...    70   1e-12
TPHA0M02160 Chr13 (448670..450370) [1701 bp, 566 aa] {ON}              74   2e-12
NDAI0D00670 Chr4 (145289..145612) [324 bp, 107 aa] {ON}                66   3e-12
Skud_12.299 Chr12 complement(546128..546313,546317..546328) [198...    64   7e-12
Suva_14.55 Chr14 (94266..96023) [1758 bp, 585 aa] {ON} YNL054W-B...    71   1e-11
Kwal_12.672 s12 complement(39524..39994) [471 bp, 156 aa] {ON} Y...    65   2e-11
KNAG0G00963 Chr7 complement(194859..195845) [987 bp, 328 aa] {ON}      68   3e-11
Kwal_54.19474 s54 (1826..2470) [645 bp, 214 aa] {OFF} [contig 41...    65   5e-11
TBLA0F03190 Chr6 (773382..774350) [969 bp, 322 aa] {ON}                67   5e-11
Kpol_1054.13 s1054 (30961..32157,32161..32685,32813..33538) [244...    69   6e-11
Kwal_12.680 s12 complement(41412..41750) [339 bp, 112 aa] {OFF} ...    62   7e-11
Smik_12.566 Chr12 complement(996127..996498) [372 bp, 123 aa] {O...    62   1e-10
Kwal_34.16309 s34 (282156..283190) [1035 bp, 344 aa] {ON} YJL113...    66   2e-10
KNAG0G02840 Chr7 (628866..630110) [1245 bp, 414 aa] {ON}               66   2e-10
Kwal_50.19421 s50 complement(2481..3014) [534 bp, 177 aa] {ON} [...    62   3e-10
KNAG0C06675 Chr3 complement(1300967..1301815) [849 bp, 282 aa] {...    64   4e-10
TBLA0D02690 Chr4 complement(664761..665291) [531 bp, 176 aa] {ON}      62   6e-10
Kwal_2.422 s2 (1627..1932) [306 bp, 101 aa] {OFF} [contig 305] FULL    59   7e-10
TBLA0A06870 Chr1 complement(1684530..1685090) [561 bp, 186 aa] {...    61   1e-09
Skud_14.332 Chr14 complement(599559..600476) [918 bp, 306 aa] {O...    61   5e-09
Kpol_322.9 s322 (19758..20504) [747 bp, 249 aa] {ON} (19758..205...    60   6e-09
KAFR0A01750 Chr1 complement(360823..362442) [1620 bp, 539 aa] {O...    62   8e-09
Kpol_137.2 s137 (1756..2184) [429 bp, 142 aa] {ON} (1756..2184) ...    57   1e-08
Smik_12.38 Chr12 (78253..78540,78544..78648,78655..78693,78697.....    59   2e-08
Kpol_377.2 s377 (4260..7559) [3300 bp, 1099 aa] {ON} (4260..7559...    61   2e-08
Kpol_267.2 s267 (3000..3956) [957 bp, 318 aa] {ON} (3000..3956) ...    58   5e-08
Kpol_248.1 s248 complement(4851..5807) [957 bp, 318 aa] {ON} com...    58   5e-08
Skud_46.1 Chr46 complement(1..294) [294 bp, 98 aa] {ON} YNL054W-...    54   6e-08
KLTH0B04686g Chr2 (381618..381932) [315 bp, 104 aa] {ON} conserv...    54   7e-08
Skud_14.331 Chr14 complement(599259..599558) [300 bp, 100 aa] {O...    53   1e-07
Kwal_12.679 s12 complement(41150..41341) [192 bp, 63 aa] {OFF} [...    51   1e-07
Kwal_47.19345 s47 (1200237..1200536) [300 bp, 99 aa] {ON} YAR009...    52   1e-07
Kwal_34.15661 s34 complement(1269..1556) [288 bp, 95 aa] {OFF} [...    51   4e-07
Smik_13.225 Chr13 (360997..361116) [120 bp, 40 aa] {ON}  YNL054W...    49   5e-07
KNAG0D03630 Chr4 (664165..664320) [156 bp, 51 aa] {ON}                 47   2e-06
Skud_46.3 Chr46 complement(1654..1752) [99 bp, 32 aa] {ON} YNL05...    47   3e-06
NCAS0B05650 Chr2 complement(1073091..1073969) [879 bp, 292 aa] {...    52   4e-06
Kwal_27.11216 s27 complement(690403..690597) [195 bp, 64 aa] {OF...    47   4e-06
YCL074W Chr3 (2824..3750) [927 bp, 308 aa] {OFF} Pseudogene: enc...    52   5e-06
Kpol_381.1 s381 (3213..6806) [3594 bp, 1197 aa] {ON} (3213..6806...    53   7e-06
Smik_108.1 Chr108 (1..492) [492 bp, 163 aa] {ON} YNL054W-B (REPEAT)    49   8e-06
TBLA0B08195 Chr2 complement(1955768..1956820) [1053 bp, 350 aa] ...    51   1e-05
TBLA0D04530 Chr4 (1122477..1123892) [1416 bp, 471 aa] {ON}             51   1e-05
Kpol_1018.175 s1018 complement(444710..447160) [2451 bp, 816 aa]...    52   1e-05
TBLA0B06380 Chr2 (1507107..1507604) [498 bp, 165 aa] {ON}              47   3e-05
Kpol_1035.1 s1035 complement(2508..3287) [780 bp, 259 aa] {ON} c...    47   1e-04
Kpol_272.2 s272 complement(12525..12788) [264 bp, 87 aa] {ON} co...    44   1e-04
Kwal_36.16337 s36 (3201..3458) [258 bp, 85 aa] {OFF} [contig 364...    44   1e-04
Kpol_1036.29 s1036 complement(71398..71730) [333 bp, 110 aa] {ON...    44   2e-04
Suva_6.192 Chr6 (348905..350707) [1803 bp, 600 aa] {ON} YPL060C-...    48   2e-04
Kwal_34.16308 s34 (281969..282232) [264 bp, 87 aa] {OFF} [contig...    43   2e-04
Kwal_14.769 s14 (34464..34850) [387 bp, 128 aa] {OFF} [contig 24...    44   4e-04
Kpol_1061.17 s1061 (43191..43412,43416..43739,43743..44006,44010...    46   4e-04
Kwal_26.7895 s26 complement(558601..558861) [261 bp, 86 aa] {OFF...    41   0.002
Kpol_455.14 s455 complement(36863..37699) [837 bp, 278 aa] {ON} ...    43   0.003
Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {O...    44   0.003
NCAS0G02330 Chr7 complement(413199..415172) [1974 bp, 657 aa] {O...    43   0.005
Kwal_55.19798 s55 complement(132074..132382) [309 bp, 102 aa] {O...    39   0.013
Kpol_1059.43 s1059 complement(99187..99804) [618 bp, 205 aa] {ON...    40   0.016
Kwal_12.675 s12 complement(40166..40564) [399 bp, 132 aa] {ON} Y...    39   0.016
KNAG0J01130 Chr10 complement(201867..202607) [741 bp, 246 aa] {O...    40   0.018
Smik_12.315 Chr12 (572410..572748) [339 bp, 112 aa] {ON} YNL054W...    38   0.018
Suva_6.194 Chr6 (350869..351309) [441 bp, 146 aa] {ON} YPL060C-A...    39   0.031
Kwal_26.7889 s26 complement(556831..557676) [846 bp, 281 aa] {ON...    40   0.032
Kwal_9.619 s9 (2289..2810) [522 bp, 173 aa] {ON} YAR009C - TyB G...    39   0.041
Suva_10.197 Chr10 (373838..373933) [96 bp, 32 aa] {ON}  YNL054W-...    35   0.047
Smik_3.59 Chr3 complement(87134..87220,87224..87259,87263..87286...    38   0.050
Kwal_14.767 s14 (33880..34431) [552 bp, 183 aa] {ON} YAR009C - T...    38   0.056
Kwal_1.406 s1 (1719..2021) [303 bp, 100 aa] {OFF} [contig 695] FULL    36   0.11 
CAGL0G07183g2 Chr7 complement(678730..682425,682425..683243) [45...    39   0.13 
Skud_110.1 Chr110 (3..560) [558 bp, 186 aa] {ON} YPL060C-A (REPEAT)    37   0.14 
NDAI0F01730 Chr6 (424126..424542) [417 bp, 138 aa] {ON}                36   0.15 
Kwal_33.15092 s33 complement(958321..958851) [531 bp, 176 aa] {O...    37   0.16 
TBLA0I02850 Chr9 complement(672290..674410) [2121 bp, 706 aa] {O...    37   0.33 
NCAS0A05290 Chr1 complement(1047369..1050149) [2781 bp, 926 aa] ...    37   0.45 
NCAS0H03510 Chr8 (662442..666104) [3663 bp, 1220 aa] {ON}              37   0.51 
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...    35   1.9  
Kwal_23.3711 s23 (400253..400588) [336 bp, 111 aa] {OFF} [contig...    32   2.1  
Skud_63.2 Chr63 complement(665..994) [330 bp, 109 aa] {ON} YPL06...    31   5.4  
NCAS0H02470 Chr8 complement(489960..490880) [921 bp, 306 aa] {ON...    33   5.6  
Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON} (14919....    33   6.1  

>Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON}
            (80237..84124) [3888 nt, 1296 aa]
          Length = 1295

 Score = 2462 bits (6381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1205/1295 (93%), Positives = 1205/1295 (93%)

Query: 1    MLMTIPLGSPNHVDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIP 60
            MLMTIPLGSPNHVDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIP
Sbjct: 1    MLMTIPLGSPNHVDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIP 60

Query: 61   ISSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIA 120
            ISSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIA
Sbjct: 61   ISSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIA 120

Query: 121  TLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLI 180
            TLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLI
Sbjct: 121  TLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLI 180

Query: 181  KNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNM 240
            KNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNM
Sbjct: 181  KNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNM 240

Query: 241  PTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGS 300
            PTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGS
Sbjct: 241  PTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGS 300

Query: 301  EFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYS 360
            EFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYS
Sbjct: 301  EFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYS 360

Query: 361  VEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGY 420
            VEFATLIRNALLNTTYKT              TILPFGQHVITHDTNPIDKLHVRGHHGY
Sbjct: 361  VEFATLIRNALLNTTYKTSARARAGLAGLDASTILPFGQHVITHDTNPIDKLHVRGHHGY 420

Query: 421  ALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDD 480
            ALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDD
Sbjct: 421  ALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDD 480

Query: 481  FLNDTSAPALIDDNSSEPDNSTSAPNXXXXXXXXXXXXTAMIHSRPESIDTQGTNSDVSP 540
            FLNDTSAPALIDDNSSEPDNSTSAPN            TAMIHSRPESIDTQGTNSDVSP
Sbjct: 481  FLNDTSAPALIDDNSSEPDNSTSAPNSDSELSDDPDLDTAMIHSRPESIDTQGTNSDVSP 540

Query: 541  TSNPVTTIPLXXXXXXXXXXXXXXXXXXPLSFYHSDFNKPISSSTFDEELPPDVIPISDD 600
            TSNPVTTIPL                  PLSFYHSDFNKPISSSTFDEELPPDVIPISDD
Sbjct: 541  TSNPVTTIPLTSDIYTDPDSDTDDDSDSPLSFYHSDFNKPISSSTFDEELPPDVIPISDD 600

Query: 601  NTTPSVLEDDVLPEIXXXXXXXXXXXXQLIDSSPKNSDSGGIIADTTISLDTSPDISHSL 660
            NTTPSVLEDDVLPEI            QLIDSSPKNSDSGGIIADTTISLDTSPDISHSL
Sbjct: 601  NTTPSVLEDDVLPEIPSLSDSPPALPDQLIDSSPKNSDSGGIIADTTISLDTSPDISHSL 660

Query: 661  AISPSGGTIDDXXXXXXXXXXXXXXXXXXXXGGITQTSVSTDLGGIGKEQDSSXXXXXXX 720
            AISPSGGTIDD                    GGITQTSVSTDLGGIGKEQDSS       
Sbjct: 661  AISPSGGTIDDLNTSSTNPLSLSLSPQNSNSGGITQTSVSTDLGGIGKEQDSSKKRNREN 720

Query: 721  XXXXXXXHLPYWEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSN 780
                   HLPYWEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSN
Sbjct: 721  DENNDKDHLPYWEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSN 780

Query: 781  QNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCR 840
            QNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCR
Sbjct: 781  QNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCR 840

Query: 841  FVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELY 900
            FVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELY
Sbjct: 841  FVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELY 900

Query: 901  IRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLI 960
            IRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLI
Sbjct: 901  IRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLI 960

Query: 961  VCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSK 1020
            VCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSK
Sbjct: 961  VCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSK 1020

Query: 1021 SLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKL 1080
            SLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKL
Sbjct: 1021 SLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKL 1080

Query: 1081 VGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKER 1140
            VGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKER
Sbjct: 1081 VGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKER 1140

Query: 1141 NTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVI 1200
            NTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVI
Sbjct: 1141 NTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVI 1200

Query: 1201 PLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYS 1260
            PLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYS
Sbjct: 1201 PLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYS 1260

Query: 1261 HLKLEYVNTDNNIADILTKALPAKRFNDLTNVWMV 1295
            HLKLEYVNTDNNIADILTKALPAKRFNDLTNVWMV
Sbjct: 1261 HLKLEYVNTDNNIADILTKALPAKRFNDLTNVWMV 1295

>Kpol_1066.33 s1066 complement(54660..55907) [1248 bp, 415 aa] {ON}
           complement(54660..55907) [1248 nt, 416 aa]
          Length = 415

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/409 (71%), Positives = 327/409 (79%)

Query: 569 PLSFYHSDFNKPISSSTFDEELPPDVIPISDDNTTPSVLEDDVLPEIXXXXXXXXXXXXQ 628
           PLSFY+SDFNKPISSSTFDEELPPDVIPISDD++TPSV+EDDV PEI            +
Sbjct: 7   PLSFYYSDFNKPISSSTFDEELPPDVIPISDDSSTPSVIEDDVPPEIPSLSSSTPALPDE 66

Query: 629 LIDSSPKNSDSGGIIADTTISLDTSPDISHSLAISPSGGTIDDXXXXXXXXXXXXXXXXX 688
           LI+SSP+NS SGGII DTTIS DTSP IS SL  SPSGGTI D                 
Sbjct: 67  LINSSPENSHSGGIIDDTTISSDTSPAISPSLENSPSGGTIADLNTSSANPVSPSLLAQN 126

Query: 689 XXXGGITQTSVSTDLGGIGKEQDSSXXXXXXXXXXXXXXHLPYWEKNNMSSIKFPPKQRR 748
              GGITQ SVSTDLGGIGKEQDSS                PYW KN++SSI FPP+Q+R
Sbjct: 127 SNSGGITQPSVSTDLGGIGKEQDSSKKRIREINENNDMKKQPYWRKNDLSSINFPPRQKR 186

Query: 749 RIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDN 808
           RIH INSVKHA+NNPPSVGN S+SYR+AI+ NQN  +K+ Y+KAYMKE++QLMKH TWDN
Sbjct: 187 RIHLINSVKHAINNPPSVGNNSLSYREAITLNQNPIDKDSYKKAYMKEVNQLMKHETWDN 246

Query: 809 SRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALM 868
             +YD++EVNPK +INSM IF TKRDGTHKCRFVA+GDQQ  GTY DSL ANTIHHEALM
Sbjct: 247 HNLYDIQEVNPKTVINSMFIFITKRDGTHKCRFVAQGDQQKPGTYYDSLAANTIHHEALM 306

Query: 869 TCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGA 928
           TCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNK+FKL+KSLYGLKQSGA
Sbjct: 307 TCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKVFKLQKSLYGLKQSGA 366

Query: 929 NWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVFGKKHKK 977
           NWYENIK Y+TE CGMS+IRGW CAFK +DL+VCLFVD+II+FGK H +
Sbjct: 367 NWYENIKNYITETCGMSSIRGWSCAFKKDDLMVCLFVDNIIMFGKDHNE 415

>Smik_40.1 Chr40 (1..2793) [2793 bp, 930 aa] {ON} YNL054W-B (REPEAT)
          Length = 930

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/564 (52%), Positives = 407/564 (72%), Gaps = 6/564 (1%)

Query: 732  WEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRK 791
            W   NM S++ PP+ ++RI  I +VK   +  P     ++ Y +AI+ N+N+ EKE Y +
Sbjct: 371  WNTKNMRSLE-PPRSKKRILLIAAVKTVKSIKPI--RATLRYDEAITYNKNIIEKEKYIE 427

Query: 792  AYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAG 851
            AY KE++QL+K NTWD  R YD ++++PK++INSM IF  KRDGTHK RFVARGD Q+  
Sbjct: 428  AYQKEINQLLKMNTWDTDRYYDREDIDPKRVINSMFIFNKKRDGTHKARFVARGDVQHPD 487

Query: 852  TYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKN 911
            TYD  + +NT+HH ALMT +++ALDND FI QLDISSAYLYAD+KEELYIR PPHL   N
Sbjct: 488  TYDSGMQSNTVHHYALMTSLSLALDNDYFITQLDISSAYLYADIKEELYIRPPPHLRMNN 547

Query: 912  KIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVF 971
            K+ +L KSLYGLKQSGANWYE IK YL + C M  +RGW C FKN  L +CLFVDD+I+F
Sbjct: 548  KLIRLRKSLYGLKQSGANWYETIKSYLIQQCDMKEVRGWSCVFKNSQLTICLFVDDMILF 607

Query: 972  GKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLE 1031
             K       +++ LK +Y+TK++N G  E  +   YDILGLEI Y+R K +  GME SL 
Sbjct: 608  SKDLNANKKVIEKLKRQYDTKIINLG--EDNDEIQYDILGLEIKYKRGKYMKLGMENSLT 665

Query: 1032 QKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKY 1091
            +K+P + V LN + +++ APGQPG+ +   +L++ E +YK KV  MQKL+GLASY+GYK+
Sbjct: 666  EKLPKINVPLNPKGKKLAAPGQPGLYIDQEELELEEDDYKMKVHEMQKLIGLASYVGYKF 725

Query: 1092 RYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKE-RNTQRVTAITD 1150
            R+DLLYYIN LAQH L+PS QVL +TY+LIQ+IWDTR+++LIW K+K  +    +  I+D
Sbjct: 726  RFDLLYYINTLAQHILFPSKQVLDMTYELIQFIWDTRDRQLIWHKSKSTKPANNLVVISD 785

Query: 1151 AAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLM 1210
            A++ NQP YKSQ+G   L+N K+I  +STKA+LTC S+TE+E++AIS  +PLLN++  L+
Sbjct: 786  ASYGNQPYYKSQIGNVFLLNGKVIGGKSTKASLTCTSTTEAEIHAISESVPLLNNLSYLV 845

Query: 1211 ETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTD 1270
            + +    +   L+TDS   ISI+ S++E K RN++FG ++M++RDEV  ++L + Y+ T 
Sbjct: 846  QELNKKPITKGLLTDSKSTISIVMSKNEEKFRNRFFGTKAMRLRDEVSGNNLHVCYIETK 905

Query: 1271 NNIADILTKALPAKRFNDLTNVWM 1294
             NIAD+LTK LP K F  LTN W+
Sbjct: 906  KNIADVLTKPLPIKTFKLLTNKWI 929

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%)

Query: 393 TILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRS 452
           T+LPFGQ VI ++ NP  K+H RG  GYAL PS+ S+GY+IY+P L K +DT+NYV+++ 
Sbjct: 7   TLLPFGQPVIVNNHNPDSKIHPRGITGYALHPSRNSYGYIIYLPSLKKTVDTTNYVILQG 66

Query: 453 DTNISADHNYDSTVFDPLMQSIARPYDDFL 482
             +     NYD+  FD  +  +   Y  F+
Sbjct: 67  KESRLDQFNYDALTFDDDLNRLTASYQSFI 96

>YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 aa]
            {OFF} TyB Gag-Pol protein; proteolytically processed to
            make the Gag, RT, PR, and IN proteins that are required
            for retrotransposition
          Length = 1749

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/564 (53%), Positives = 411/564 (72%), Gaps = 6/564 (1%)

Query: 732  WEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRK 791
            W   NM S++ PP+ ++RIH I +VK   +  P    T++ Y +AI+ N++++EKE Y +
Sbjct: 1190 WNTKNMRSLE-PPRSKKRIHLIAAVKAVKSIKPI--RTTLRYDEAITYNKDIKEKEKYIE 1246

Query: 792  AYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAG 851
            AY KE++QL+K  TWD  + YD KE++PK++INSM IF  KRDGTHK RFVARGD Q+  
Sbjct: 1247 AYHKEVNQLLKMKTWDTDKYYDRKEIDPKRVINSMFIFNRKRDGTHKARFVARGDIQHPD 1306

Query: 852  TYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKN 911
            TYD  + +NT+HH ALMT +++ALDN+ +I QLDISSAYLYAD+KEELYIR PPHLG  +
Sbjct: 1307 TYDSGMQSNTVHHYALMTSLSLALDNNYYITQLDISSAYLYADIKEELYIRPPPHLGMND 1366

Query: 912  KIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVF 971
            K+ +L+KSLYGLKQSGANWYE IK YL E C M  +RGW C FKN  + +CLFVDD+I+F
Sbjct: 1367 KLIRLKKSLYGLKQSGANWYETIKSYLIEQCDMEEVRGWSCVFKNSQVTICLFVDDMILF 1426

Query: 972  GKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLE 1031
             K       ++  LK +Y+TK++N G  E      YDILGLEI Y+RSK +  GMEKSL 
Sbjct: 1427 SKDLNANKKIITTLKKQYDTKIINLG--ESDNEIQYDILGLEIKYQRSKYMKLGMEKSLT 1484

Query: 1032 QKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKY 1091
            +K+P L V LN + +++ APGQPG+ +   +L++ E EYK KV  MQKL+GLASY+GYK+
Sbjct: 1485 EKLPKLNVHLNPKGKKLSAPGQPGLYIDQDELEIDEDEYKEKVHEMQKLIGLASYVGYKF 1544

Query: 1092 RYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAK-ERNTQRVTAITD 1150
            R+DLLYYIN LAQH L+PS QVL +TY+LIQ++WDTR+K+LIW K K  +   ++ AI+D
Sbjct: 1545 RFDLLYYINTLAQHILFPSRQVLDMTYELIQFMWDTRDKQLIWHKNKPTKPDNKLVAISD 1604

Query: 1151 AAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLM 1210
            A++ NQP YKSQ+G   L+N K+I  +STKA+LTC S+TE+E++A+S  IPLLN++  L+
Sbjct: 1605 ASYGNQPYYKSQIGNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAIPLLNNLSHLV 1664

Query: 1211 ETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTD 1270
            + +    +   L+TDS   ISII S +E K RN++FG ++M++RDEV  ++L + Y+ T 
Sbjct: 1665 QELNKKPIIKGLLTDSRSTISIIKSTNEEKFRNRFFGTKAMRLRDEVSGNNLYVYYIETK 1724

Query: 1271 NNIADILTKALPAKRFNDLTNVWM 1294
             NIAD++TK LP K F  LTN W+
Sbjct: 1725 KNIADVMTKPLPIKTFKLLTNKWI 1748

 Score =  459 bits (1180), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 225/477 (47%), Positives = 302/477 (63%), Gaps = 8/477 (1%)

Query: 11  NHVDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFH 70
           NH DDE  LPG+LLLDSGAS ++IR +  +H       I V DAQ   IPI++ G L+FH
Sbjct: 448 NHSDDE--LPGHLLLDSGASRTLIRSAHHIHSASSNPDINVVDAQKRNIPINAIGDLQFH 505

Query: 71  FANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYW 130
           F +     I    +PNI YDL+SL+EL    I A F+   L   D  V+A ++K+G FYW
Sbjct: 506 FQDNTKTSIKVLHTPNIAYDLLSLNELAAVDITACFTKNVLERSDGTVLAPIVKYGDFYW 565

Query: 131 LSTKYLMLPARSRNHRINNI-----LPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISY 185
           +S KYL LP+      INN+       ++ + FIHR+  H N + I+ S++   I   + 
Sbjct: 566 VSKKYL-LPSNISVPTINNVHTSESTRKYPYPFIHRMLAHANAQTIRYSLKNNTITYFNE 624

Query: 186 DNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSP 245
            ++DWS    +QCPDCL GKST+H+H  GSR+KYQ  Y  F++LHTD+FGPV N+P S+P
Sbjct: 625 SDVDWSSAIDYQCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAP 684

Query: 246 TYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNA 305
           +YFISFTDE ++FRWV+PL  +   ++  VF  I+A    QF   VLV QMDRGSE+TN 
Sbjct: 685 SYFISFTDETTKFRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNR 744

Query: 306 EIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFAT 365
            +  F  +NGI PCYT+  DSRAHGVAERLNRTLLDDCRT L+ SGL  HLWF ++EF+T
Sbjct: 745 TLHKFLEKNGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFST 804

Query: 366 LIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPS 425
           ++RN+L +   K               T+LPFGQ VI +D NP  K+H RG  GYAL PS
Sbjct: 805 IVRNSLASPKSKKSARQHAGLAGLDISTLLPFGQPVIVNDHNPNSKIHPRGIPGYALHPS 864

Query: 426 KESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDDFL 482
           + S+GY+IY+P L K +DT+NYV+++   +     NYD+  FD  +  +   Y  F+
Sbjct: 865 RNSYGYIIYLPSLKKTVDTTNYVILQGKESRLDQFNYDALTFDEDLNRLTASYQSFI 921

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
            aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/564 (53%), Positives = 411/564 (72%), Gaps = 6/564 (1%)

Query: 732  WEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRK 791
            W   +M S++ PP+ ++RIH I +VK A +  P    T++ Y +AI+ N+N+ EKE Y +
Sbjct: 1196 WNTKSMRSLE-PPRSKKRIHLIAAVKAAKSIKPI--RTTLRYDEAITYNKNIEEKEKYIQ 1252

Query: 792  AYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAG 851
            AY KE++QL+K NTWD  R YD  E++ KK+I+SM IF  KRDGTHK RFVARGD Q+  
Sbjct: 1253 AYHKEVNQLLKMNTWDTDRYYDKNEIDTKKVISSMFIFNKKRDGTHKARFVARGDIQHPD 1312

Query: 852  TYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKN 911
            TYD  + +NT+HH ALMT +++ALDND ++ QLDISSAYLYAD+KEELYIR PPHLG  N
Sbjct: 1313 TYDSEMQSNTVHHYALMTSLSLALDNDHYVTQLDISSAYLYADIKEELYIRPPPHLGMNN 1372

Query: 912  KIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVF 971
            K+ +L KSLYGLKQSGANWYE IK YL + CGM  +RGW C FKN  + +CLFVDD+I+F
Sbjct: 1373 KLIRLRKSLYGLKQSGANWYETIKSYLVDKCGMEEVRGWSCVFKNSQVTICLFVDDMILF 1432

Query: 972  GKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLE 1031
             K       +++ LK +Y+TK++N G  +  +   YDILGLEI Y+R K +  GME SL 
Sbjct: 1433 SKDLNSNKRIIEKLKRQYDTKIINLG--DSDDEIQYDILGLEIKYQRGKYMKLGMENSLT 1490

Query: 1032 QKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKY 1091
            +K+P+L V LN + R++ APGQPG+ +   +L++ E +YK KV  MQKL+GLASY+GYK+
Sbjct: 1491 EKLPNLNVPLNPKGRKLAAPGQPGLYIDQEELELEEDDYKMKVHEMQKLIGLASYVGYKF 1550

Query: 1092 RYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQ-RVTAITD 1150
            R+DLLYYIN LAQH L+PS QVL +TY+LIQ+IWDTR+++LIW K +    + ++  I+D
Sbjct: 1551 RFDLLYYINTLAQHILFPSKQVLDMTYELIQFIWDTRDRQLIWYKNRSSKPENKLVVISD 1610

Query: 1151 AAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLM 1210
            A++ NQP YKSQ+G   L+N K+I  +STKA+LTC S+TE+E++A+S  +PLLN++  L+
Sbjct: 1611 ASYGNQPYYKSQIGNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAVPLLNNLSYLV 1670

Query: 1211 ETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTD 1270
            + +    +   L+TDS   ISI+ S++E K RN++FG ++M++RDEV  ++L L Y+ T 
Sbjct: 1671 QELDKKPIIKCLLTDSRSTISIVTSKNEEKFRNRFFGTKAMRLRDEVSDNNLYLCYIETK 1730

Query: 1271 NNIADILTKALPAKRFNDLTNVWM 1294
             NIADILTK LP K F  LTN W+
Sbjct: 1731 KNIADILTKPLPIKTFKLLTNKWI 1754

 Score =  447 bits (1151), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/479 (45%), Positives = 304/479 (63%), Gaps = 7/479 (1%)

Query: 11  NHVDDEFD-LPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKF 69
           NH D   D LPG+LL+DSGAS ++IR +  +H     I I   DAQ   IPI++ G L+F
Sbjct: 445 NHTDHSNDELPGHLLIDSGASQTLIRSAHHIHSASPNIDISAIDAQKKEIPINAIGNLQF 504

Query: 70  HFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFY 129
            F +     I+   +PNI +DL+SL EL    I A F+  +L   D  V+A +++HG FY
Sbjct: 505 QFDDNTKTSITVLHTPNIAHDLLSLSELAKQNITACFTKNTLERSDGTVLAHIVRHGDFY 564

Query: 130 WLSTKYLMLPARSRNHRINNILP-----RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNIS 184
           WLS KYL +P+      +NNI       ++ +  IHR+ GH N + I++S++   I  + 
Sbjct: 565 WLSKKYL-IPSNLSVPTVNNIGTDKGSHKYPYPLIHRMLGHANAQTIRNSLKNNSITYLK 623

Query: 185 YDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSS 244
             ++DWS   T+QCPDCL GKST+H+H  GSRVKYQ  Y  F++LHTD+FGPV N+P S+
Sbjct: 624 ESDVDWSKATTYQCPDCLIGKSTKHRHVKGSRVKYQNSYEPFQYLHTDIFGPVHNLPKSA 683

Query: 245 PTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTN 304
           P+YFI+FTDE++RF+WV+PL  +   ++  VF  I+A    QF   VLV QMDRGSE+TN
Sbjct: 684 PSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIERQFKASVLVIQMDRGSEYTN 743

Query: 305 AEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFA 364
             +  F  + GI  CYT+  DSRAHGVAERLNRTLLDDCRT L+ SGL  HLWF +VEF+
Sbjct: 744 KTLHKFLLKKGITACYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAVEFS 803

Query: 365 TLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTP 424
           T++RN+L++   +               T+LPFGQ V+ ++ NP  K+H RG  GYAL P
Sbjct: 804 TIVRNSLVSPKNEKSARQHAGLAGLDISTLLPFGQPVVVNNHNPDSKIHPRGIPGYALHP 863

Query: 425 SKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDDFLN 483
           S+ S+GY+IY+P L K +DT+NYV+++   +     NYD+  FD  +  +   Y  F++
Sbjct: 864 SRNSYGYIIYLPSLKKTVDTTNYVILQDKQSRLDQFNYDALTFDEDISRLTASYKSFID 922

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
            [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/564 (52%), Positives = 411/564 (72%), Gaps = 6/564 (1%)

Query: 732  WEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRK 791
            W   +M S++ PP+ ++RIH I +VK A +    +  T++ Y +AI+ N+N+ EKE Y +
Sbjct: 1196 WNTKSMRSLE-PPRSKKRIHLIAAVKAAKS--IKLIRTTLRYDEAITYNKNIEEKEKYIQ 1252

Query: 792  AYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAG 851
            AY KE++QL+K NTWD  R YD  E++ KK+I+SM IF  KRDGTHK RFVARGD Q+  
Sbjct: 1253 AYHKEVNQLLKMNTWDTDRYYDKNEIDTKKVISSMFIFNKKRDGTHKARFVARGDIQHPD 1312

Query: 852  TYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKN 911
            TYD  + +NT+HH ALMT +++ALDND ++ QLDISSAYLYAD+KEELYIR PPHLG  N
Sbjct: 1313 TYDSEMQSNTVHHYALMTSLSLALDNDHYVTQLDISSAYLYADIKEELYIRPPPHLGMNN 1372

Query: 912  KIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVF 971
            K+ +L KSLYGLKQSGANWYE IK YL + CGM  +RGW C FKN  + +CLFVDD+I+F
Sbjct: 1373 KLIRLRKSLYGLKQSGANWYETIKSYLVDKCGMEEVRGWSCVFKNSQVTICLFVDDMILF 1432

Query: 972  GKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLE 1031
             K       +++ LK +Y+TK++N G  +  +   YDILGLEI Y+R K +  GME SL 
Sbjct: 1433 SKDLNSNKRIIEKLKRQYDTKIINLG--DSDDEIQYDILGLEIKYQRGKYMKLGMENSLT 1490

Query: 1032 QKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKY 1091
            +K+P+L V LN + R++ APGQPG+ +   +L++ E +YK KV  MQKL+GLASY+GYK+
Sbjct: 1491 EKLPNLNVPLNPKGRKLAAPGQPGLYIDQEELELEEDDYKMKVHEMQKLIGLASYVGYKF 1550

Query: 1092 RYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQ-RVTAITD 1150
            R+DLLYYIN LAQH L+PS QVL +TY+LIQ+IWDTR+++LIW K +    + ++  I+D
Sbjct: 1551 RFDLLYYINTLAQHILFPSKQVLDMTYELIQFIWDTRDRQLIWYKNRSSKPENKLVVISD 1610

Query: 1151 AAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLM 1210
            A++ NQP YKSQ+G   L+N K+I  +STKA+LTC S+TE+E++A+S  +PLLN++  L+
Sbjct: 1611 ASYGNQPYYKSQIGNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAVPLLNNLSYLV 1670

Query: 1211 ETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTD 1270
            + +    +   L+TDS   ISI+ S++E K RN++FG ++M++RDEV  ++L L Y+ T 
Sbjct: 1671 QELDKKPIIKCLLTDSRSTISIVTSKNEEKFRNRFFGTKAMRLRDEVSDNNLYLCYIETK 1730

Query: 1271 NNIADILTKALPAKRFNDLTNVWM 1294
             NIADILTK LP K F  LTN W+
Sbjct: 1731 KNIADILTKPLPIKTFKLLTNKWI 1754

 Score =  447 bits (1151), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/479 (45%), Positives = 304/479 (63%), Gaps = 7/479 (1%)

Query: 11  NHVDDEFD-LPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKF 69
           NH D   D LPG+LL+DSGAS ++IR +  +H     I I   DAQ   IPI++ G L+F
Sbjct: 445 NHTDHSNDELPGHLLIDSGASQTLIRSAHHIHSASPNIDISAIDAQKKEIPINAIGNLQF 504

Query: 70  HFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFY 129
            F +     I+   +PNI +DL+SL EL    I A F+  +L   D  V+A +++HG FY
Sbjct: 505 QFDDNTKTSITVLHTPNIAHDLLSLSELAKQNITACFTKNTLERSDGTVLAHIVRHGDFY 564

Query: 130 WLSTKYLMLPARSRNHRINNILP-----RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNIS 184
           WLS KYL +P+      +NNI       ++ +  IHR+ GH N + I++S++   I  + 
Sbjct: 565 WLSKKYL-IPSNLSVPTVNNIGTDKGSHKYPYPLIHRMLGHANAQTIRNSLKNNSITYLK 623

Query: 185 YDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSS 244
             ++DWS   T+QCPDCL GKST+H+H  GSRVKYQ  Y  F++LHTD+FGPV N+P S+
Sbjct: 624 ESDVDWSKATTYQCPDCLIGKSTKHRHVKGSRVKYQNSYEPFQYLHTDIFGPVHNLPKSA 683

Query: 245 PTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTN 304
           P+YFI+FTDE++RF+WV+PL  +   ++  VF  I+A    QF   VLV QMDRGSE+TN
Sbjct: 684 PSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIERQFKASVLVIQMDRGSEYTN 743

Query: 305 AEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFA 364
             +  F  + GI  CYT+  DSRAHGVAERLNRTLLDDCRT L+ SGL  HLWF +VEF+
Sbjct: 744 KTLHKFLLKKGITACYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAVEFS 803

Query: 365 TLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTP 424
           T++RN+L++   +               T+LPFGQ V+ ++ NP  K+H RG  GYAL P
Sbjct: 804 TIVRNSLVSPKNEKSARQHAGLAGLDISTLLPFGQPVVVNNHNPDSKIHPRGIPGYALHP 863

Query: 425 SKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDDFLN 483
           S+ S+GY+IY+P L K +DT+NYV+++   +     NYD+  FD  +  +   Y  F++
Sbjct: 864 SRNSYGYIIYLPSLKKTVDTTNYVILQDKQSRLDQFNYDALTFDEDISRLTASYKSFID 922

>SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 1755 aa]
            {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/564 (52%), Positives = 410/564 (72%), Gaps = 6/564 (1%)

Query: 732  WEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRK 791
            W   +M S++ PP+ ++RIH I +VK A +  P    T++ Y +AI+ N+N+ EKE Y +
Sbjct: 1196 WNTKSMRSLE-PPRSKKRIHLIAAVKAAKSIKPI--RTTLRYDEAITYNKNIEEKEKYIQ 1252

Query: 792  AYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAG 851
            AY KE++QL+K NTWD  R YD  E++ KK+INSM IF  KRDGTHK RFVARGD Q+  
Sbjct: 1253 AYHKEVNQLLKMNTWDTDRYYDKNEIDTKKVINSMFIFNKKRDGTHKARFVARGDIQHPD 1312

Query: 852  TYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKN 911
            TYD  + +NT+HH ALMT +++ALDND ++ QLDISSAYLYAD+KEELYIR PPHLG  N
Sbjct: 1313 TYDSEMQSNTVHHYALMTSLSLALDNDHYVTQLDISSAYLYADIKEELYIRPPPHLGMNN 1372

Query: 912  KIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVF 971
            K+ +L KSLYGLKQSGANWYE IK YL + CGM  +RGW C FKN  + +CLFVDD+I+F
Sbjct: 1373 KLIRLRKSLYGLKQSGANWYETIKSYLVDKCGMEEVRGWSCVFKNSQVTICLFVDDMILF 1432

Query: 972  GKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLE 1031
             K       +++ LK +Y+TK++N G  +  +   YDILGLEI Y+R K +  GME SL 
Sbjct: 1433 SKDLNSNKRIIEKLKRQYDTKIINLG--DSDDEIQYDILGLEIKYQRGKYMKLGMENSLT 1490

Query: 1032 QKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKY 1091
            +K+P+L V LN +  ++ APGQPG+ +   +L++ E +YK KV  MQKL+GLASY+GYK+
Sbjct: 1491 EKLPNLNVPLNPKGGKLAAPGQPGLYIDQEELELEEDDYKMKVHEMQKLIGLASYVGYKF 1550

Query: 1092 RYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQ-RVTAITD 1150
            R+DLLYYIN LAQH L+PS QVL +TY+LIQ+IWDTR+++LIW K +    + ++  I+D
Sbjct: 1551 RFDLLYYINTLAQHILFPSKQVLDMTYELIQFIWDTRDRQLIWYKNRSSKPENKLVVISD 1610

Query: 1151 AAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLM 1210
            A++ NQP YKSQ+G   L+N K+I  +STKA+LTC S+TE+E++A+S  +PLLN++  L+
Sbjct: 1611 ASYGNQPYYKSQIGNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAVPLLNNLSYLV 1670

Query: 1211 ETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTD 1270
            + +    +   L+TDS   ISI+ S+++ K RN++FG ++M++RDEV  ++L L Y+ T 
Sbjct: 1671 QELDKKPIIKCLLTDSRSTISIVTSKNKEKFRNRFFGTKAMRLRDEVSDNNLYLCYIETK 1730

Query: 1271 NNIADILTKALPAKRFNDLTNVWM 1294
             NIADILTK LP K F  LTN W+
Sbjct: 1731 KNIADILTKPLPIKTFKLLTNKWI 1754

 Score =  447 bits (1150), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/479 (45%), Positives = 304/479 (63%), Gaps = 7/479 (1%)

Query: 11  NHVDDEFD-LPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKF 69
           NH D   D LPG+LL+DSGAS ++IR +  +H     I I   DAQ   IPI++ G L+F
Sbjct: 445 NHTDHSNDELPGHLLIDSGASQTLIRSAHHIHSASPNIDISAIDAQKKEIPINAIGNLQF 504

Query: 70  HFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFY 129
            F +     I+   +PNI +DL+SL EL    I A F+  +L   D  V+A +++HG FY
Sbjct: 505 QFDDNTKTSITVLHTPNIAHDLLSLSELAKQNITACFTKNTLERSDGTVLAHIVRHGDFY 564

Query: 130 WLSTKYLMLPARSRNHRINNILP-----RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNIS 184
           WLS KYL +P+      +NNI       ++ +  IHR+ GH N + I++S++   I  + 
Sbjct: 565 WLSKKYL-IPSNLSVPTVNNIGTDKGSHKYPYPLIHRMLGHANAQTIRNSLKNNSITYLK 623

Query: 185 YDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSS 244
             ++DWS   T+QCPDCL GKST+H+H  GSRVKYQ  Y  F++LHTD+FGPV N+P S+
Sbjct: 624 ESDVDWSKATTYQCPDCLIGKSTKHRHVKGSRVKYQDSYEPFQYLHTDIFGPVHNLPKSA 683

Query: 245 PTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTN 304
           P+YFI+FTDE++RF+WV+PL  +   ++  VF  I+A    QF   VLV QMDRGSE+TN
Sbjct: 684 PSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIERQFKASVLVIQMDRGSEYTN 743

Query: 305 AEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFA 364
             +  F  + GI  CYT+  DSRAHGVAERLNRTLLDDCRT L+ SGL  HLWF +VEF+
Sbjct: 744 KTLHKFLLKKGITACYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAVEFS 803

Query: 365 TLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTP 424
           T++RN+L++   +               T+LPFGQ V+ ++ NP  K+H RG  GYAL P
Sbjct: 804 TIVRNSLVSPKNEKSARQHAGLAGLDISTLLPFGQPVVVNNHNPDSKIHPRGIPGYALHP 863

Query: 425 SKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDDFLN 483
           S+ S+GY+IY+P L K +DT+NYV+++   +     NYD+  FD  +  +   Y  F++
Sbjct: 864 SRNSYGYIIYLPSLKKTVDTTNYVILQDKQSRLDQFNYDALTFDEDISRLTASYKSFID 922

>Smik_45.1 Chr45 complement(3..2270) [2268 bp, 756 aa] {ON}  YNL054W-B
            (REPEAT)
          Length = 756

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/505 (53%), Positives = 367/505 (72%), Gaps = 6/505 (1%)

Query: 732  WEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRK 791
            W   NM S++ PP+ ++RI+ I ++K   +  P    T++ Y +AI+ N+N +EK+ Y +
Sbjct: 256  WNNKNMRSLE-PPRSKKRINLIAAIKGVKSIKPV--RTTLRYDEAITYNKNNKEKDRYIE 312

Query: 792  AYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAG 851
            AY KE++QL+K NTWD  + YD  +++PKKIINSM IF  KRDGTHK RFVARGD Q+  
Sbjct: 313  AYHKEVNQLLKMNTWDTDKYYDRNDIDPKKIINSMFIFNKKRDGTHKARFVARGDIQHPD 372

Query: 852  TYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKN 911
            TY+  + +NT+HH ALMT ++IALDND +I QLDISSAYLYAD+KEELYIR PPHLG  N
Sbjct: 373  TYESGMQSNTVHHYALMTSLSIALDNDYYITQLDISSAYLYADIKEELYIRPPPHLGLNN 432

Query: 912  KIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVF 971
            K+ +L KSLYGLKQSGANWYE IK YL   C M  +RGW C F+N ++ +CLFVDD+I+F
Sbjct: 433  KLLRLRKSLYGLKQSGANWYETIKSYLINCCEMQEVRGWSCVFRNSEVTICLFVDDMILF 492

Query: 972  GKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLE 1031
             K       ++  LK +Y+TK++N G  E      YDILGLEI Y+RSK +  GMEKSL 
Sbjct: 493  SKDLNANKKIITTLKKQYDTKIINLG--ESDNEIQYDILGLEIKYQRSKYMKLGMEKSLT 550

Query: 1032 QKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKY 1091
            +K+P L V LN + +++ APGQPG+ +   +L++ E EYK KV  MQKL+GLASY+GYK+
Sbjct: 551  EKLPKLNVHLNPKGKKLSAPGQPGLYIDQDELEIDEDEYKEKVHEMQKLIGLASYVGYKF 610

Query: 1092 RYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAK-ERNTQRVTAITD 1150
            R+DLLYYIN LAQH L+PS QVL +TY+LIQ++WDTR+K+LIW + K  +   ++ AI+D
Sbjct: 611  RFDLLYYINTLAQHILFPSRQVLDMTYELIQFMWDTRDKQLIWHRNKPTKPDNKLVAISD 670

Query: 1151 AAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLM 1210
            A++ NQP YKSQVG   L+N K+I  +STKA+LTC S+TE+E++A+S  IPLLN++  L+
Sbjct: 671  ASYGNQPYYKSQVGNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAIPLLNNLSHLV 730

Query: 1211 ETITGNQVKNKLITDSAPAISIINS 1235
            + +    +   L+TDS   ISII S
Sbjct: 731  QELNKKPIIKGLLTDSRSTISIIKS 755

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score =  563 bits (1452), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 269/562 (47%), Positives = 393/562 (69%), Gaps = 10/562 (1%)

Query: 740  IKFPPKQRRRI-----HYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYM 794
            ++ PP++R RI     + IN+V  AV    +  N S++Y +A+S N NV E+ L+ +AY 
Sbjct: 844  VENPPRRRHRIKNIRINRINAVNKAVGIQHTKINPSLNYFEAVSGNDNVEERNLFSQAYH 903

Query: 795  KELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYD 854
            KE++QL   NTWD+  I D  EV+  K+IN+M IFTTKR+G  KCR VARGDQQ  GT++
Sbjct: 904  KEIEQLENMNTWDDQDIKDESEVDSNKVINTMFIFTTKRNGKKKCRCVARGDQQKPGTFN 963

Query: 855  DSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIF 914
            +   ++T+HH ALMTC+AIALD   +I QLDISSAYLYA L+EELYIRTPPH+  K K+ 
Sbjct: 964  EDATSSTVHHYALMTCLAIALDKGQYITQLDISSAYLYAALEEELYIRTPPHMKMKGKVM 1023

Query: 915  KLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVFGKK 974
            +L KSLYGLKQSGANWY  I+++L ++C ++ + GWPC F N ++ VCLFVDD++VF K 
Sbjct: 1024 RLNKSLYGLKQSGANWYNTIREFLLDNCDLTEVTGWPCVFTNNNVTVCLFVDDMVVFSKD 1083

Query: 975  HKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKI 1034
                  LV  L+ +++TKVV+ G++    S +YDILGLE+ Y+ ++ + FGME+SL  K+
Sbjct: 1084 LADADKLVDTLQSKFDTKVVHSGELIN-NSANYDILGLEVEYKFNEHMKFGMEESLSDKL 1142

Query: 1035 PSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYD 1094
              L V++++ K   K P  P   +  + +D ++  Y + V  +Q++VGLASY+ +KYR+D
Sbjct: 1143 TKLEVSMDTTKSS-KTPSPPNYYIQSNTMDSTDENYYKDVNWLQRIVGLASYVAHKYRFD 1201

Query: 1095 LLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFA 1154
            LLYY+N+LAQHTL+P+ +V  L  QL++Y++DTR+K+L+W K   ++   +TA+TDAAFA
Sbjct: 1202 LLYYVNVLAQHTLFPNKEVKRLAKQLVKYMFDTRSKKLLWKKQDIKDNN-LTALTDAAFA 1260

Query: 1155 NQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETIT 1214
            N   +KSQ+G FI++N KII  +S+K  L C SSTE+ELY++S   P+L S++ L+++I 
Sbjct: 1261 NMANFKSQIGNFIILNGKIIGGKSSKEKLACTSSTEAELYSVSEAYPMLLSLQELVQSIK 1320

Query: 1215 GNQVKNKLITDSAPAISIIN--SQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNN 1272
               +  K+ITDS P I++I     D+ K R +YFGAR+ ++RDE+  S + L Y++T+ N
Sbjct: 1321 AEPIHLKIITDSKPVIALIQRAEMDDKKFRTRYFGARASRLRDELDQSRVSLHYIDTETN 1380

Query: 1273 IADILTKALPAKRFNDLTNVWM 1294
            IAD LTK L  K+FN+ T  W+
Sbjct: 1381 IADCLTKPLSIKKFNEFTKTWI 1402

 Score =  419 bits (1078), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 210/480 (43%), Positives = 304/480 (63%), Gaps = 9/480 (1%)

Query: 16  EFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFANGP 75
           E ++  + +LDS A  S++  S LLH         +  A +  IP++++G L F + N  
Sbjct: 168 ELNINEFFVLDSAAEISVVS-SKLLHNRNDDPPDQLFGAGNEEIPVAASGNLTFKWLNSV 226

Query: 76  PVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKD-NNVIATLLKHGPFYWLSTK 134
              I A +SP +  +L+S ++L+  G+  D   ++L   D + V+A ++K G +  +   
Sbjct: 227 SHCIYAIASPYVDLNLVSTNDLEAIGVIVDNRRKALVKVDTDEVLAPIIKIGKYQCVPLS 286

Query: 135 YLMLPA-RSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGF 193
           +  LP  +S+ H ++    +F    +HRLFGH+N+K I+ SI   LI NI  +++DWSG 
Sbjct: 287 FGKLPKHKSQVHALSK---KFPLTLVHRLFGHINVKDIRKSIESKLITNIRINDVDWSGI 343

Query: 194 DTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTD 253
           D FQC DCL GK T+HKH VGSR+KYQ+ Y  FE++HTDLFGPV  +  +SP YFISFTD
Sbjct: 344 DKFQCKDCLAGKITKHKHIVGSRLKYQKSYEPFEYIHTDLFGPVSGVDITSPKYFISFTD 403

Query: 254 EQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRE 313
           E +RFRWVFPL+ KDA  +  +F+ +V     QF  +VL F MDRGSE+TN  +R +F++
Sbjct: 404 ENTRFRWVFPLKKKDADHILPIFQQLVNYIKNQFKVRVLTFHMDRGSEYTNKLVRDYFKD 463

Query: 314 NGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLN 373
            GI P YT+VGDS ++G+AER N T L+DCRTLL SS L  +LWFY+V+FATL+RNA +N
Sbjct: 464 KGILPIYTTVGDSSSNGIAERANLTFLNDCRTLLSSSKLPANLWFYAVDFATLMRNAFIN 523

Query: 374 TTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLI 433
           ++  +              TILPFGQ V+ HD N + KL  RG  G+ALTPSKESHGYLI
Sbjct: 524 SSTNSSARAKAGLAGLDARTILPFGQEVMVHDYNQVSKLKPRGITGFALTPSKESHGYLI 583

Query: 434 YVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDDFLNDTSAPALIDD 493
           ++P +HKV+DTSNY ++ +D+      +  ++VFD L++      D+     S  A++D+
Sbjct: 584 FIPSIHKVIDTSNYALVINDSKSLDSISTGTSVFDTLLEDFHSNEDEL---ASIGAVVDN 640

>KNAG0F03765 Chr6 (715917..716089,716091..719205) [3288 bp, 1095 aa]
            {ON} Ty-like element; ribosomal frameshifting site
            uncertain; NNN added to avoid internal stop codon
          Length = 1095

 Score =  542 bits (1397), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 270/556 (48%), Positives = 391/556 (70%), Gaps = 15/556 (2%)

Query: 745  KQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHN 804
            K +  I+Y   +K   NN  +  N S+ Y  AI  N+NV E +L+ +AY KE++QL K N
Sbjct: 544  KHKFSINYTQVIKTITNNV-NTKNRSIFYHQAIQYNRNVEENKLFTEAYNKEVNQLKKMN 602

Query: 805  TWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHH 864
            TW+ + I D+ +V  + +IN+M IFT  RDGTHKCRFVARGDQQ+  T+   L +NTIHH
Sbjct: 603  TWEENAI-DISDVPKQNVINAMFIFTVTRDGTHKCRFVARGDQQDPLTFQQDLKSNTIHH 661

Query: 865  EALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLK 924
             ALM+ +A++LDN   I+Q+DISSAYLYADLKE+LYIRTPPH G  NK+FK +KSLYGLK
Sbjct: 662  YALMSALAMSLDNGYQIIQMDISSAYLYADLKEDLYIRTPPHYGMSNKVFKPKKSLYGLK 721

Query: 925  QSGANWYENIKKYLTEDCGMSNIRGWPCAFKNED----LIVCLFVDDIIVFGKKHKKCMD 980
            QSGANWY+ IK++L  +C +  + GW C F  E+    +I+CLFVDD+I     ++    
Sbjct: 722  QSGANWYQKIKEFLITNCQLKEVPGWLCVFHKEEDGKIIIICLFVDDMITMTNSNEYATS 781

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT 1040
             +  +K +++TK +NDG    +E   YDILG+EI Y+R+  +  GME SL +K+P LG+ 
Sbjct: 782  TILTIKEKFDTKFINDGI--GSEEISYDILGIEIKYKRNHYMKLGMETSLSKKLPELGIN 839

Query: 1041 LNSEKRRMKAPGQPGIILSDSK-LDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLL-YY 1098
            L +++   K PG P  I+++ K L++++ EYK+K+K MQK++GLASY+ YKYR+DLL  Y
Sbjct: 840  LQTKR---KVPGTPHEIVNEDKDLEVTQEEYKKKIKWMQKMIGLASYVAYKYRFDLLXXY 896

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKA--KERNTQRVTAITDAAFANQ 1156
            +N LA++TLYPSNQV+SLT QLIQY+W T+ K+L+W K+  +E +T  ++AITDA+ ANQ
Sbjct: 897  VNTLARYTLYPSNQVISLTKQLIQYLWCTKEKQLLWKKSEFQEFDTNYLSAITDASLANQ 956

Query: 1157 PGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGN 1216
               KSQ G   L+N KII A+S+K+TLTC SSTE+EL+A++  IP L +I++L+ETI+  
Sbjct: 957  KNLKSQFGNIYLLNGKIIGAKSSKSTLTCTSSTEAELFAVTESIPRLQNIRLLIETISNL 1016

Query: 1217 QVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADI 1276
            QVK  +I  + P I+ I   D + ++ K++G + ++ ++E+  ++L +EY+NT  NIAD+
Sbjct: 1017 QVKCLIINYNMPCITSIKEGDTSMVKGKFYGTKLLRTKEEIDNNNLNIEYINTKKNIADV 1076

Query: 1277 LTKALPAKRFNDLTNV 1292
            LTK LP   F  ++ +
Sbjct: 1077 LTKPLPVADFQRISKM 1092

 Score =  345 bits (884), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 172/425 (40%), Positives = 254/425 (59%), Gaps = 24/425 (5%)

Query: 90  DLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINN 149
           +L+S+ +L+  G+  D     L   +    A ++ H  F WLS ++++ P         N
Sbjct: 4   NLLSMHDLEQNGLCLDTRMNILYSTNQTAKAHVIMHDSFRWLSFRHIVFPP--------N 55

Query: 150 ILPRFSF-----EFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKG 204
           + P+ S        IHRL GH+N++ +  SI+    +++   +IDW     FQC DCL+G
Sbjct: 56  VPPKRSILSSQNALIHRLLGHINVQSLYKSIKNKTFQHLELSDIDWGNLAQFQCVDCLQG 115

Query: 205 KSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPL 264
           KS QH H VGSRVK+Q +Y+ FE+LH+DL GP+ +  T++  +FISFTDE +R+RWV+ +
Sbjct: 116 KSRQHSHIVGSRVKHQEKYSNFEYLHSDLLGPISSPSTNTKAWFISFTDETTRYRWVYKI 175

Query: 265 RSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVG 324
             K  +T+  + ++++     QF   VL FQ DRGSEFTN  +R +  ENGI   YTSVG
Sbjct: 176 TDKRDTTILHILKSLIGYIRNQFKGNVLAFQFDRGSEFTNNIVRTYLAENGISTLYTSVG 235

Query: 325 DSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXX 384
           D +++GVAERLN TL++DCRTLL+++ L  HLWFY+V+FATL+RN++ N T ++      
Sbjct: 236 DHQSNGVAERLNLTLMNDCRTLLKTTNLPYHLWFYAVQFATLLRNSVYNDTLQSSARAKA 295

Query: 385 XXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDT 444
                   +ILPFGQ VI H T    KL  RG  G+AL PS  S GY IY+P    V+D+
Sbjct: 296 GLPGIDVKSILPFGQPVIAHFTKLKTKLRYRGEQGFALVPSDNSCGYHIYIPKTGAVVDS 355

Query: 445 SNYVVIRSDTNISADHNYDSTVF----DPLMQSIARPYDDFLNDTSAPALIDDNSSEPDN 500
           +NY VIRS+  I++  +YD T+F    D L  + A+   DF ++  +P        +P  
Sbjct: 356 TNYAVIRSNIQINSKEDYDDTIFDDVIDKLTDAAAQTTSDFDDEMLSP-------HQPTE 408

Query: 501 STSAP 505
           +T+ P
Sbjct: 409 TTTLP 413

>Kwal_1.414 s1 (3588..5348) [1761 bp, 586 aa] {ON} YCL074W -
            Psuedogene: encodes fragment of Ty Pol protein [contig
            695] FULL
          Length = 586

 Score =  521 bits (1342), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 269/556 (48%), Positives = 366/556 (65%), Gaps = 9/556 (1%)

Query: 746  QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
            +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 34   KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 92

Query: 806  WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
            WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 93   WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 152

Query: 866  ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
            AL TC+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQ
Sbjct: 153  ALTTCLAITLEQGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQ 212

Query: 926  SGANWYENIKKYLTEDCGMSNIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDL 981
            SGANWYE IK YLT  CG+S I+ WPC      K + L+V LFVDD+IV     +   +L
Sbjct: 213  SGANWYEVIKNYLTNTCGLSEIKQWPCVLVKKRKEDTLVVNLFVDDMIVMTSNDELYNEL 272

Query: 982  VQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTL 1041
            +  L+  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++L
Sbjct: 273  LVQLQKEFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLSL 332

Query: 1042 NSEKRRMKAPGQPGII--LSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYI 1099
              +K R   PGQPG I  LS+ +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY+
Sbjct: 333  QGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYYV 391

Query: 1100 NILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGY 1159
            N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+       + AITDA+ A Q  Y
Sbjct: 392  NVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDINIDAITDASHATQEEY 451

Query: 1160 KSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVK 1219
            KSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P L S++ +   + G + +
Sbjct: 452  KSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALYNSLPKLKSLQDITAAL-GYKSQ 510

Query: 1220 NKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTK 1279
              + TDS   IS I   D +K RN++FG+++ ++R E      ++ YV+T  N ADILTK
Sbjct: 511  TTIYTDSQTVISSITKTDTSKFRNRFFGSKAFRLRQEYDAGEFQVAYVSTKENTADILTK 570

Query: 1280 ALPAKRFNDLTNVWMV 1295
             L  K F  L   W+V
Sbjct: 571  PLAVKIFQGLIENWIV 586

>Kwal_55.19796 s55 complement(129910..132153) [2244 bp, 747 aa] {ON}
            YLR035C-A - Ty ORF [contig 159] FULL
          Length = 747

 Score =  524 bits (1350), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 269/556 (48%), Positives = 366/556 (65%), Gaps = 9/556 (1%)

Query: 746  QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
            +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 195  KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 253

Query: 806  WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
            WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 254  WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 313

Query: 866  ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
            AL TC+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQ
Sbjct: 314  ALTTCLAITLEQGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQ 373

Query: 926  SGANWYENIKKYLTEDCGMSNIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDL 981
            SGANWYE IK YLT  CG+S I+ WPC      K + L+V LFVDD+IV     +   +L
Sbjct: 374  SGANWYEVIKNYLTNTCGLSEIKQWPCVLVKKRKEDTLVVNLFVDDMIVMTSNDELYNEL 433

Query: 982  VQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTL 1041
            +  L+  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++L
Sbjct: 434  LVQLQKEFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLSL 493

Query: 1042 NSEKRRMKAPGQPGII--LSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYI 1099
              +K R   PGQPG I  LS+ +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY+
Sbjct: 494  QGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYYV 552

Query: 1100 NILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGY 1159
            N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+       + AITDA+ A Q  Y
Sbjct: 553  NVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDINIDAITDASHATQEEY 612

Query: 1160 KSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVK 1219
            KSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P L S++ +   + G + +
Sbjct: 613  KSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALYNSLPKLKSLQDITAAL-GYKSQ 671

Query: 1220 NKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTK 1279
              + TDS   IS I   D +K RN++FG+++ ++R E      ++ YV+T  N ADILTK
Sbjct: 672  TTIYTDSQTVISSITKTDTSKFRNRFFGSKAFRLRQEYDAGEFQVAYVSTKENTADILTK 731

Query: 1280 ALPAKRFNDLTNVWMV 1295
             L  K F  L   W+V
Sbjct: 732  PLAVKIFQGLIENWIV 747

>NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON} 
          Length = 1303

 Score =  512 bits (1319), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 250/475 (52%), Positives = 340/475 (71%), Gaps = 12/475 (2%)

Query: 745  KQRRRIHYINSVKHAVNNPPSVG-NTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKH 803
            K ++ ++YI +  H++N   S+   TS  Y  AI+ N N  EK+L+++AY KE+ QL K 
Sbjct: 831  KSKQTVNYIKATNHSINAIKSIPLQTSTFYPQAITYNNNETEKQLFQEAYEKEISQLKKM 890

Query: 804  NTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIH 863
             TWD + I + + V+  KIINSM IFT KRDGTHKCR VARGDQQ  GTY+  + ANT+H
Sbjct: 891  GTWDETAIEE-ELVDKNKIINSMFIFTIKRDGTHKCRLVARGDQQKDGTYNTDMTANTVH 949

Query: 864  HEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGL 923
            H ALMTC++  L N   I+QLDISSAYLYAD+ E LYIR PPH+  KNK+F+L+KSLYGL
Sbjct: 950  HYALMTCLSNCLSNSYDIIQLDISSAYLYADIDETLYIRAPPHMNMKNKVFQLQKSLYGL 1009

Query: 924  KQSGANWYENIKKYLTEDCGMSNIRGWPCAF-KNED---LIVCLFVDDIIVFGKKHKKCM 979
            KQSGANWY+ IK +LT+   M+ + GWPC F K +D   LI+CLFVDD+I+F   +K   
Sbjct: 1010 KQSGANWYKLIKGFLTDKLNMTEVLGWPCVFMKRKDKQVLIICLFVDDMILFTNSNKMAT 1069

Query: 980  DLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGV 1039
            D ++LLK R+ TKV+NDGK        YDILG+EI Y +++S+ FGMEKSLE+K+P+LG+
Sbjct: 1070 DAIELLKTRFATKVINDGKDNTINK--YDILGMEIEYVKNQSMKFGMEKSLEEKLPTLGI 1127

Query: 1040 TLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYI 1099
             L+   +  K PG PG+I+    + +++ EY +KVK MQ+++GLASY+GYKYR+DLLYYI
Sbjct: 1128 DLS---KLRKVPGTPGLIIEKEDIKVTKQEYNQKVKWMQQIIGLASYVGYKYRFDLLYYI 1184

Query: 1100 NILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQ-RVTAITDAAFANQPG 1158
            N+LA+HTLYPS  V+ L  +LIQY+W+TR ++LIW K+   NT  ++  I DA+FANQ  
Sbjct: 1185 NVLARHTLYPSGTVIQLAKELIQYLWNTRGRKLIWLKSNNSNTHNKLNIICDASFANQEN 1244

Query: 1159 YKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETI 1213
            +KSQ G+ I +N+ II   S+K+T+TC SSTE+ELY++S  IP    +  L + I
Sbjct: 1245 FKSQYGHIIKLNDNIIAGTSSKSTITCSSSTEAELYSVSQAIPQFELLTALSKRI 1299

 Score =  388 bits (996), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 183/471 (38%), Positives = 297/471 (63%), Gaps = 15/471 (3%)

Query: 22  YLLLDSGASTSIIRHSSLLHFPQQ----PIHIGVQDAQDNPIPISSTGILKFHFANGPPV 77
           + +LDSGAS +++++ S+LH   Q    P+   +  +Q+ P+  +  G L+    +   +
Sbjct: 210 HFILDSGASVTVVKNGSILHDLHQTASPPV---ISSSQNIPMRCTGQGTLRLKLYHSKTI 266

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
            I A   P + ++L+S + L+   I+ D    +L  +D N +A  ++     WL+  +++
Sbjct: 267 DIPAYVIPELEHNLLSTNSLEHHDIFVDAKHGTLESRDGNTLAQFVRFNSLPWLTFHHVV 326

Query: 138 LPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQ 197
           +P  +R   INN++ +F  + +HRL GHVN+K ++ SI+     + + ++IDW+G  TFQ
Sbjct: 327 IPPHAR---INNLIQKFPLDVVHRLLGHVNVKSLQQSIKNKTFDHFTIEDIDWTGISTFQ 383

Query: 198 CPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSR 257
           C  CL+GKS +H H VGSR+KYQ+ Y  F+++HTD+FGPV ++    P++F++FTDE +R
Sbjct: 384 CITCLQGKSRKHNHTVGSRLKYQKNYEPFQYIHTDVFGPV-SVDKPYPSWFVAFTDEATR 442

Query: 258 FRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQ 317
           FRWVFPL +K A  +  V   +V T   QF++KVL FQ D G E+ N  ++++   NGIQ
Sbjct: 443 FRWVFPLENKTADLMLHVITALVNTIKRQFNSKVLCFQFDHGREYDNKLLQNYLESNGIQ 502

Query: 318 PCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYK 377
             + SV DS ++GVAER+N TLL+DCRTLL+++ L  +LWFY+++F+T+IRN++ N + K
Sbjct: 503 SIFNSVADSASNGVAERMNLTLLNDCRTLLKAAQLPDNLWFYAIQFSTVIRNSVYNESIK 562

Query: 378 TXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPH 437
           +              TILPFGQ VI H T    KLH RG  G+ALTPS  S+GYLIY+P 
Sbjct: 563 SSPRAIAGLSGLDVKTILPFGQPVIAHRTKTSSKLHSRGEPGFALTPSTHSYGYLIYIPR 622

Query: 438 LHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDDFLNDTSAP 488
              ++DT+NY V++ + + S   + ++++ DPL+ +    ++D ++DT +P
Sbjct: 623 TQTIIDTANYAVVKQNVSTSHSADQNASIIDPLLDA----FNDHVHDTDSP 669

>Kpol_1066.30 s1066 complement(52257..53045) [789 bp, 262 aa] {ON}
           complement(52257..53045) [789 nt, 263 aa]
          Length = 262

 Score =  471 bits (1212), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 225/262 (85%), Positives = 233/262 (88%)

Query: 137 MLPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTF 196
           MLPARSR+H+INNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGF+TF
Sbjct: 1   MLPARSRHHQINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFETF 60

Query: 197 QCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQS 256
           Q PDCLKGKSTQHKHYVGS VKYQREYNTFEFLHTDLF PVPNMPTSSPTYFISFTDE+S
Sbjct: 61  QFPDCLKGKSTQHKHYVGSCVKYQREYNTFEFLHTDLFAPVPNMPTSSPTYFISFTDERS 120

Query: 257 RFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGI 316
           +FRW FPLRSKDA+ VTTVFRNIVA   TQFDTKVL FQMDRGSEF+NAEIRHFFRENGI
Sbjct: 121 KFRWDFPLRSKDAAIVTTVFRNIVAFISTQFDTKVLGFQMDRGSEFSNAEIRHFFRENGI 180

Query: 317 QPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTY 376
           Q CYTSVGDSRAHGVAERLNR  LDDCRTLLESSGLS HLWFYSVEFA LI+NALLNT Y
Sbjct: 181 QSCYTSVGDSRAHGVAERLNRPFLDDCRTLLESSGLSSHLWFYSVEFANLIQNALLNTKY 240

Query: 377 KTXXXXXXXXXXXXXXTILPFG 398
           KT              TILPFG
Sbjct: 241 KTSARARAGLAGLDASTILPFG 262

>Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 550

 Score =  447 bits (1149), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 219/486 (45%), Positives = 306/486 (62%), Gaps = 4/486 (0%)

Query: 13  VDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFA 72
           +D   +LP +LL+DSGAS +++R +  LH       I + DAQ   IPI++ G L F+F 
Sbjct: 20  IDSNDELPDHLLIDSGASQTLVRSAHYLHHATPNSEINIVDAQKQDIPINAIGNLHFNFK 79

Query: 73  NGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLS 132
           NG    I A  +PNI YDL+SL EL +  I A F+  +L   D  V+A + KHG FYWLS
Sbjct: 80  NGTKTSIKALHTPNIAYDLLSLSELANQDITACFTRNTLERSDGTVLAPIFKHGDFYWLS 139

Query: 133 TKYLMLPARSR----NHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
            KYL+    S+    N   +  + ++ +  IHR+ GH N++ I+ S++K  +  +   +I
Sbjct: 140 KKYLIPSQISKLTINNVNNSKSVNKYPYPLIHRMLGHANVQSIQKSLKKNAVTYLKESDI 199

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYF 248
           +WS   T+QCPDCL GKST+H+H  GSR+KYQ  Y  F++LHTD+FGPV ++P S+P+YF
Sbjct: 200 EWSNASTYQCPDCLIGKSTKHRHVKGSRLKYQESYEPFQYLHTDIFGPVHHLPKSAPSYF 259

Query: 249 ISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIR 308
           ISFTDE++RF+WV+PL  +   ++  VF +++A    QF+ +VLV QMDRGSE+TN  + 
Sbjct: 260 ISFTDEKTRFQWVYPLHDRREESILNVFTSLLAFIKNQFNARVLVIQMDRGSEYTNKTLH 319

Query: 309 HFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIR 368
            FF   GI  CYT+  DSRAHGVAERLNRTLL+DCRTLL  SGL  HLWF +VEF+T+IR
Sbjct: 320 KFFTNRGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLWFSAVEFSTIIR 379

Query: 369 NALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKES 428
           N+L++                   TILPFGQ VI ++ NP  K+H RG  GYAL PS+ S
Sbjct: 380 NSLVSPKNDKSARQHAGLAGLDITTILPFGQPVIVNNHNPDSKIHPRGIPGYALHPSRNS 439

Query: 429 HGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDDFLNDTSAP 488
           +GY+IY+P L K +DT+NYV+++   +     NYD+  FD  +  +      F+  +   
Sbjct: 440 YGYIIYLPSLKKTVDTTNYVILQDKQSKLDQFNYDTLTFDDDLNRLTAHSQSFIEQSETE 499

Query: 489 ALIDDN 494
              D N
Sbjct: 500 QSYDQN 505

>Kwal_12.670 s12 complement(38284..39510) [1227 bp, 408 aa] {ON}
            YAR009C - TyB Gag-Pol protein [contig 461] FULL
          Length = 408

 Score =  399 bits (1026), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 203/394 (51%), Positives = 270/394 (68%), Gaps = 7/394 (1%)

Query: 826  MIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLD 885
            M IFTTKRDG  KCR VARGD+Q   TYD    A T+ HEAL TC+AI L+    I QLD
Sbjct: 1    MFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHEALTTCLAITLEQGWTIKQLD 60

Query: 886  ISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMS 945
            I+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQSGANWYE IK YLT  CG+S
Sbjct: 61   ITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQSGANWYEVIKNYLTNTCGLS 120

Query: 946  NIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEK 1001
             I+ WPC      K + L+V LFVDD+IV     +   +L+  L+  +ETKVV +G  EK
Sbjct: 121  EIKQWPCVLVKKRKEDTLVVNLFVDDMIVMTSNDELYNELLVQLQKEFETKVVAEGTPEK 180

Query: 1002 AESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGII--LS 1059
                 YDILGLEI Y++   +  GMEK++ +K+P LG++L  +K R   PGQPG I  LS
Sbjct: 181  DGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLSLQGKKERF-VPGQPGHILDLS 239

Query: 1060 DSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQ 1119
            + +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY+N+LAQHTL+P ++V  L  Q
Sbjct: 240  NKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYYVNVLAQHTLFPCDEVFDLALQ 299

Query: 1120 LIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARST 1179
             +QY+W  ++K+L W K++      + AITDA+ A Q  YKSQ+GYF  VN  II ARST
Sbjct: 300  CVQYLWTNKHKKLTWIKSRIPEDIHIDAITDASHATQEEYKSQLGYFYKVNGHIIFARST 359

Query: 1180 KATLTCISSTESELYAISMVIPLLNSIKMLMETI 1213
            ++T++CISSTE+EL A+   +P L S++ +   I
Sbjct: 360  RSTISCISSTEAELNALFNSLPKLKSLQEITAAI 393

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score =  408 bits (1048), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/432 (45%), Positives = 279/432 (64%), Gaps = 2/432 (0%)

Query: 22  YLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFANGPPVKISA 81
           +LL+DSGAST+I+R+   LH         ++DAQ   + + S G L+  F N  P K+ A
Sbjct: 385 FLLIDSGASTNILRNEDHLHDKTSDAGCLLEDAQGKQMKVLSKGTLQIQFLNSRPFKVDA 444

Query: 82  ASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPAR 141
            SSP  + +L+S+ EL   G Y ++  +++ +K    +A +++ GP++WLS+KYL+ P +
Sbjct: 445 LSSPAAKTNLLSVGELLREGFYVNYRNKTIENKHGVPVAKMIQKGPYFWLSSKYLIKPQK 504

Query: 142 SRNHRINNILP-RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPD 200
           +   + NN+   ++S +++HRLFGHVN+K IKDSI+   I  I  D +DW+  + FQC  
Sbjct: 505 TIIQKANNVNKVKYSVDYLHRLFGHVNVKSIKDSIKDRSIAGIEVDEVDWTNLEKFQCEI 564

Query: 201 CLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRW 260
           C+ GKST+ +H + SR+KYQ+EY  F+F+HTDLFGPV     + P Y ++FTDE +R++W
Sbjct: 565 CMMGKSTKGRHLMNSRLKYQKEYKPFQFIHTDLFGPVQVTAVNVPRYLLAFTDECTRYKW 624

Query: 261 VFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCY 320
           VFPLR KD+ ++T  F  +V    TQ +TKVL FQMD+G+EFTN  I  FF +NGI   +
Sbjct: 625 VFPLREKDSQSITARFSELVRFIETQLETKVLCFQMDQGTEFTNKTITQFFHDNGIITRF 684

Query: 321 TSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXX 380
           T+VGDSR++GVAER N  LL+DCRTLL S  L   LWFY+V+FATL+RN+++ T+ K   
Sbjct: 685 TTVGDSRSNGVAERTNLLLLNDCRTLLTSVKLPDDLWFYAVKFATLMRNSIVTTSTKESP 744

Query: 381 XXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHL-H 439
                       T+LPFGQ VI +      KLH RG  GYAL PS  S GYLIYVP    
Sbjct: 745 RAKAGLTGLDISTVLPFGQPVIVNKPKTSSKLHSRGWKGYALCPSSVSFGYLIYVPGAPQ 804

Query: 440 KVLDTSNYVVIR 451
            ++DT +Y  IR
Sbjct: 805 DIIDTRHYRAIR 816

 Score =  244 bits (622), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 117/200 (58%), Positives = 149/200 (74%), Gaps = 2/200 (1%)

Query: 733  EKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKA 792
            +++  +S   PP  ++RIHY    K+  ++       S+SY++AI+ N N  EKE +  A
Sbjct: 1048 DQDGTTSQGSPPSSKQRIHYAQVTKN--HSETHAERPSLSYKEAITYNSNAEEKEKFIAA 1105

Query: 793  YMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGT 852
            Y KE+ QL+K  TWD+ R+ + +++   +IINSM IFTTKRDGT KCRFVARGDQQ   T
Sbjct: 1106 YEKEIGQLLKMQTWDSDRVVNARDIRKNRIINSMFIFTTKRDGTKKCRFVARGDQQKPET 1165

Query: 853  YDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNK 912
            Y ++L ANT+H+ ALMTCMAIALDNDMFI QLDISSAYLYA+LKEELYIR PPHL  K+K
Sbjct: 1166 YLENLQANTVHNYALMTCMAIALDNDMFITQLDISSAYLYAELKEELYIRAPPHLQLKDK 1225

Query: 913  IFKLEKSLYGLKQSGANWYE 932
            + +L KSLYGLKQSGANWY+
Sbjct: 1226 VLRLNKSLYGLKQSGANWYQ 1245

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score =  382 bits (982), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 196/417 (47%), Positives = 268/417 (64%), Gaps = 9/417 (2%)

Query: 59  IPISSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSL-RDKDNN 117
           I ++++G L FH+ N     + A SSP++  +LIS D L+D GI  D   ++L R   + 
Sbjct: 23  ITVAASGNLTFHWLNNTSHSLYAISSPHVNLNLISTDALEDVGIIVDNRRKALVRLDSDE 82

Query: 118 VIATLLKHGPFYWLSTKYLMLPA-RSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIR 176
           V+A + K G +  ++  +  LP  +S  H ++    +FS   IHRLFGH+N++ IK SI 
Sbjct: 83  VLAPVTKIGKYRCVTLSFGKLPKHKSPVHVLSQ---KFSLTLIHRLFGHINVRDIKKSIE 139

Query: 177 KGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGP 236
              I  I  +++DWSG D FQC DCL GK T+HKH VGSR+  +   +   ++HTDLFGP
Sbjct: 140 SKSITTIRINDVDWSGIDKFQCKDCLTGKLTKHKHIVGSRLNIK---SPMSYIHTDLFGP 196

Query: 237 VPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQM 296
           V  +  +SP YFISFTDE +RFRWVFPL+ KDA  +  +F+ +V    TQF  +VL F M
Sbjct: 197 VSGVDITSPKYFISFTDENTRFRWVFPLKKKDADHILPIFQQLVNYIKTQFKVRVLTFHM 256

Query: 297 DRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHL 356
           DRGSE+T+  +R +F++ GI P YT+VGDS ++G+AER N T L+DCRTLL SS L   L
Sbjct: 257 DRGSEYTSTMVRDYFKDKGIIPIYTTVGDSSSNGIAERANLTFLNDCRTLLSSSNLPASL 316

Query: 357 WFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRG 416
           WFY+V+FATL RNA +N++  +              TILPFGQ V+ HD     KL  RG
Sbjct: 317 WFYAVDFATLRRNAFINSSTNSSARAKAGLAGLDARTILPFGQEVMIHDYTQTSKLKSRG 376

Query: 417 HHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQS 473
             G+ALTPSKESHGYLI+VP L KV+DTSNYV++  D+  S   +   +VFD L++S
Sbjct: 377 ITGFALTPSKESHGYLIFVPALRKVIDTSNYVIVVHDST-SLSESSTHSVFDNLLES 432

>KNAG0A01870 Chr1 (132203..134533) [2331 bp, 776 aa] {ON} 
          Length = 776

 Score =  390 bits (1003), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 188/459 (40%), Positives = 285/459 (62%), Gaps = 1/459 (0%)

Query: 18  DLPGYLLLDSGASTSIIRHSSLLHFPQ-QPIHIGVQDAQDNPIPISSTGILKFHFANGPP 76
           D   + L+DSGA+ +++ + +LLH P      I +  + ++ IP +  G +    ++   
Sbjct: 212 DTSKHFLIDSGAALTVVNNKNLLHNPHPSSTKISIASSANHDIPFTLEGTILLRLSDNST 271

Query: 77  VKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYL 136
           ++I A  +P I  +L+S  +L+  G++ D     L   + +  A ++ H  F WL  +Y 
Sbjct: 272 IEIPAFYAPTITNNLLSTHDLEQHGLFLDTRLNILYAANGSSKANVITHNAFRWLPFRYA 331

Query: 137 MLPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTF 196
           + P+   +  IN++L ++  + IHRL GH+N++ +  SI+    ++I   +IDWS    F
Sbjct: 332 IFPSTVPSTTINSLLTKYPLDLIHRLLGHINVQSLYKSIKNKTFQHIELSDIDWSNLAQF 391

Query: 197 QCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQS 256
           QC DCL+GKS QH H VGSRVK+Q +Y  FE+LH+DL GP+ +  T + ++FISFTDE +
Sbjct: 392 QCVDCLQGKSRQHSHVVGSRVKHQEKYTKFEYLHSDLLGPITSTSTQTKSWFISFTDEAT 451

Query: 257 RFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGI 316
           R+RWV+ L  K  +T+    +++++    QF + VL FQ DRGSEFTN  +R +  E+GI
Sbjct: 452 RYRWVYRLTDKRDTTILHNLKSLISLIRNQFKSNVLAFQFDRGSEFTNTAVRFYLAESGI 511

Query: 317 QPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTY 376
              YTSVGD +AHG+AERLN TL++DCRTLL+++ L  HLWFY+V+FATL+RN++ N T 
Sbjct: 512 STFYTSVGDHQAHGIAERLNLTLMNDCRTLLKTTNLPHHLWFYAVQFATLLRNSVYNDTI 571

Query: 377 KTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVP 436
           ++              TILPFGQ VI H T    KL  RG  G+AL PS  S+GY IY+P
Sbjct: 572 QSSARAKANLPGIDVKTILPFGQPVIAHFTKLKTKLKYRGEQGFALVPSSTSYGYNIYIP 631

Query: 437 HLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIA 475
              KV+DT+NY VIRS  +I+ + +YD T+FD ++  + 
Sbjct: 632 KTGKVIDTTNYAVIRSTVHINPNQDYDDTIFDDVINQLT 670

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score =  392 bits (1007), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/488 (40%), Positives = 295/488 (60%), Gaps = 15/488 (3%)

Query: 16  EFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFANGP 75
           E  L  Y++LDSG   S+++    +          +  A +  +P+ ++G + F + N  
Sbjct: 448 EPSLDDYVILDSGEEVSVVKDPKYIFCKNMNPIDKLFGAGNEELPVEASGTMAFKWLNKQ 507

Query: 76  PVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKY 135
              I   +S    Y+L+S + L  AG+  D     L +K + V+A L   GP+  +   +
Sbjct: 508 SHSIRVLASKAATYNLVSWNALIKAGVIIDTRRSRLINKSDEVLAPLEMIGPYMCIHINH 567

Query: 136 LMLPARSRNH---------RINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYD 186
           L+LP  S            R++N+  +   EF+HR FGHVN+K I+ S+ KG+I+NI+ D
Sbjct: 568 LLLPLGSTQKKSKGKISTSRVHNVSEKIPVEFLHRFFGHVNVKDIRKSVEKGMIQNITAD 627

Query: 187 NIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPT 246
            IDW G D FQC +CL GK  +HKH VGSR+KYQ+ +  F+++HTDLFGP+ ++  ++PT
Sbjct: 628 KIDWRGIDKFQCKECLAGKMRRHKHTVGSRLKYQQFFEPFQYIHTDLFGPMSDVSATTPT 687

Query: 247 YFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAE 306
           YFISF DE +RFRWV+PLRSK A  +  VFR +V    TQF TKV  FQMDRGSE+ N  
Sbjct: 688 YFISFVDENTRFRWVYPLRSKSAEHILLVFRKLVNFIRTQFSTKVKAFQMDRGSEYRNEL 747

Query: 307 IRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATL 366
           +  FF + GI+  Y +  DS ++GVAER N   L+DCRTLL+++ L  ++W+++VEFATL
Sbjct: 748 LDDFFIDKGIKSIYNTAADSASNGVAERTNLLFLNDCRTLLKATNLPNNMWYHAVEFATL 807

Query: 367 IRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSK 426
           IRN ++N++                 TILPFGQ V+ H+ +   KL  RG  G+AL PSK
Sbjct: 808 IRNTMINSSINDSPRAKAGLEGLDIKTILPFGQEVVVHNHDTDSKLKPRGDLGFALCPSK 867

Query: 427 ESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDDFLNDTS 486
           ES GYLIYVP  HKV+DT+NY +++   + +  +N  +TVFD L+      Y++F++++ 
Sbjct: 868 ESFGYLIYVPSKHKVIDTTNYAIVK--YSAAPVNNQVATVFDSLLSD----YNEFVSESH 921

Query: 487 APALIDDN 494
             A  DD+
Sbjct: 922 TFADADDH 929

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%)

Query: 744  PKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLM 801
            P  RR +H ++++K A    P     S+++ +AIS N+N  +++LY  AY KE+ Q++
Sbjct: 1106 PTTRRGVHLVHAIKAARYKRPPTNKPSLNFWEAISDNENEDDRKLYLNAYGKEIGQIL 1163

>NCAS0A05800 Chr1 (1141745..1142704) [960 bp, 319 aa] {ON} 
          Length = 319

 Score =  363 bits (932), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 177/318 (55%), Positives = 234/318 (73%), Gaps = 1/318 (0%)

Query: 916  LEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVFGKKH 975
            L KSLYGLKQSGANWY+NIK YL +DCG+  I+GWP  FKN+D+ +CLFVDD+I+F K+ 
Sbjct: 3    LNKSLYGLKQSGANWYDNIKNYLIKDCGLKGIKGWPRVFKNDDVTICLFVDDMIMFTKEF 62

Query: 976  KKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIP 1035
            K    ++  LK  Y+TK++ DG  +  E  +YDILGLEI Y R + +  GMEKSL +KIP
Sbjct: 63   KYANQIIDCLKKSYDTKIIMDGNSKINELVEYDILGLEIEYTRGRKMLCGMEKSLTEKIP 122

Query: 1036 SLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDL 1095
            SL   LN+  R++ AP QPG  + D  +DM+E EY  +VK MQKL+GLASY+GYK+R+DL
Sbjct: 123  SLNTPLNTAGRKINAPYQPGFKIEDKDIDMNETEYNTRVKKMQKLIGLASYVGYKFRFDL 182

Query: 1096 LYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFAN 1155
            LYYIN+LAQHTLYP+ QVL LT+QLIQY+WDTR+++L   K K +   R+ AITDA+FA 
Sbjct: 183  LYYINVLAQHTLYPTYQVLDLTHQLIQYMWDTRDQKLK-WKKKSKKVNRLVAITDASFAG 241

Query: 1156 QPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITG 1215
            Q  YKSQ+G F  +N KII ARSTK  LTC+SSTE+E+Y +S  +PL+NS++ L+     
Sbjct: 242  QELYKSQLGIFYSLNGKIIGARSTKIKLTCVSSTEAEIYGVSESVPLVNSLEQLISETDN 301

Query: 1216 NQVKNKLITDSAPAISII 1233
               K  ++TDS+P +SI+
Sbjct: 302  KTCKKSILTDSSPTVSIV 319

>Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 398

 Score =  356 bits (913), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 176/371 (47%), Positives = 239/371 (64%), Gaps = 7/371 (1%)

Query: 6   PLGSPNHVDDEFD-LPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISST 64
           P   PNHV    D LP + L+DSGAS ++IR  + LH       I +  AQ   IPI++ 
Sbjct: 8   PKFKPNHVGHPNDELPNHFLIDSGASQTLIRTVNHLHSASPNDSISLHGAQKQEIPINAI 67

Query: 65  GILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLK 124
           G L F+F N     I+A  +PNI YDL+SL EL    I A F+  +L   D  ++A ++K
Sbjct: 68  GNLYFNFQNNVQTSITALHTPNITYDLLSLSELASQNITACFTKNTLEQSDGTILAPIVK 127

Query: 125 HGPFYWLSTKYLMLPARSRNHRINNI-----LPRFSFEFIHRLFGHVNIKIIKDSIRKGL 179
           HG FYWLS  +L +P+  +   +NN        ++ +  IHR+ GH N   I+ S++   
Sbjct: 128 HGDFYWLSKDFL-IPSTLQKQTVNNFNTSKSTHKYPYPLIHRVLGHANTITIRHSLKNSS 186

Query: 180 IKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPN 239
           I  +   ++DWS   T+QC DCL GKST+H++  GSR+KYQ  Y  F++LHTD+FGPV +
Sbjct: 187 ITYLKESDVDWSNPITYQCLDCLLGKSTKHRYVKGSRLKYQESYQPFQYLHTDIFGPVHH 246

Query: 240 MPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRG 299
           +P S+P+YFISFTDE++RF+WV+PL ++   ++  VF   +A    QF+ KVLV QM R 
Sbjct: 247 LPKSAPSYFISFTDEKTRFKWVYPLLNRREQSILDVFTKKIAFIDNQFNAKVLVVQMGRD 306

Query: 300 SEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFY 359
           SE+TN  +  FF E GI PCYT+  DSRAHG+AERLNRTLLDDCRT L+SSGL  HLWF 
Sbjct: 307 SEYTNKSLHTFFMERGITPCYTTTADSRAHGIAERLNRTLLDDCRTHLQSSGLPNHLWFL 366

Query: 360 SVEFATLIRNA 370
           +VEF T+IRN+
Sbjct: 367 AVEFFTIIRNS 377

>TPHA0H01270 Chr8 (284616..288713) [4098 bp, 1365 aa] {ON} 
          Length = 1365

 Score =  373 bits (957), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 242/340 (71%), Gaps = 3/340 (0%)

Query: 746  QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
            +R+RIHY++++K+  N  P+    S+SY +AIS N++V+++ LY  AY KELD+L K  T
Sbjct: 1029 KRKRIHYLHAIKYQTNITPT--RDSLSYSEAISKNRDVKQRNLYIAAYRKELDRLYKMQT 1086

Query: 806  WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
            WD S ++DV+ +   +IINSM IFT KRDGTHK R+VARGDQQ AGTYD++ I+NT+H+ 
Sbjct: 1087 WDESTLHDVENIPKHQIINSMFIFTEKRDGTHKYRYVARGDQQKAGTYDENAISNTVHNS 1146

Query: 866  ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
            ALMTCMAIAL+   FI QLDISSA+LYADL EELYIR PPH+  +NK+++L+KSLYGLKQ
Sbjct: 1147 ALMTCMAIALETKQFITQLDISSAHLYADLDEELYIRPPPHINLQNKVYRLQKSLYGLKQ 1206

Query: 926  SGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVFGKKHKKCMDLVQLL 985
            SGANWY NIK +LT +C +  ++ WPC F N    VCLFVDD++VF     +    ++LL
Sbjct: 1207 SGANWYNNIKTFLTHECNLQEVKLWPCVFYNGTFRVCLFVDDMVVFADDITQTESFIELL 1266

Query: 986  KLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEK 1045
            + +Y+TKV+N G   K+  R YD+LGL I Y    S+SFGMEK L +K+  + + +    
Sbjct: 1267 QTKYDTKVINLGNEVKSIIR-YDMLGLNIEYHFGSSISFGMEKVLTEKLEKMNIAIRKAG 1325

Query: 1046 RRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLAS 1085
            +     GQPG+ +SD  ++M E  Y + V+ +Q++ GLAS
Sbjct: 1326 KLAWVAGQPGLYISDEDIEMEEEHYLQDVEWLQRITGLAS 1365

 Score =  372 bits (954), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/492 (40%), Positives = 294/492 (59%), Gaps = 37/492 (7%)

Query: 15  DEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ----DAQDNPIPISSTGILKFH 70
           +  D   YL++DSGA  ++++  +LL    Q IH   +     A +  +    +G L+F 
Sbjct: 386 ENLDADDYLIIDSGAEITVVKDETLL----QNIHPNTKHVLYGAGNQKLSAPVSGTLQFT 441

Query: 71  FANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYW 130
           F      ++ +  S  + Y+LISL +L+  G+  D   R+L DK+NNV+ +L        
Sbjct: 442 FTKNKRYQVHSLVSSEVDYNLISLYQLEKTGLVVDTKHRTLEDKNNNVLCSLTD------ 495

Query: 131 LSTKYLMLPARSRNHRINNI-------LPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNI 183
              KY+ +P      +I  I          F+ +FIH L GH+NI+ IK +I + LI+ I
Sbjct: 496 -IDKYVAIPISCLTSQIKKIQQLSTEFTKPFTMQFIHDLLGHINIRDIKRTIDRKLIRGI 554

Query: 184 SYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTS 243
             D ++WSG D FQC  CL+GKST+ +H + SR+KYQ  Y  FE++HTD+FGP+ ++P S
Sbjct: 555 EPDKVNWSGIDKFQCKYCLQGKSTKRRHTIDSRIKYQINYEPFEYIHTDIFGPLHHLPAS 614

Query: 244 SPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFT 303
           +P  FI+FTDE +RFRWVF + +K ++T+T +FR ++    TQF TK+  FQMDRGSE+T
Sbjct: 615 TPDSFITFTDENTRFRWVFAINNKSSNTITAIFRKLINLIHTQFGTKIKCFQMDRGSEYT 674

Query: 304 NAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEF 363
           N EI   F + GI+  Y +VGDS ++GVAER N T L+DCRTLL ++ L   +WF++V+F
Sbjct: 675 NHEIDDLFCKYGIRKIYNTVGDSASNGVAERTNLTFLNDCRTLLHATNLPNTVWFHAVKF 734

Query: 364 ATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALT 423
           A L+RNA+   T K               TILPFG  VI H+ N   KL +RG  GYAL 
Sbjct: 735 AVLMRNAICTAT-KNSPRASAGLLGLDIKTILPFGTPVIVHEPNAKSKLAIRGRDGYALC 793

Query: 424 PSKESHGYLIYVPHLHKVLDTSNY-VVIRSDTNISADHNYDSTVFDPLMQSIA--RPYDD 480
           PS+ S+GYLIY+P LH+++D+S+Y +V R+D+  + D N    +FD L+ +    +PY  
Sbjct: 794 PSEVSYGYLIYIPSLHRIVDSSSYKLVSRTDSLSTPDKN----IFDELLLTAHEDKPY-- 847

Query: 481 FLNDTSAPALID 492
                S P +ID
Sbjct: 848 -----SPPDIID 854

>NDAI0B00750 Chr2 (169331..170407) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score =  333 bits (855), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 237/337 (70%), Gaps = 10/337 (2%)

Query: 927  GANWYENIKKYLTEDCGMSNIRGWPCAF-KNED---LIVCLFVDDIIVFGKKHKKCMDLV 982
            GANWY+ IK +LT+   M+ + GWPC F K +D   LI+CLFVDD+I+F   +K   D +
Sbjct: 3    GANWYKLIKGFLTDKLNMTEVLGWPCVFMKRKDKQVLIICLFVDDMILFTNSNKMATDAI 62

Query: 983  QLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLN 1042
            +LLK R+ TKV+NDGK        YDILG+EI Y ++ S+ FGMEKSLE+K+P+LG+ L+
Sbjct: 63   ELLKTRFATKVINDGKGNTINK--YDILGMEIEYVKNHSMKFGMEKSLEEKLPTLGIDLS 120

Query: 1043 SEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINIL 1102
               +  K PG PG+I+    + +++ EY +KVK MQ+++GLASY+GYKYR+DLLYYIN+L
Sbjct: 121  ---KLRKVPGTPGLIIEKEDIKVTKQEYNQKVKWMQQIIGLASYVGYKYRFDLLYYINVL 177

Query: 1103 AQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQ-RVTAITDAAFANQPGYKS 1161
            A+HTLYPS  V+ L  +LIQY+W+TR ++LIW K+   NT  ++  I DA+FANQ  +KS
Sbjct: 178  ARHTLYPSGTVIQLAKELIQYLWNTRGRKLIWLKSNNSNTHNKLDIICDASFANQENFKS 237

Query: 1162 QVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNK 1221
            Q G+ I +N+ II   S+K+T+TC SSTE+ELY++S  IP    +  L++ I    ++ K
Sbjct: 238  QYGHIIKLNDNIIAGTSSKSTITCSSSTEAELYSVSQAIPQFELLTALVKEIEDKTIELK 297

Query: 1222 LITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVK 1258
            LI+DS P I+ + + DE  ++ K++  R +++++E+K
Sbjct: 298  LISDSQPGIASMKNNDEKIMKKKFYAIRLLRLKEEIK 334

>Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -
           TyB Gag-Pol protein [contig 416] FULL
          Length = 542

 Score =  339 bits (869), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/448 (40%), Positives = 254/448 (56%), Gaps = 20/448 (4%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 10  PQMFLIDSGASFSIFSNSKFF-TELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 66

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 67  KLEAYLSPDIFCDIISTTQLEQFGIYPNFEMRSLRTQEGIEVAKLIRYQAVYWLSTD--- 123

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   +NNI           +   E +H    H+N+K I+ S+  GLIK++   ++
Sbjct: 124 --VAAQFKHVNNIRGMKSLIKPGRKIPLEILHESLSHINVKYIRKSVELGLIKDVKISDV 181

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYF 248
           DWS  + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YF
Sbjct: 182 DWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYF 241

Query: 249 ISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIR 308
           I+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R
Sbjct: 242 ITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTR 301

Query: 309 HFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIR 368
            F    GI   YTSVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF++V+ A   R
Sbjct: 302 MFLANEGIDAYYTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWFHAVKTACNHR 361

Query: 369 NALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHVRGHHGYALTPSKE 427
           N+L N T  T               +  FGQ  + HD + +  KL  R   GY L  S+ 
Sbjct: 362 NSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKERSIPGYILHKSET 421

Query: 428 SHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           S+G LIY+P   +V+DT NY +I + +N
Sbjct: 422 SYGSLIYIPSTGRVVDTQNYNLIENHSN 449

>Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 457] FULL
          Length = 641

 Score =  340 bits (873), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/448 (40%), Positives = 255/448 (56%), Gaps = 20/448 (4%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 75  PQMFLMDSGASFSIFSNSKFF-TELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 131

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 132 KLEAYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLSTD--- 188

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   INNI           +   E +H    H+N+K I+ S+  GLIK+++  ++
Sbjct: 189 --VATKCKHINNIRGIKSLIKPGRKIPLEILHESLSHINVKYIRKSVELGLIKDVTISDV 246

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYF 248
           DWS  + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YF
Sbjct: 247 DWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYF 306

Query: 249 ISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIR 308
           I+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R
Sbjct: 307 ITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTR 366

Query: 309 HFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIR 368
            F    GI   YTSVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF++V+ A   R
Sbjct: 367 MFLANEGIDAYYTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWFHAVKTACNHR 426

Query: 369 NALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHVRGHHGYALTPSKE 427
           N+L N T  T               +  FGQ  + HD + +  KL  R   GY L  S+ 
Sbjct: 427 NSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKERSIPGYILHKSET 486

Query: 428 SHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           S+G LIY+P   +V+DT NY +I + +N
Sbjct: 487 SYGSLIYIPSTGRVVDTQNYNLIENHSN 514

>Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A -
           Ty ORF [contig 372] FULL
          Length = 734

 Score =  338 bits (867), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/448 (40%), Positives = 253/448 (56%), Gaps = 20/448 (4%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 75  PQMFLMDSGASFSIFSNSKFF-TELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 131

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 132 KLEAYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLSTD--- 188

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   INNI           +   E +H    H+N+K I+ S+  GLIK++   ++
Sbjct: 189 --VATKCKHINNIRGIKSLIKPGRKIPLEILHESLSHINVKYIRKSVELGLIKDVKISDV 246

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYF 248
           DW   + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YF
Sbjct: 247 DWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYF 306

Query: 249 ISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIR 308
           I+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R
Sbjct: 307 ITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTR 366

Query: 309 HFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIR 368
            F    GI   YTSVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF++V+ A   R
Sbjct: 367 MFLANEGIDAYYTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWFHAVKTACNHR 426

Query: 369 NALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHVRGHHGYALTPSKE 427
           N+L N T  T               +  FGQ  + HD + +  KL  R   GY L  S+ 
Sbjct: 427 NSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKERSIPGYILHKSET 486

Query: 428 SHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           S+G LIY+P   +V+DT NY +I + +N
Sbjct: 487 SYGSLIYIPSTGRVVDTQNYNLIENHSN 514

>Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON}
           YBL101W-B - TyB Gag-Pol protein [contig 696] FULL
          Length = 865

 Score =  341 bits (875), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/448 (40%), Positives = 254/448 (56%), Gaps = 20/448 (4%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI I+  GI++ +   G  V
Sbjct: 10  PQMFLIDSGASFSIFSNSKFF-TELYPVETDDEMFDAQDQPIAITGKGIIELNL--GRVV 66

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 67  KLEAYLSPDIFCDIISTTQLEQFGIYPNFEMRSLRTQEGIEVAKLIRYQAVYWLSTD--- 123

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   +NNI           +   E +H    H+N+K I+ S+  GLIK++   ++
Sbjct: 124 --VAAQFKHVNNIRGMKSLIKPGRKIPLEILHESLSHINVKYIRKSVELGLIKDVKISDV 181

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYF 248
           DWS  + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YF
Sbjct: 182 DWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYF 241

Query: 249 ISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIR 308
           I+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R
Sbjct: 242 ITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTR 301

Query: 309 HFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIR 368
            F    GI   YTSVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF++V+ A   R
Sbjct: 302 MFLANEGIDAYYTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWFHAVKTACNHR 361

Query: 369 NALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHVRGHHGYALTPSKE 427
           N+L N T  T               +  FGQ  + HD + +  KL  R   GY L  S+ 
Sbjct: 362 NSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKERSIPGYILHKSET 421

Query: 428 SHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           S+G LIY+P   +V+DT NY +I + +N
Sbjct: 422 SYGSLIYIPSTGRVVDTQNYNLIENHSN 449

 Score =  226 bits (576), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 138/195 (70%), Gaps = 1/195 (0%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 665 KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 723

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
           WD S   D+  V   KI++SM IFTTK+DG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 724 WDLSNPIDMNLVPANKIVSSMFIFTTKKDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 783

Query: 866 ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
           AL  C+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQ
Sbjct: 784 ALTMCLAITLEKGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQ 843

Query: 926 SGANWYENIKKYLTE 940
           SGANWYE IK YLT+
Sbjct: 844 SGANWYEVIKNYLTK 858

>KAFR0K02290 Chr11 (467694..468593) [900 bp, 299 aa] {ON} 
          Length = 299

 Score =  318 bits (815), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 148/286 (51%), Positives = 202/286 (70%)

Query: 847  QQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPH 906
            QQ  GTYD++  ANT+HH ALM C++ ALDN+ +I QLDISSAYLYADL+EELYIRTPPH
Sbjct: 9    QQKFGTYDENATANTVHHYALMACLSQALDNNQYITQLDISSAYLYADLQEELYIRTPPH 68

Query: 907  LGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVD 966
            +G K K ++L KSLYGLKQSGANWY  IK YL +DC +  I GW C  KN+++IVCLFVD
Sbjct: 69   MGLKGKAYRLNKSLYGLKQSGANWYSTIKTYLQQDCKLLEIPGWSCVLKNDEIIVCLFVD 128

Query: 967  DIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGM 1026
            D++V        M+LV+ L+ +++TKVV  G++++     YDILGL+I YR  K +  GM
Sbjct: 129  DMVVMPSDLAYNMNLVKKLRKKFDTKVVKSGRLDQDGVAQYDILGLDIEYRYGKDMKMGM 188

Query: 1027 EKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASY 1086
            EK LE K+ +L V LN   +++K P  P   ++      +E  YK+ VK +Q +VGLASY
Sbjct: 189  EKILEAKLKTLDVPLNKSGKKLKVPSPPNTYITKEDYVTTEENYKKNVKWLQGIVGLASY 248

Query: 1087 LGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRL 1132
            + YKYR+D++ Y N+LAQHT + S  V  L  +++QY+WDT+ K++
Sbjct: 249  VCYKYRFDIMCYANVLAQHTPFSSKDVKQLAERMVQYLWDTKEKKI 294

>Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 345] FULL
          Length = 744

 Score =  331 bits (848), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 238/413 (57%), Gaps = 17/413 (4%)

Query: 53  DAQDNPIPISSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLR 112
           DAQD PI IS  GI++ +   G  +K+ A  SP+I  D+IS  +L+  GIY +F  RSLR
Sbjct: 3   DAQDQPIAISGKGIIELNL--GRVIKLEAYLSPDIFCDIISTIQLEQFGIYPNFEMRSLR 60

Query: 113 DKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILP---------RFSFEFIHRLF 163
            ++   +A L+++   YWLST        ++   INNI           +   E +H   
Sbjct: 61  TQEGLEVAKLIRYQAAYWLSTD-----VATKCKHINNIRGIKSLIKPGRKIPLEILHESL 115

Query: 164 GHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREY 223
            H+N+K I+ S+  GLIK++   ++DW   + F+C  C+ GK  +H H   SR  YQ +Y
Sbjct: 116 SHINVKYIRKSVELGLIKDVKISDVDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKY 175

Query: 224 NTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATF 283
              EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWVFPL  K    V  VFR ++A  
Sbjct: 176 ADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHI 235

Query: 284 GTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDC 343
             Q   KV   QMD+GSE+TN   R F    GI   YTSVGDS +HG+AERLN TL++DC
Sbjct: 236 ARQHGVKVKAIQMDKGSEYTNQSTRMFLANEGIDAYYTSVGDSSSHGIAERLNLTLMNDC 295

Query: 344 RTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVIT 403
           RT+L+ S +  HLWF++V+ A   RN+L N T  T               +  FGQ  + 
Sbjct: 296 RTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQPCMV 355

Query: 404 HDTNPI-DKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           HD + +  KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 356 HDYSALKKKLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 408

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (64%), Gaps = 1/117 (0%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 624 KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 682

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTI 862
           WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+
Sbjct: 683 WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTV 739

>TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score =  313 bits (803), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 197/299 (65%), Gaps = 1/299 (0%)

Query: 154 FSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYV 213
           +S +++HRLFGHVNIK IKDS +   I  I  D ++W+    FQ   C+ GKST+ +H +
Sbjct: 10  YSVDYLHRLFGHVNIKSIKDSTKDRSIAGIEVDEVNWTNLAKFQSEVCMAGKSTKGRHLM 69

Query: 214 GSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVT 273
            SR+KYQ+EY  F+F+HTDLFGPV     + P Y ++FTDE +R++WVFPLR KD+ ++T
Sbjct: 70  NSRLKYQKEYKPFQFIHTDLFGPVQVTAVNVPRYLLAFTDECTRYKWVFPLREKDSQSIT 129

Query: 274 TVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAE 333
             F  +V    TQ +TKVL FQMD+G+EFTN  I  FF +NGI   +T+VGDSR++GVAE
Sbjct: 130 ARFSELVRFIETQLETKVLCFQMDQGTEFTNKTITQFFHDNGIITRFTTVGDSRSNGVAE 189

Query: 334 RLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXT 393
           R N  LL+DCRTLL S  L   LWFY+V+FATL+RN+++ T+ K               T
Sbjct: 190 RTNLLLLNDCRTLLTSVKLPDDLWFYAVKFATLMRNSIVTTSTKESPRAKAGLTGLDIST 249

Query: 394 ILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHL-HKVLDTSNYVVIR 451
           +LPFGQ VI +      KLH RG  GYAL PS  S GYLIYVP     ++DT +Y  IR
Sbjct: 250 VLPFGQPVIVNKPKTSSKLHSRGWKGYALCPSSVSFGYLIYVPGAPQDIIDTRHYRAIR 308

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 733 EKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKA 792
           +++  +S + PP  ++RIHY    K+  ++       S+SY++AI+ N N   KE     
Sbjct: 540 DQDGTTSQESPPSSKQRIHYAQVTKN--HSETHAERPSLSYKEAITYNSNAEGKEKLIAG 597

Query: 793 YMKELDQLMK 802
           Y KE++QL+K
Sbjct: 598 YEKEINQLIK 607

>Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 159] FULL
          Length = 354

 Score =  301 bits (772), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 154/361 (42%), Positives = 215/361 (59%), Gaps = 19/361 (5%)

Query: 23  LLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPVKIS 80
            L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +K+ 
Sbjct: 2   FLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVIKLE 58

Query: 81  AASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPA 140
           A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST       
Sbjct: 59  AYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLSTD-----V 113

Query: 141 RSRNHRINNIL---------PRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWS 191
            ++   INNI           +   E +H    H+N+K I+ S+  GLIK+++  ++DWS
Sbjct: 114 ATKCKHINNIRGIKSLIKPGKKIPLEILHESLSHINVKYIRKSVELGLIKDVTISDVDWS 173

Query: 192 GFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISF 251
             + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YFI+F
Sbjct: 174 ELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYFITF 233

Query: 252 TDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFF 311
           TDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R F 
Sbjct: 234 TDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTRMFL 293

Query: 312 RENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNAL 371
              GI   YTSVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF++V+ A   RN+L
Sbjct: 294 ANEGIDAYYTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWFHAVKTACNHRNSL 353

Query: 372 L 372
           L
Sbjct: 354 L 354

>Kwal_20.2719 s20 complement(2073..3491) [1419 bp, 472 aa] {ON}
            YLR035C-A - Ty ORF [contig 316] FULL
          Length = 472

 Score =  300 bits (768), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 203/306 (66%), Gaps = 5/306 (1%)

Query: 746  QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
            +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 158  KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 216

Query: 806  WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
            WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 217  WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 276

Query: 866  ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
            AL  C+AIAL+    I QLDI+SAYLYA L++ELYI+ P H   ++K+F+L KSLYGLKQ
Sbjct: 277  ALTMCLAIALEQGWTIRQLDITSAYLYAPLRKELYIKEPLHCELRDKVFELNKSLYGLKQ 336

Query: 926  SGANWYENIKKYLTEDCGMSNIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDL 981
            SGANWYE IK YLT  CG+S I+ WPC      K + L+V LFV+D+IV     +   +L
Sbjct: 337  SGANWYEVIKNYLTNTCGLSEIKQWPCVLVKKRKEDTLVVNLFVNDMIVMTSNDELYNEL 396

Query: 982  VQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTL 1041
            +  L+  +ETKVV +G  EK E   YD LGLEI Y++  S+  GM+K++  K+P L ++L
Sbjct: 397  LVQLQKEFETKVVAEGSHEKDEFAKYDTLGLEIEYKKDDSMLIGMDKTIIDKLPKLELSL 456

Query: 1042 NSEKRR 1047
              +K R
Sbjct: 457  QEKKVR 462

>Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A -
           Ty ORF [contig 245] FULL
          Length = 358

 Score =  293 bits (750), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 205/350 (58%), Gaps = 19/350 (5%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 10  PQMFLIDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 66

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 67  KLEAYLSPDIFCDIISTTQLEQFGIYPNFEMRSLRTQEGIEVAKLIRYQAVYWLSTD--- 123

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   +NNI           +   E +H    H+N+K I+ S+  GLIK++   ++
Sbjct: 124 --VAAQFKHVNNIRGMKSLIKPGRKIPLEILHESLSHINVKYIRKSVELGLIKDVKISDV 181

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYF 248
           DWS  + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YF
Sbjct: 182 DWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYF 241

Query: 249 ISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIR 308
           I+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R
Sbjct: 242 ITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTR 301

Query: 309 HFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWF 358
            F    GI   YTSVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF
Sbjct: 302 MFLANEGIDAYYTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWF 351

>Kwal_50.19415 s50 complement(2..922) [921 bp, 307 aa] {ON} YLR035C-A
            - Ty ORF [contig 328] PARTIAL
          Length = 307

 Score =  291 bits (744), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 150/275 (54%), Positives = 185/275 (67%), Gaps = 5/275 (1%)

Query: 746  QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
            +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 34   KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 92

Query: 806  WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
            WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 93   WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 152

Query: 866  ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
            AL TC+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQ
Sbjct: 153  ALTTCLAITLEQGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQ 212

Query: 926  SGANWYENIKKYLTEDCGMSNIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDL 981
            SGANWYE IK YLT  CG+S I+ WPC      K + L+V LFVDD+IV     +   +L
Sbjct: 213  SGANWYEVIKNYLTNTCGLSEIKQWPCVLVKKRKEDTLVVNLFVDDMIVMTSNDELYNEL 272

Query: 982  VQLLKLRYETKVVNDGKIEKAESRDYDILGLEITY 1016
            +  L+  +ETKVV +G  EK     YDILGLEI Y
Sbjct: 273  LVQLQKEFETKVVAEGTPEKDGFAKYDILGLEIEY 307

>Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 94] FULL
          Length = 478

 Score =  293 bits (750), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 206/357 (57%), Gaps = 15/357 (4%)

Query: 109 RSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNIL---------PRFSFEFI 159
           RSLR ++   +A L+++   YWLST        ++   INNI           +   E +
Sbjct: 2   RSLRTQEGLEVAKLIRYQAAYWLSTD-----VATKCKHINNIRGIKSLIKPGKKIPLEIL 56

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKY 219
           H    H+N+K I+ S+  GLIK+++  ++DWS  + F+C  C+ GK  +H H   SR  Y
Sbjct: 57  HESLSHINVKYIRKSVELGLIKDVTISDVDWSELEWFECESCMAGKGKRHNHIANSRDTY 116

Query: 220 QREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNI 279
           Q +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWVFPL  K    V  VFR +
Sbjct: 117 QEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 176

Query: 280 VATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTL 339
           +A    Q   KV   QMD+GSE+TN   R F    GI   YTSVGDS +HG+AERLN TL
Sbjct: 177 IAHIARQHGVKVKAIQMDKGSEYTNQSTRMFLANEGIDAYYTSVGDSSSHGIAERLNLTL 236

Query: 340 LDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQ 399
           ++DCRT+L+ S +  HLWF++V+ A   RN+L N T  T               +  FGQ
Sbjct: 237 MNDCRTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQ 296

Query: 400 HVITHDTNPI-DKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
             + HD + +  KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 297 PCMVHDYSALKKKLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 353

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  286 bits (733), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 148/337 (43%), Positives = 207/337 (61%), Gaps = 12/337 (3%)

Query: 15  DEFDLPGYLLLDSGASTSIIRHSSLLHF----PQQPIHIGVQDAQDNPIPISSTGILKFH 70
           +E ++  + +L+S A  S I  S  LH     P  P+      A +  IP++++G L FH
Sbjct: 82  NELNIDNFFVLNSAAEISPI-DSKFLHSRNDNPPDPLF----GAGNEEIPVAASGNLTFH 136

Query: 71  FANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSL-RDKDNNVIATLLKHGPFY 129
           + N     + A SSP++  +LIS D L+D GI  D   ++L R   + V+A + K G + 
Sbjct: 137 WLNNTSHSLYAISSPHVDLNLISTDALEDVGIIVDNRRKALVRLDSDEVLAPITKIGKYR 196

Query: 130 WLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNID 189
            +   +  LP             +F   F+HRLF H+N+K  + SI   LI NI  +++D
Sbjct: 197 CVPLSFGKLPKHKSPSPC--AFQKFPLTFVHRLFDHINVKDTRKSIESKLITNIRINDVD 254

Query: 190 WSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFI 249
           W+G D FQC DCL GK T+HKH VGSR+KYQ+ Y  FE++HTDLFGPV  +  +SP YFI
Sbjct: 255 WTGIDKFQCKDCLAGKLTKHKHIVGSRLKYQKYYEPFEYIHTDLFGPVSGVDITSPKYFI 314

Query: 250 SFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRH 309
           SFTDE +RFRWVFPL+ KDA  +  +F+ +V    TQF  +VL F MDRGSE+T+  +R 
Sbjct: 315 SFTDENTRFRWVFPLKKKDADHILPIFQQLVNYIKTQFKVRVLTFHMDRGSEYTSTMVRD 374

Query: 310 FFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTL 346
           +F+  GI P YT+VGDS ++G+AER N T L+DCRTL
Sbjct: 375 YFKVKGIIPIYTTVGDSSSNGIAERANLTFLNDCRTL 411

>Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A -
           TyA Gag protein [contig 364] PARTIAL
          Length = 604

 Score =  291 bits (745), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 146/357 (40%), Positives = 204/357 (57%), Gaps = 15/357 (4%)

Query: 109 RSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILP---------RFSFEFI 159
           RSLR ++   +A L+++   YWLST        ++   INNI           +   E +
Sbjct: 2   RSLRTQEGLEVAKLIRYQAAYWLSTD-----VATKCKHINNIRGIKSLIKPGRKIPLEIL 56

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKY 219
           H    H+N+K I+ S+  GLIK++   ++DW   + F+C  C+ GK  +H H   SR  Y
Sbjct: 57  HESLSHINVKYIRKSVELGLIKDVKISDVDWIELEWFECESCMAGKGKRHNHIANSRDTY 116

Query: 220 QREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNI 279
           Q +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWVFPL  K    V  VFR +
Sbjct: 117 QEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 176

Query: 280 VATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTL 339
           +A    Q   KV   QMD+GSE+TN   R F    GI   YTSVGDS +HG+AERLN TL
Sbjct: 177 IAHIARQHGVKVKAIQMDKGSEYTNQSTRMFLANEGIDAYYTSVGDSSSHGIAERLNLTL 236

Query: 340 LDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQ 399
           ++DCRT+L+ S +  HLWF++V+ A   RN+L N T  T               +  FGQ
Sbjct: 237 MNDCRTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQ 296

Query: 400 HVITHDTNPI-DKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
             + HD + +  KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 297 PCMVHDYSALKKKLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 353

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQN 782
           +R+RI+YI +++HA      +   S+ YRDAIS N N
Sbjct: 569 KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNN 604

>KNAG0E03750 Chr5 (743927..744811) [885 bp, 294 aa] {ON} 
          Length = 294

 Score =  279 bits (713), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 181/279 (64%)

Query: 158 FIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRV 217
            IHRL GH+N++ +  SI+    +++   +IDW     FQC D L+GKS QH H VGSRV
Sbjct: 15  LIHRLLGHINVQSLYKSIKNKTFQHLELSDIDWGNLAQFQCVDSLQGKSRQHSHIVGSRV 74

Query: 218 KYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFR 277
           K+Q +Y+ FE++H+DL G + +  T++  +FISFTDE  R+RWV+ +  K  +T+  + +
Sbjct: 75  KHQEKYSNFEYIHSDLLGQISSPSTNTKAWFISFTDEAIRYRWVYKITDKRDTTILHILK 134

Query: 278 NIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNR 337
           +++     QF   VL FQ DRGSEFTN  +R +  E GI   YTSVGD +A+GVAERLN 
Sbjct: 135 SLIDYIRNQFKGNVLAFQFDRGSEFTNNIVRTYLAEKGISTFYTSVGDHQANGVAERLNL 194

Query: 338 TLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPF 397
           TL++DCRTLL+++ L  HLWFY+V+FATL++N++ N T ++               ILPF
Sbjct: 195 TLMNDCRTLLKTTNLLYHLWFYAVQFATLLKNSVYNDTLQSSARAKAGLPGRDIKNILPF 254

Query: 398 GQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVP 436
           GQ VI H T    +L  RG  G+AL PS  S+GY IY+P
Sbjct: 255 GQPVIAHFTKLKTELKYRGEQGFALVPSSNSYGYQIYIP 293

>Kwal_33.15087 s33 complement(955836..956876) [1041 bp, 346 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 94] FULL
          Length = 346

 Score =  275 bits (702), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 174/256 (67%), Gaps = 5/256 (1%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 73  KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 131

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
           WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 132 WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 191

Query: 866 ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
           AL TC+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQ
Sbjct: 192 ALTTCLAITLEQGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQ 251

Query: 926 SGANWYENIKKYLTEDCGMSNIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDL 981
           SGANWYE IK YLT  CG+S I+ WPC      K + L+V LFVDD+IV     +   +L
Sbjct: 252 SGANWYEVIKNYLTNTCGLSEIKQWPCVLVKKRKEDTLVVNLFVDDMIVMTSNDELYNEL 311

Query: 982 VQLLKLRYETKVVNDG 997
           +  L+  +ETKVV +G
Sbjct: 312 LVQLQKEFETKVVAEG 327

>Kwal_14.773 s14 (35373..36359) [987 bp, 328 aa] {ON} YBL101W-B - TyB
            Gag-Pol protein [contig 245] FULL
          Length = 328

 Score =  271 bits (694), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 207/317 (65%), Gaps = 5/317 (1%)

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT 1040
            LVQL K  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++
Sbjct: 15   LVQLQK-EFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLS 73

Query: 1041 LNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYY 1098
            L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY
Sbjct: 74   LQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYY 132

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPG 1158
            +N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K++      + AITDA+ A Q  
Sbjct: 133  VNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSRIPEDIHIDAITDASHATQEE 192

Query: 1159 YKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQV 1218
            YKSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P L S++ +   + G + 
Sbjct: 193  YKSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALFNSLPKLKSLQEITAAL-GYKS 251

Query: 1219 KNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILT 1278
            +  + TDS   IS I   D +K RN++FG+++ ++R E      ++ YV+T +N ADILT
Sbjct: 252  QTTIYTDSQTVISSITKSDTSKFRNRFFGSKAFRLRQEYHAGEFQVAYVSTKDNTADILT 311

Query: 1279 KALPAKRFNDLTNVWMV 1295
            K L  K F  L   WM+
Sbjct: 312  KPLAVKIFQGLIENWMM 328

>Kwal_23.3719 s23 (402936..403922) [987 bp, 328 aa] {ON} YLR410W-B -
            TyB Gag-Pol protein [contig 254] FULL
          Length = 328

 Score =  268 bits (685), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 205/317 (64%), Gaps = 5/317 (1%)

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT 1040
            LVQL K  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++
Sbjct: 15   LVQLQK-EFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLS 73

Query: 1041 LNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYY 1098
            L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY
Sbjct: 74   LQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYY 132

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPG 1158
            +N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+       + AITDA+ A Q  
Sbjct: 133  VNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDINIDAITDASHATQEE 192

Query: 1159 YKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQV 1218
            YKSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P L S++ +   + G + 
Sbjct: 193  YKSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALFNSLPKLKSLQDITAAL-GYKS 251

Query: 1219 KNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILT 1278
            +  + TDS   IS I   D +K RN++FG+++ ++R E      ++ YV+T  N ADILT
Sbjct: 252  QTTIYTDSQTVISSITKTDTSKFRNRFFGSKAFRLRQEYDAGEFQVAYVSTKENTADILT 311

Query: 1279 KALPAKRFNDLTNVWMV 1295
            K L  K F  L   W+V
Sbjct: 312  KPLAVKIFQGLIENWIV 328

>Kwal_47.17030 s47 complement(215874..216860) [987 bp, 328 aa] {ON}
            YLR035C-A - Ty ORF [contig 215] FULL
          Length = 328

 Score =  265 bits (677), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 204/317 (64%), Gaps = 5/317 (1%)

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT 1040
            LVQL K  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++
Sbjct: 15   LVQLQK-EFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLS 73

Query: 1041 LNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYY 1098
            L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++ GL SY+ +K R+++ YY
Sbjct: 74   LQGKKERF-VPGQPGHILYLSNKELMMSKEEFDNKVNHLQRIGGLLSYITHKCRFEMAYY 132

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPG 1158
            +N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+       + AITDA+ A Q  
Sbjct: 133  VNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDINIDAITDASHATQEE 192

Query: 1159 YKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQV 1218
            YKSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P L S++ +   + G + 
Sbjct: 193  YKSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALFNSLPKLKSLQDITAAL-GYKS 251

Query: 1219 KNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILT 1278
            +  + TDS   IS I   D +K RN++FG+++ ++R E      ++ YV+T  N ADILT
Sbjct: 252  QTTIYTDSQTVISSITKTDTSKFRNRFFGSKAFRLRQEYDAGEFQVAYVSTKENTADILT 311

Query: 1279 KALPAKRFNDLTNVWMV 1295
            K L  K F  L   W+V
Sbjct: 312  KPLAVKIFQGLIENWIV 328

>NDAI0A01430 Chr1 (320300..321061) [762 bp, 253 aa] {ON}
          Length = 253

 Score =  257 bits (657), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 176/247 (71%), Gaps = 1/247 (0%)

Query: 1049 KAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLY 1108
            K PG PG+I+    + +++ EY +KVK MQ+++GLASY+GYKYR+DLLYYIN+LA+HTLY
Sbjct: 6    KVPGTPGLIIEKEDIKVTKQEYNQKVKWMQQIIGLASYVGYKYRFDLLYYINVLARHTLY 65

Query: 1109 PSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQ-RVTAITDAAFANQPGYKSQVGYFI 1167
            PS  V+ L  +LIQY+W+TR ++LIW K+   NT  ++  I DA+FANQ  +KSQ G+ I
Sbjct: 66   PSGTVIQLAKELIQYLWNTRGRKLIWLKSNNSNTHNKLNIICDASFANQENFKSQYGHII 125

Query: 1168 LVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSA 1227
             +N+ II   S+K+T+TC SSTE+ELY++S  IP    +  L++ I    ++ KLI+DS 
Sbjct: 126  KLNDNIIAGTSSKSTITCSSSTEAELYSVSQAIPQFELLTALVKEIEDKTIEPKLISDSQ 185

Query: 1228 PAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFN 1287
            P I+ + + DE  ++ K++  R +++++E+K   +KLEY+NT  NIADILTK LP K F 
Sbjct: 186  PGIASMKNNDEKIMKKKFYAIRLLRLKEEIKEKDIKLEYINTKENIADILTKPLPVKTFT 245

Query: 1288 DLTNVWM 1294
            +LT  W+
Sbjct: 246  ELTKDWI 252

>Kwal_39.16413 s39 (9645..10418) [774 bp, 257 aa] {ON} YER160C - TyB
           Gag-Pol protein [contig 372] FULL
          Length = 257

 Score =  250 bits (638), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 122/212 (57%), Positives = 148/212 (69%), Gaps = 1/212 (0%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 34  KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 92

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
           WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 93  WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 152

Query: 866 ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
           AL TC+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQ
Sbjct: 153 ALTTCLAITLEQGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQ 212

Query: 926 SGANWYENIKKYLTEDCGMSNIRGWPCAFKNE 957
           SGANWYE IK YLT  CG+S I+ WPC    E
Sbjct: 213 SGANWYEVIKNYLTNTCGLSEIKQWPCVLSEE 244

>Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 55] FULL
          Length = 310

 Score =  248 bits (632), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 116/266 (43%), Positives = 161/266 (60%), Gaps = 14/266 (5%)

Query: 109 RSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILP---------RFSFEFI 159
           RSLR ++   +A L+++   YWLST        ++   INNI           +   E +
Sbjct: 2   RSLRTQEGLEVAKLIRYQAAYWLST-----DVATKCKHINNIRGIKSLIKPGRKIPLEIL 56

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKY 219
           H    H+N+K I+ S+  GLIK++   ++DW   + F+C  C+ GK  +H H   SR  Y
Sbjct: 57  HESLSHINVKYIRKSVELGLIKDVKISDVDWIELEWFECESCMAGKGKRHNHIANSRDTY 116

Query: 220 QREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNI 279
           Q +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWVFPL  K    V  VFR +
Sbjct: 117 QEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 176

Query: 280 VATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTL 339
           +A    Q   KV   QMD+GSE+TN  IR F    GI   YTSVGDS +HG+A RLN TL
Sbjct: 177 IAHIARQHGVKVKAIQMDKGSEYTNQSIRMFLANEGIDTYYTSVGDSSSHGIAARLNLTL 236

Query: 340 LDDCRTLLESSGLSPHLWFYSVEFAT 365
           ++DCRT+L+ S +S HLWF++V+ A 
Sbjct: 237 MNDCRTILKGSKMSIHLWFHAVKAAC 262

>Kwal_9.621 s9 (2869..3753) [885 bp, 294 aa] {ON} YJL113W - TyB
           Gag-Pol protein [contig 351] FULL
          Length = 294

 Score =  246 bits (628), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 146/206 (70%), Gaps = 1/206 (0%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 78  KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 136

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
           WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 137 WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 196

Query: 866 ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
           AL TC+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQ
Sbjct: 197 ALTTCLAITLEQGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQ 256

Query: 926 SGANWYENIKKYLTEDCGMSNIRGWP 951
           SGANWYE IK YLT  CG+S I+ WP
Sbjct: 257 SGANWYEVIKNYLTNTCGLSEIKQWP 282

>Kwal_47.17031 s47 complement(216862..218613) [1752 bp, 583 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 215] FULL
          Length = 583

 Score =  251 bits (642), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 121/209 (57%), Positives = 147/209 (70%), Gaps = 1/209 (0%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 360 KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 418

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
           WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 419 WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 478

Query: 866 ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQ 925
           AL TC+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQ
Sbjct: 479 ALTTCLAITLEQGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQ 538

Query: 926 SGANWYENIKKYLTEDCGMSNIRGWPCAF 954
           SGANWYE IK YLT  CG+S I+ WPC  
Sbjct: 539 SGANWYEVIKNYLTNTCGLSEIKQWPCVL 567

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 82/137 (59%), Gaps = 1/137 (0%)

Query: 320 YTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTX 379
           YTSVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF++V+ A   RN+L N T  T 
Sbjct: 8   YTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGTS 67

Query: 380 XXXXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHVRGHHGYALTPSKESHGYLIYVPHL 438
                         +  FGQ  + HD + +  KL  R   GY L  S+ S+G LIY+P  
Sbjct: 68  PRSKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKERSIPGYILHKSETSYGSLIYIPST 127

Query: 439 HKVLDTSNYVVIRSDTN 455
            +V+DT NY +I + +N
Sbjct: 128 GRVVDTQNYNLIENHSN 144

>Kwal_54.19476 s54 (2448..3092) [645 bp, 215 aa] {ON} YBL101W-B - TyB
            Gag-Pol protein [contig 416] PARTIAL
          Length = 215

 Score =  231 bits (588), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 143/210 (68%), Gaps = 4/210 (1%)

Query: 817  VNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALD 876
            V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HEAL TC+AI L+
Sbjct: 4    VPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHEALTTCLAITLE 63

Query: 877  NDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKK 936
                I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLKQSGANWYE IK 
Sbjct: 64   QGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLKQSGANWYEVIKN 123

Query: 937  YLTEDCGMSNIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETK 992
            YLT  CG+S I+ WPC      K + L+V LFVDD+IV     +   +L+  L+  +ETK
Sbjct: 124  YLTNTCGLSEIKQWPCVLVKKRKEDTLVVNLFVDDMIVMTSNDELYNELLVQLQKEFETK 183

Query: 993  VVNDGKIEKAESRDYDILGLEITYRRSKSL 1022
            VV +G  EK     YDILGLEI Y++   +
Sbjct: 184  VVAEGTPEKDGFAKYDILGLEIEYKKDDKM 213

>TDEL0H00110 Chr8 (2134..3018) [885 bp, 294 aa] {ON} 
          Length = 294

 Score =  233 bits (593), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 113/195 (57%), Positives = 145/195 (74%), Gaps = 6/195 (3%)

Query: 738 SSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKEL 797
           +S + PP  ++RIHY    K+  ++       S+SY++AI+ N N  EKE +  AY KE+
Sbjct: 103 TSQESPPSSKQRIHYAQVTKN--HSETHAERPSLSYKEAITYNSNAEEKENFIAAYEKEI 160

Query: 798 DQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSL 857
           +QL+K NTW+  +  + ++V   +I+N+M IFTTKRDGT KCRFVARGDQQ      ++L
Sbjct: 161 NQLLKMNTWEKDQPIEARDVRKNRILNTMFIFTTKRDGTKKCRFVARGDQQKP----ENL 216

Query: 858 IANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLE 917
            ANT+H+ ALMTCMAIALDNDMFI QLDISSAYLYA+LKEELYIR PPHL  K+K+ +L 
Sbjct: 217 QANTVHNYALMTCMAIALDNDMFITQLDISSAYLYAELKEELYIRAPPHLRLKDKVLRLN 276

Query: 918 KSLYGLKQSGANWYE 932
           KSLYGLKQSGANWY+
Sbjct: 277 KSLYGLKQSGANWYQ 291

>Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 691] FULL
          Length = 524

 Score =  239 bits (609), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 177/321 (55%), Gaps = 19/321 (5%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 210 PQMFLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 266

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 267 KLEAYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLSTD--- 323

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   INNI           +   E +H    H+N+K I+ S+  GLIK++   ++
Sbjct: 324 --VATKCKHINNIRGIKSLIKPGRKIPLEILHESLSHINVKYIRKSVELGLIKDVKISDV 381

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYF 248
           DW   + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YF
Sbjct: 382 DWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYF 441

Query: 249 ISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIR 308
           I+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R
Sbjct: 442 ITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTR 501

Query: 309 HFFRENGIQPCYTSVGDSRAH 329
            F    GI   YT +  +R H
Sbjct: 502 MFLANEGIDAYYTLLLVTRLH 522

>Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 328] FULL
          Length = 348

 Score =  231 bits (588), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 153/255 (60%), Gaps = 1/255 (0%)

Query: 202 LKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWV 261
           + GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWV
Sbjct: 1   MAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWV 60

Query: 262 FPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYT 321
           FPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R F    GI   YT
Sbjct: 61  FPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTRMFLANEGIDAYYT 120

Query: 322 SVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXX 381
           SVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF++V+ A   RN+L N T  T   
Sbjct: 121 SVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGTSPR 180

Query: 382 XXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHVRGHHGYALTPSKESHGYLIYVPHLHK 440
                       +  FGQ  + HD + +  KL  R   GY L  S+ S+G LIY+P   +
Sbjct: 181 SKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKERSIPGYILHKSETSYGSLIYIPSTGR 240

Query: 441 VLDTSNYVVIRSDTN 455
           V+DT NY +I + +N
Sbjct: 241 VVDTQNYNLIENHSN 255

>Smik_89.1 Chr89 complement(2..754) [753 bp, 251 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 251

 Score =  226 bits (577), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 158/250 (63%), Gaps = 8/250 (3%)

Query: 11  NHVDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFH 70
           NH DDE  LPG+LLLDSGAS ++IR    +H       I V DAQ   IPI++ G L+FH
Sbjct: 5   NHYDDE--LPGHLLLDSGASRTLIRSVHHIHSASPNPDINVVDAQKRNIPINAVGDLQFH 62

Query: 71  FANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYW 130
           F +     I    +PNI YDL+SL+EL    I A F+   L   D  V+A ++K+G FYW
Sbjct: 63  FQDDTKTSIKVLHTPNIAYDLLSLNELAAIDITACFTKNVLERADGTVLAPIVKYGDFYW 122

Query: 131 LSTKYLMLPARSRNHRINNI-----LPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISY 185
           +S KYL LP+      INN+       ++ + FIHR+  H N + I+ S++K  I   + 
Sbjct: 123 VSKKYL-LPSNISIPTINNVHTSERTHKYPYPFIHRMLAHANAQTIRYSLKKNTITYFNE 181

Query: 186 DNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSP 245
            ++DWS    +QCPDCL GKST+H+H  GSR+KYQ  Y  F++LHTD+FGPV N+P S+P
Sbjct: 182 SDVDWSSATNYQCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAP 241

Query: 246 TYFISFTDEQ 255
           +YFISFTDE+
Sbjct: 242 SYFISFTDEK 251

>Kwal_13.689 s13 complement(1951..2763) [813 bp, 271 aa] {ON}
            YLR410W-B - TyB Gag-Pol protein [contig 696] PARTIAL
          Length = 271

 Score =  219 bits (557), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/259 (45%), Positives = 170/259 (65%), Gaps = 5/259 (1%)

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT 1040
            LVQL K  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++
Sbjct: 15   LVQLQK-EFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLS 73

Query: 1041 LNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYY 1098
            L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY
Sbjct: 74   LQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYY 132

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPG 1158
            +N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+       + AITDA+ A Q  
Sbjct: 133  VNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDINIDAITDASHATQEE 192

Query: 1159 YKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQV 1218
            YKSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P L S++ +   + G + 
Sbjct: 193  YKSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALYNSLPKLKSLQDITAAL-GYKS 251

Query: 1219 KNKLITDSAPAISIINSQD 1237
            +  + TDS   IS I   D
Sbjct: 252  QTTIYTDSQTVISSITKTD 270

>Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 206] FULL
          Length = 625

 Score =  230 bits (586), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/255 (44%), Positives = 152/255 (59%), Gaps = 1/255 (0%)

Query: 202 LKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWV 261
           + GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWV
Sbjct: 1   MAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWV 60

Query: 262 FPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYT 321
           FPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R F    GI   YT
Sbjct: 61  FPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTRMFLANEGIDAYYT 120

Query: 322 SVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXX 381
           SVGDS +HG+AERLN TL++DCRT+L+ S +  HLW ++V+ A   RN+L N T  T   
Sbjct: 121 SVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWSHAVKTACNHRNSLFNPTLGTSPR 180

Query: 382 XXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHVRGHHGYALTPSKESHGYLIYVPHLHK 440
                       +  FGQ  + HD + +  KL  R   GY L  S+ S+G LIY+P   +
Sbjct: 181 SKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKERSIPGYILHKSETSYGSLIYIPSTGR 240

Query: 441 VLDTSNYVVIRSDTN 455
           V+DT NY +I + +N
Sbjct: 241 VVDTQNYNLIENHSN 255

 Score =  139 bits (349), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (64%), Gaps = 1/139 (0%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 471 KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 529

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
           WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 530 WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 589

Query: 866 ALMTCMAIALDNDMFIVQL 884
           AL TC+AI L+    I QL
Sbjct: 590 ALTTCLAITLEQGWTIKQL 608

>Kwal_2.424 s2 (2177..2896) [720 bp, 239 aa] {ON} YBL101W-B - TyB
           Gag-Pol protein [contig 305] FULL
          Length = 239

 Score =  216 bits (550), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 108/236 (45%), Positives = 141/236 (59%), Gaps = 1/236 (0%)

Query: 202 LKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWV 261
           + GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWV
Sbjct: 1   MAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWV 60

Query: 262 FPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYT 321
           FPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R F    GI   YT
Sbjct: 61  FPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTRMFLANEGIDAYYT 120

Query: 322 SVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXX 381
           SVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF++V+ A   RN+L N T  T   
Sbjct: 121 SVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGTSPR 180

Query: 382 XXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHVRGHHGYALTPSKESHGYLIYVP 436
                       +  FGQ  + HD + +  KL  R   GY L  S+ S+G LIY+P
Sbjct: 181 SKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKERSIPGYILHKSETSYGSLIYIP 236

>Kwal_13.685 s13 complement(731..1438) [708 bp, 235 aa] {ON} YLR410W-B
            - TyB Gag-Pol protein [contig 292] FULL
          Length = 235

 Score =  210 bits (535), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 153/223 (68%), Gaps = 4/223 (1%)

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT 1040
            LVQL K  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++
Sbjct: 15   LVQLQK-EFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLS 73

Query: 1041 LNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYY 1098
            L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY
Sbjct: 74   LQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYY 132

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPG 1158
            +N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+       + AITDA+ A Q  
Sbjct: 133  VNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDINIDAITDASHATQEE 192

Query: 1159 YKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIP 1201
            YKSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P
Sbjct: 193  YKSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALYNSLP 235

>Kpol_414.5 s414 (15737..19603) [3867 bp, 1289 aa] {ON} (15737..19603)
            [3867 nt, 1289 aa]
          Length = 1289

 Score =  231 bits (590), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 166/552 (30%), Positives = 288/552 (52%), Gaps = 27/552 (4%)

Query: 745  KQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHN 804
            K+ R + Y   V H +         SM Y +AI++N N++ ++L+++AY KELD L +  
Sbjct: 734  KKNRPLQYEVPVVHTIR--------SMYYNEAITNNTNMKTRKLFQEAYQKELDNLKRML 785

Query: 805  TWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHH 864
             +D        +V  ++II    IF  KRDGTHK R V RGD+Q A TY   +  + +  
Sbjct: 786  VFDIQMGIPRNQVPKEQIIPVQTIFNVKRDGTHKARIVCRGDKQTASTY-GVITTDLLQM 844

Query: 865  EALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLK 924
            + L   + IA +N M +  LDI+ A+LYADL+E +YI   PH     K+ +L K+LYGLK
Sbjct: 845  DTLKLLLMIANNNRMVVQTLDINHAFLYADLQEVIYI---PHPYEPRKVVQLNKALYGLK 901

Query: 925  QSGANWYENIKKYLTEDCGMSNIRGWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLV 982
            QS   W ++++KYL  +C + +    P  F N +  +I+ ++VDD I+  K +      +
Sbjct: 902  QSPKEWNDHLRKYLN-NCSLYDTEYTPGLFMNNEKSIIIAVYVDDCIIAAKNNIILKKFI 960

Query: 983  QLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLN 1042
              +K  +E K+V  G +EK   +  DILG+++ Y  +K     +  SLE  + S+     
Sbjct: 961  NKMKETFELKIV--GTMEKGILKT-DILGMDLDYDITKG---EISLSLETYLKSIENDWI 1014

Query: 1043 SEKRRMKAPGQPGIILSDSKLD----MSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYY 1098
             E   +K    P     D K      +SE   K   K +Q + G+ +Y+  + RYD+ + 
Sbjct: 1015 DEINYIKFDNSPHWSSYDKKTKGIPILSEIRKKEITKNLQIMAGIINYILTRCRYDIAFA 1074

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPG 1158
             N LA+    P+ Q + + +++++Y++ T++++LI+ + +  +  ++  +TDA+   +  
Sbjct: 1075 ANKLARSVNTPNEQSIKIAHKILKYLFTTKDRKLIY-RRETGSKPKINIVTDASLGTEWD 1133

Query: 1159 YKSQVGYFILVNNKIITARSTKATLTCISSTESELYAI-SMVIPLLNSIKMLMETITGNQ 1217
            YKS++G  +     +    S   T   +SSTE+EL AI           K+L +    N 
Sbjct: 1134 YKSRIGIMVWYGRNLYKVISRATTSIRVSSTEAELDAIYEGFKEGKLLKKVLEKLKILNN 1193

Query: 1218 VKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADIL 1277
            +   + TDS P+I  +N    +K R+K+   +  K+ ++V+ + + +E +    N+ADIL
Sbjct: 1194 IDINIFTDSKPSIQFLNKDYRSKKRDKFIDLKLAKLSEQVRENIIAIEKIPGVTNVADIL 1253

Query: 1278 TKALPAKRFNDL 1289
            TK +   +F  +
Sbjct: 1254 TKPVTTIQFKKI 1265

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 173/419 (41%), Gaps = 26/419 (6%)

Query: 55  QDNPIPISSTGILKFHFANG-PPVKISAASSPNIRYDLISLDEL-DDAGI-----YADFS 107
           +++PI I   G L+    N    +K      P     ++S+  L +D G      Y   +
Sbjct: 16  ENHPITIKGEGFLQIKIDNSNKTIKTKVYFCPYESATVLSIATLQEDTGYELERGYKFLT 75

Query: 108 TRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPRF---------SFEF 158
              LR K + V  TL       W+++  L++    +N   +N   R          S + 
Sbjct: 76  NNILRIKVSKVDKTL-------WINSNNLLVKNEIKNKTTSNKTVRVVTNKTKKKVSIQE 128

Query: 159 IHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVK 218
            H  F H++  ++K +I  G+  ++       +    +QC DCL+GK   H HY GS   
Sbjct: 129 AHAKFNHIDKNVVKATIESGIFADVDGLKETSTEIAQYQCEDCLRGKLKTHNHYTGSMNA 188

Query: 219 YQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRN 278
           +            DL GP+     + P Y +   D  SR+  +     K + ++      
Sbjct: 189 HYVNVLPGASWSIDLRGPIVRSHKNVPHYLLVMVDNVSRYMMISTHLDKSSQSIPRQIIK 248

Query: 279 IVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRT 338
            +     QFD KV     DRG+EF N+ ++ F    GI+   T   D  ++G  ER    
Sbjct: 249 NIHLIENQFDRKVKELITDRGTEFNNSVLKEFIDGRGIKWILTDTDDHASNGRVERYIGV 308

Query: 339 LLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLN--TTYKTXXXXXXXXXXXXXXTILP 396
           L  D RTL+  S L   LW Y+   AT  RN  LN  T                  +++P
Sbjct: 309 LNADLRTLMIQSQLPWKLWKYAAMAATDSRNTSLNKMTGQTPFNMISGNSEPLLYKSLIP 368

Query: 397 FGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           FGQ     D   I K  ++G    AL    ES GY  Y+P   K++ TS++ ++++ TN
Sbjct: 369 FGQKAFVKDHKKI-KTGLQGLEALALCKDPESRGYYFYLPETRKIVTTSSFSLLKAQTN 426

>Kwal_34.16313 s34 (283644..284327) [684 bp, 228 aa] {ON} YAR009C -
            TyB Gag-Pol protein [contig 710] PARTIAL
          Length = 228

 Score =  208 bits (529), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 149/215 (69%), Gaps = 4/215 (1%)

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT 1040
            LVQL K  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++
Sbjct: 15   LVQLQK-EFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLS 73

Query: 1041 LNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYY 1098
            L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY
Sbjct: 74   LQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYY 132

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPG 1158
            +N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+       + AITDA+ A Q  
Sbjct: 133  VNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDINIDAITDASHATQEE 192

Query: 1159 YKSQVGYFILVNNKIITARSTKATLTCISSTESEL 1193
            YKSQ+GYF  VN  II ARST++T++CISSTE+EL
Sbjct: 193  YKSQLGYFYKVNGHIIFARSTRSTISCISSTEAEL 227

>NDAI0G00400 Chr7 (78577..79731,79733..84067) [5490 bp, 1829 aa] {ON} 
          Length = 1829

 Score =  226 bits (577), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 163/531 (30%), Positives = 293/531 (55%), Gaps = 23/531 (4%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            S+  RDAI++N+NV EK  +++A  KE++  ++  T D +   + +EV   ++I    IF
Sbjct: 1286 SIYLRDAITNNKNVEEKIKFKQALQKEINSFIQTKTIDPTIKLNKREVPGDQVIPIQPIF 1345

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
              KRDGT+K R VARGD Q+  +Y D +  + ++ E+L   + +AL+ ++ I  +DI+ A
Sbjct: 1346 DIKRDGTYKARIVARGDLQSDESYGD-IDTSLLNMESLKLFLILALEKELTIRTMDINHA 1404

Query: 890  YLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRG 949
            +LYAD++E+LYI+ P     ++KI  L KS+YGLKQS  NW + ++ ++ ++ G+ +   
Sbjct: 1405 FLYADIEEKLYIQHP---QDRSKITPLYKSIYGLKQSPKNWNDTLRTFMNKN-GLYDTEY 1460

Query: 950  WPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDY 1007
             P  + NED  +++  +VDD ++  K  +    ++ + +  +  K+V   K  +  +   
Sbjct: 1461 SPGFYTNEDRSVMIAAYVDDTVIAAKSEEDIDKIIIMFQKEFTLKIVGTMKNNRLST--- 1517

Query: 1008 DILGLEITY---RRSKSLSF-GMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSD--S 1061
            DILGL++ Y       +LS  G  + + ++ P +       KR+ K P       +    
Sbjct: 1518 DILGLDLEYDLNTGQATLSLNGYIQRMMKEFPEIQT-----KRKFKTPFPSEYKYNPIYE 1572

Query: 1062 KLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLI 1121
            K D +E E K KVK +Q++VG  +Y+  + R D+ +    +A+ T  P ++V     ++I
Sbjct: 1573 KSDFNENEMKDKVKKLQQIVGKITYIRSRGRLDIEFAAAKVARLTKLPHSKVFEWVERII 1632

Query: 1122 QYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKA 1181
            +Y+  TR+ +L   K  ++   ++T I+DA+ A +  YKS++G  I   N +I ++S + 
Sbjct: 1633 KYLDQTRDLKLTLKKDIQK-CPKLTMISDASVATEYDYKSRIGVHIWYGNNLILSQSKQT 1691

Query: 1182 TLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKL 1241
            T TC SS E+ELY I+    +   +K  +E IT  ++   +I+D  PA+  I  Q   K 
Sbjct: 1692 TKTCNSSPEAELYGINYGTLMALMLKEKIEKITRRKILVDVISDCQPALDWI-KQPYMKT 1750

Query: 1242 RNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDLTNV 1292
            R K       ++R+E + +++ L  ++   N+AD  TK + A++F  L N+
Sbjct: 1751 RKKPILIPLTRLREEFEKNNINLFKISGVENVADEHTKVVTAEKFKTLINI 1801

 Score =  145 bits (367), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 118/440 (26%), Positives = 191/440 (43%), Gaps = 20/440 (4%)

Query: 45  QPIHIGVQDAQDNPIPISSTGILKFHFANGPPVKISAASSPNIRYDLISLDEL-DDAGIY 103
           +P   GV   + N I I+  G LK          +    +P     ++S   L D  G  
Sbjct: 462 RPTFFGV--GEGNAIKITGKGKLKIKTNTNKTDYLPVFYAPKEDATILSAICLRDKVGFT 519

Query: 104 ADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPR-----FSFEF 158
            D + R L++K N ++   + +   +      L +P   +  RI  + P        ++ 
Sbjct: 520 IDSNYRYLKNK-NFLVPMKIVNKTLWVHHEDILTVPTTQKVRRITPMNPTAINKTIEYKE 578

Query: 159 IHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVK 218
            H+   H + + I +SI+KG+  ++     D +  +  +C  CL GKST+H HY G+   
Sbjct: 579 AHQRLSHASSQAIIESIKKGIFADVK----DITNSENTECEICLLGKSTRHNHYKGAMNY 634

Query: 219 YQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRN 278
           + ++         D+FGPV     ++P Y +   D  SR+       +KD  T+      
Sbjct: 635 HYKDKEPGYSWSLDIFGPVATNVPNNPKYMLVMIDSVSRYLITSFHTTKDKITIGNQIEK 694

Query: 279 IVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRT 338
            +     QF+  V   +MDRG+EF N  ++      GI P YTS  D   +  AER+ RT
Sbjct: 695 NINRIEKQFERTVKELRMDRGTEFHNEYLQGILNGLGIVPIYTSTQDHAGNARAERVIRT 754

Query: 339 LLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTX--XXXXXXXXXXXXXTILP 396
           +  D RTLL  + +S   W Y+   AT +RN + N   KT                + +P
Sbjct: 755 ISGDIRTLLTQTTMSQRFWHYAARAATEVRNCIYNKQIKTSPVKLVSKPNIEIYLRSFIP 814

Query: 397 FGQ-HVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPH--LHKVLDTSNYVVIRSD 453
           FG   VI   T   +K    G+   AL  + E  GY+ +VP    HK++ T+NY ++  +
Sbjct: 815 FGAPAVIWQPTK--NKQKPTGYIARALCKNIEGDGYVFFVPQGKSHKIIPTNNYTILNPN 872

Query: 454 TNISADHNYDSTVFDPLMQS 473
              +   +YD    D L Q+
Sbjct: 873 NIETKTKDYDQFYKDILHQN 892

>Kwal_47.19348 s47 (1201985..1202794) [810 bp, 269 aa] {ON} YJL113W -
            TyB Gag-Pol protein [contig 297] PARTIAL
          Length = 269

 Score =  205 bits (521), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 105/261 (40%), Positives = 164/261 (62%), Gaps = 4/261 (1%)

Query: 1026 MEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVGL 1083
            MEK++ +  P LG+++  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VGL
Sbjct: 5    MEKTIIENYPKLGLSVQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGL 63

Query: 1084 ASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQ 1143
             SY+ +K R+++ YY+N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+      
Sbjct: 64   LSYITHKCRFEMAYYVNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDI 123

Query: 1144 RVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLL 1203
             + AITDA+ A Q  YKSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P L
Sbjct: 124  NIDAITDASHATQEEYKSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALYNSLPKL 183

Query: 1204 NSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLK 1263
             S++ +   + G + +  + TDS   IS I   D +K RN++FG+++ ++R E      +
Sbjct: 184  KSLQDITAAL-GYKSQTTIYTDSQTVISSITKTDTSKFRNRFFGSKAFRLRQEYDAGEFQ 242

Query: 1264 LEYVNTDNNIADILTKALPAK 1284
            + YV+ +        KA   K
Sbjct: 243  VAYVSDEGKYGRYTNKATGRK 263

>Kpol_1066.31 s1066 complement(53055..53135,53139..53381) [324 bp,
           108 aa] {ON} complement(53055..53135,53139..53381) [324
           nt, 108 aa]
          Length = 108

 Score =  196 bits (498), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 98/109 (89%), Positives = 103/109 (94%), Gaps = 1/109 (0%)

Query: 25  LDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFANGPPVKISAASS 84
           LDSGASTSIIRHSSLLHFPQQPIHI VQDAQDN IPISSTGILKFHF NGP VKISAA+S
Sbjct: 1   LDSGASTSIIRHSSLLHFPQQPIHIRVQDAQDNSIPISSTGILKFHFDNGPQVKISAAAS 60

Query: 85  PNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLST 133
           PNI YDLISLDELD+AGIYAD STRSLRDK+NNVIAT++KHGPFYWLST
Sbjct: 61  PNIYYDLISLDELDNAGIYAD-STRSLRDKNNNVIATIVKHGPFYWLST 108

>Kwal_39.16415 s39 (10712..11407) [696 bp, 231 aa] {ON} YAR009C - TyB
            Gag-Pol protein [contig 372] FULL
          Length = 231

 Score =  201 bits (510), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 149/231 (64%), Gaps = 1/231 (0%)

Query: 1065 MSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYI 1124
            MS+ E+  KV  +Q++VGL SY+ +K R+++ YY+N+LAQHTL+P ++V  L  Q +QY+
Sbjct: 2    MSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYYVNVLAQHTLFPCDEVFDLALQCVQYL 61

Query: 1125 WDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLT 1184
            W  ++K+L W K+       + AITDA+ A Q  YKSQ+GYF  VN  II ARST++T++
Sbjct: 62   WTNKHKKLTWIKSNIPGDINIDAITDASHATQEEYKSQLGYFYKVNGHIIFARSTRSTIS 121

Query: 1185 CISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNK 1244
            CISSTE+EL A+   +P L S++ +   + G + +  + TDS   IS I   D +K RN+
Sbjct: 122  CISSTEAELNALYNSLPKLKSLQDITAAL-GYKSQTTIYTDSQTVISSITKTDTSKFRNR 180

Query: 1245 YFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDLTNVWMV 1295
            +FG+++ ++R E      ++ YV+T  N ADILTK L  K F  L   W+V
Sbjct: 181  FFGSKAFRLRQEYDAGEFQVAYVSTKENTADILTKPLAVKIFQGLIENWIV 231

>TPHA0B03640 Chr2 complement(851392..854469) [3078 bp, 1025 aa] {ON} 
          Length = 1025

 Score =  218 bits (554), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 150/528 (28%), Positives = 279/528 (52%), Gaps = 21/528 (3%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            ++ ++ AI++N +VRE++L+ +A+ KEL  L+K   +D S      +V   +II    IF
Sbjct: 478  TLYFKTAITNNTDVRERKLFSEAFEKELQNLLKMQVFDTSISIPRNQVPANRIIPLQTIF 537

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
            T KRDGTHK R V RGD+Q   TY +    + +  + L   + IA +  M+I  LDI+ A
Sbjct: 538  TVKRDGTHKARIVCRGDKQTEATYSN-YHTDLLQIDTLKLFLMIANNRKMWIQTLDINHA 596

Query: 890  YLYADLKEELYIRTPPHLGHKNK-IFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIR 948
            +LYADL+EE+Y+  P    H  + +  L+K+LYGLKQS   W E++KK+L     + + R
Sbjct: 597  FLYADLREEIYVPLP----HDRRFVTPLKKALYGLKQSPKEWNEHLKKFLNS-IDLDDSR 651

Query: 949  GWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRD 1006
              P  F+N D  +++ ++VDD ++  K  +   + V  L+ R+E K++  GK+ +   R 
Sbjct: 652  HTPGIFRNHDYSIMIAVYVDDCVIAAKSQELLDEFVSTLRNRFELKII--GKMNQGILR- 708

Query: 1007 YDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKL--- 1063
             D+LG+++ Y   +     +  SL+  I S+      +   +K    P +   +  +   
Sbjct: 709  TDVLGMDLDYNIDEG---KISLSLQSYIESIENDWLDKISHIKTTSIPHVSSYEHNIKNI 765

Query: 1064 -DMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQ 1122
              M      +K+  +QK+ G+ +Y+  + RYD+ +  N LA+   +P++ V  +  +L+ 
Sbjct: 766  DSMDTKTRSKKINELQKINGVINYIRSRCRYDVEFAANKLARSVNFPADNVFYMADKLMN 825

Query: 1123 YIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKAT 1182
            YI+ T+++++++ +    N   +T ++DA+   +   KS++G  +     +    S  ++
Sbjct: 826  YIFQTKSEKIVFTRETTDNPA-ITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASS 884

Query: 1183 LTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKL-ITDSAPAISIINSQDETKL 1241
                SSTE+EL AI         +K ++E +   +    + ITDS P+I  + +   +  
Sbjct: 885  AVRNSSTEAELDAIYEGSKEAYYLKKILEEMNLQKDPTVISITDSKPSIQYLKNNYNSNR 944

Query: 1242 RNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
            R+++   +  K+ + ++   L +  +   +NIAD+LTK +  + F  L
Sbjct: 945  RDRFLDLKLAKLEERIRADDLLIYKIAGTDNIADVLTKPVSCEDFKKL 992

 Score =  107 bits (267), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 110/251 (43%), Gaps = 5/251 (1%)

Query: 208 QHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSK 267
           QH H   S  K+  +    +    D+ GP+   P     Y +   D  SRF  V    +K
Sbjct: 3   QHDHIKDSMNKHYEQMQPGQSWSLDIRGPLGKNPAKVDNYLLLMVDNVSRFLLVSTHTNK 62

Query: 268 DASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSR 327
           +  T++   +N +     Q+D  V    +DRGSEFTN  ++ +  E GI+   T   D  
Sbjct: 63  NKETISLQIKNNIQYIEKQYDRIVKELIVDRGSEFTNDSLKTYVSEKGIKLMLTDTNDHA 122

Query: 328 AHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTX--XXXXXX 385
           ++  AER    + +D RTL+ +S L   LW Y+   A  IRN  +               
Sbjct: 123 SNARAERFIGIMNNDIRTLMHNSDLPWALWKYAALAAARIRNLFMTKKLNCSPMTTLSGK 182

Query: 386 XXXXXXXTILPFGQHV-ITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDT 444
                  + LPFG H  + + TN  +KL  +G     L     S GYL Y+P   KV+ T
Sbjct: 183 NEQIRFNSFLPFGAHAFVKNQTN--NKLTNQGIPAITLCKDPNSFGYLFYLPQTRKVIST 240

Query: 445 SNYVVIRSDTN 455
            +Y++  S+ N
Sbjct: 241 MSYILANSEVN 251

>TPHA0O01190 Chr15 (230494..232602) [2109 bp, 702 aa] {ON} 
          Length = 702

 Score =  213 bits (542), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 149/528 (28%), Positives = 278/528 (52%), Gaps = 21/528 (3%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            ++ ++ AI++N +VRE++L+ +A+ KEL  L+K   +D S      +V   +II    IF
Sbjct: 155  TLYFKTAITNNTDVRERKLFSEAFEKELQNLLKMQVFDTSISIPRNQVPANRIIPLQTIF 214

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
            T KRDGTHK R V RGD+Q   TY +    + +  + L   + IA +  M+I  LDI+ A
Sbjct: 215  TVKRDGTHKARIVCRGDKQTEATYSN-YHTDLLQIDTLKLFLMIANNRKMWIQTLDINHA 273

Query: 890  YLYADLKEELYIRTPPHLGHKNK-IFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIR 948
            +LYADL+EE+Y+  P    H  + +  L+K+LYGLKQS   W E++KK+L     + + R
Sbjct: 274  FLYADLREEIYVPLP----HDRRFVTPLKKALYGLKQSPKEWNEHLKKFLNS-IDLDDSR 328

Query: 949  GWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRD 1006
              P  F+N D  +++ ++VDD ++  K  +   +    L+ R+E K++  GK+ +   R 
Sbjct: 329  HTPGIFRNHDYSIMIAVYVDDCVIAAKSQELLDEFGSTLRNRFELKII--GKMNQGILRT 386

Query: 1007 YDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKL--- 1063
             D+LG+++ Y   +     +  SL+  I S+      +   +K    P +   +  +   
Sbjct: 387  -DVLGMDLDYNIDEG---KISLSLQSYIESIENDWLDKISHIKTTSIPHVSSYEHNIKNI 442

Query: 1064 -DMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQ 1122
              M      +K+  +QK+ G+ +Y+  + RYD+ +  N LA+   +P++ V  +  +L+ 
Sbjct: 443  DSMDTKTRSKKINELQKINGVINYIRSRCRYDIEFAANKLARSVNFPADNVFYMADKLMN 502

Query: 1123 YIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKAT 1182
            YI+ T+++++++ +    N   +T ++DA+   +   KS++G  +     +    S  ++
Sbjct: 503  YIFQTKSEKIVFTRETTDNPA-ITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASS 561

Query: 1183 LTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKL-ITDSAPAISIINSQDETKL 1241
                SSTE+EL AI         +K ++E +   +    + ITDS P+I  + +   +  
Sbjct: 562  AVRNSSTEAELDAIYEGSKEAYYLKKILEEMNLQKDPTVISITDSKPSIQYLKNNYNSNR 621

Query: 1242 RNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
            R+++   +  K+ + ++   L +  +   +NIAD+LTK +  + F  L
Sbjct: 622  RDRFLDLKLAKLEERIRADDLLIYKIAGTDNIADVLTKPVSCEDFKKL 669

>TPHA0P01400 Chr16 complement(285031..289965) [4935 bp, 1644 aa] {ON} 
          Length = 1644

 Score =  217 bits (553), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 151/528 (28%), Positives = 279/528 (52%), Gaps = 21/528 (3%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            ++ ++ AI++N +VRE++L+ +A+ KEL  L+K   +D S      +V   +II    IF
Sbjct: 1113 TLYFKTAITNNTDVRERKLFSEAFEKELQNLLKMQVFDTSISIPRNQVPANRIIPLQTIF 1172

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
            T KRDGTHK R V RGD+Q   TY +    + +  + L   + IA +  M+I  LDI+ A
Sbjct: 1173 TVKRDGTHKARIVCRGDKQTEATYSN-YHTDLLQIDTLKLFLMIANNRKMWIQTLDINHA 1231

Query: 890  YLYADLKEELYIRTPPHLGHKNK-IFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIR 948
            +LYADL+EE+Y+  P    H  + +  L+K+LYGLKQS   W E++KK+L     + + R
Sbjct: 1232 FLYADLREEIYVPLP----HDRRFVTPLKKALYGLKQSPKEWNEHLKKFLNS-IDLDDSR 1286

Query: 949  GWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRD 1006
              P  F+N D  +++ ++VDD ++  K  +   + V  L+ R+E K++  GK+ +   R 
Sbjct: 1287 HTPGIFRNHDYSIMIAVYVDDCVIAAKSQELLDEFVSTLRNRFELKII--GKMNQGILRT 1344

Query: 1007 YDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKL--- 1063
             D+LG+++ Y   +     +  SL+  I S+      +   +K    P +   +  +   
Sbjct: 1345 -DVLGMDLDYNIDEG---KISLSLQSYIESIENDWLDKISHIKTTSTPHVSSYEHNIKNI 1400

Query: 1064 -DMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQ 1122
              M      +K+  +QK+ G+ +Y+  + RYD+ +  N LA+   +P++ V  +  +L+ 
Sbjct: 1401 DSMDTKTRSKKINELQKINGVINYIRSRCRYDVEFAANKLARSVNFPADNVFYMADKLMN 1460

Query: 1123 YIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKAT 1182
            YI+ T++++L++ +    N   +T ++DA+   +   KS++G  +     +    S  ++
Sbjct: 1461 YIFQTKSEKLVFTRETTDNPA-ITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASS 1519

Query: 1183 LTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKL-ITDSAPAISIINSQDETKL 1241
                SSTE+EL AI         +K ++E +   +    + ITDS P+I  + +   +  
Sbjct: 1520 AVRNSSTEAELDAIYEGSKEAYYLKKILEEMNLQKDPTVISITDSKPSIQYLKNNYNSNR 1579

Query: 1242 RNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
            R+++   +  K+ + ++   L +  +   +NIAD+LTK +  + F  L
Sbjct: 1580 RDRFLDLKLAKLEERIRADDLLIYKIAGTDNIADVLTKPVSCEDFKKL 1627

 Score =  123 bits (309), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 104/396 (26%), Positives = 160/396 (40%), Gaps = 29/396 (7%)

Query: 111 LRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKI 170
           L  KDN     L K     W+       P+ S N++        +    H    H+ + +
Sbjct: 553 LSSKDNRTSEKLTKASSIRWIK------PSTSFNNKT------VTIHEAHERSNHLPVDV 600

Query: 171 IKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLH 230
           I  +I      +++  N+  S    F C  C + K  QH H   S  K+  +    +   
Sbjct: 601 IVHNIENNAFSDVNKINLKKSELINFYCEQCAQAKMKQHDHIKDSMNKHYEQMQPGQSWS 660

Query: 231 TDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTK 290
            D+ GP+         Y +   D  SRF  V    +K+  T++   +N +     Q+D  
Sbjct: 661 LDIRGPLGKNLAKVDNYLLLMVDNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRI 720

Query: 291 VLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESS 350
           V    +DRGSEFTN  ++ +  E GI+   T   D  ++  AER    + +D RTL+ +S
Sbjct: 721 VKELIVDRGSEFTNDSLKTYVSEKGIKLMLTDTNDHASNARAERFIGIMNNDIRTLMHNS 780

Query: 351 GLSPHLWFYSVEFATLIRNALLNTTYKTX--XXXXXXXXXXXXXTILPFGQHV-ITHDTN 407
            L   LW Y+   A  IRN  +                      + LPFG H  + + TN
Sbjct: 781 DLPWALWKYAALAAARIRNLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTN 840

Query: 408 PIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVF 467
             +KL  +G     L     S GYL Y+P   KV+ T +Y++  S+ N            
Sbjct: 841 --NKLTNQGIPAITLCKDPNSFGYLFYLPQTRKVISTMSYILANSEVN--------GDFI 890

Query: 468 DP--LMQSIARPYDDFLNDTSAPALIDDNSSEPDNS 501
           DP  ++  I    DD    TS  AL  +  +EP N+
Sbjct: 891 DPNKVLSEIVPDNDDTNEVTSEDAL--EIEAEPSNA 924

>TPHA0K02100 Chr11 (449107..454023) [4917 bp, 1638 aa] {ON} 
          Length = 1638

 Score =  216 bits (550), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 150/528 (28%), Positives = 279/528 (52%), Gaps = 21/528 (3%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            ++ ++ AI++N +VRE++L+ +A+ KEL  L+K   +D S      +V   +II    IF
Sbjct: 1091 TLYFKTAITNNTDVRERKLFSEAFEKELQNLLKMQVFDTSISIPRNQVPANRIIPLQTIF 1150

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
            T KRDGTHK R V RGD+Q   TY +    + +  + L   + IA +  M+I  LDI+ A
Sbjct: 1151 TVKRDGTHKARIVCRGDKQTEATYSN-YHTDLLQIDTLKLFLMIANNRKMWIQTLDINHA 1209

Query: 890  YLYADLKEELYIRTPPHLGHKNK-IFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIR 948
            +LYADL+EE+Y+  P    H  + +  L+K+LYGLKQS   W E++KK+L     + + R
Sbjct: 1210 FLYADLREEIYVPLP----HDRRFVTPLKKALYGLKQSPKEWNEHLKKFLNS-IDLDDSR 1264

Query: 949  GWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRD 1006
              P  F+N D  +++ ++VDD ++  K  +   + V  L+ R+E K++  GK+ +   R 
Sbjct: 1265 HTPGIFRNHDYSIMIAVYVDDCVIAAKSQELLDEFVSTLRNRFELKII--GKMNQGILR- 1321

Query: 1007 YDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKL--- 1063
             D+LG+++ Y   +     +  SL+  I S+      +   +K    P +   +  +   
Sbjct: 1322 TDVLGMDLDYNIDEG---KISLSLQSYIESIENDWLDKISHIKTTSIPHVSSYEHNIKNI 1378

Query: 1064 -DMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQ 1122
              M      +K+  +QK+ G+ +Y+  + RYD+ +  N LA+   +P++ V  +  +L+ 
Sbjct: 1379 DSMDTKTRSKKINELQKINGVINYIRSRCRYDIEFAANKLARSVNFPADNVFYMADKLMN 1438

Query: 1123 YIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKAT 1182
            YI+ T+++++++ +    N   +T ++DA+   +   KS++G  +     +    S  ++
Sbjct: 1439 YIFQTKSEKIVFTRETTDNPA-ITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASS 1497

Query: 1183 LTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKL-ITDSAPAISIINSQDETKL 1241
                SSTE+EL AI         +K ++E +   +    + ITDS P+I  + +   +  
Sbjct: 1498 AVRNSSTEAELDAIYEGSKEAYYLKKILEEMNLQKDPTVISITDSKPSIQYLKNNYNSNR 1557

Query: 1242 RNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
            R+++   +  K+ + ++   L +  +   +NIAD+LTK +  + F  L
Sbjct: 1558 RDRFLDLKLAKLEERIRADDLLIYKIAGTDNIADVLTKPVSCEDFKKL 1605

 Score =  124 bits (312), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 104/396 (26%), Positives = 161/396 (40%), Gaps = 29/396 (7%)

Query: 111 LRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKI 170
           L  KDN     L K     W+       P+ S N++        +    H    H+ + +
Sbjct: 531 LSSKDNRTSEKLTKASSIRWIK------PSTSFNNKT------VTIHEAHERSNHLPVDV 578

Query: 171 IKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLH 230
           I  +I      +++  N+  S    F C  C++ K  QH H   S  K+  +    +   
Sbjct: 579 IVHNIENNAFSDVNKINLKKSELINFYCEQCVQAKMKQHDHIKDSMNKHYEQMQPGQSWS 638

Query: 231 TDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTK 290
            D+ GP+         Y +   D  SRF  V    +K+  T++   +N +     Q+D  
Sbjct: 639 LDIRGPLGKNLAKVDNYLLLMVDNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRI 698

Query: 291 VLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESS 350
           V    +DRGSEFTN  ++ +  E GI+   T   D  ++  AER    + +D RTL+ +S
Sbjct: 699 VKELIVDRGSEFTNDSLKTYVSEKGIKLMLTDTNDHASNARAERFIGIMNNDIRTLMHNS 758

Query: 351 GLSPHLWFYSVEFATLIRNALLNTTYKTX--XXXXXXXXXXXXXTILPFGQHV-ITHDTN 407
            L   LW Y+   A  IRN  +                      + LPFG H  + + TN
Sbjct: 759 DLPWALWKYAALAAARIRNLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTN 818

Query: 408 PIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVF 467
             +KL  +G     L     S GYL Y+P   KV+ T +Y++  S+ N            
Sbjct: 819 --NKLTNQGIPAITLCKDPNSFGYLFYLPQTRKVISTMSYILANSEVN--------GDFI 868

Query: 468 DP--LMQSIARPYDDFLNDTSAPALIDDNSSEPDNS 501
           DP  ++  I    DD    TS  AL  +  +EP N+
Sbjct: 869 DPNKVLSEIVPDNDDTNEVTSEDAL--EIEAEPSNA 902

>Kwal_9.616 s9 (909..1952) [1044 bp, 347 aa] {ON} YLR410W-B - TyB
           Gag-Pol protein [contig 351] FULL
          Length = 347

 Score =  196 bits (498), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 151/274 (55%), Gaps = 19/274 (6%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 75  PQMFLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 131

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 132 KLEAYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLSTD--- 188

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   INNI           +   E +H    H+N+K I+ S+  GLIK++   ++
Sbjct: 189 --VATKCKHINNIRGIKSLIKPGRKIPLEILHESLSHINVKYIRKSVELGLIKDVKISDV 246

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYF 248
           DW   + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YF
Sbjct: 247 DWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYF 306

Query: 249 ISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVAT 282
           I+FTDE++R+RWVFPL  K    V   F+    T
Sbjct: 307 ITFTDERTRYRWVFPLSRKSDEAVVRSFQKTNCT 340

>Skud_46.2 Chr46 complement(436..1575) [1140 bp, 379 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 379

 Score =  196 bits (499), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 94/192 (48%), Positives = 125/192 (65%)

Query: 296 MDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPH 355
           MDRGSE+TN  + +FF E GI PCYT+  DSRAHG+AERLNRTLLDDCRT L+ SGL  H
Sbjct: 1   MDRGSEYTNKTLHNFFMECGITPCYTTTADSRAHGIAERLNRTLLDDCRTHLQCSGLPNH 60

Query: 356 LWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVR 415
           LWF +VEF+T+IRN+L++   K               T+LPFGQ V+ ++ +P  K++ R
Sbjct: 61  LWFSAVEFSTIIRNSLISPKNKNYPRQHAGLAGLDISTLLPFGQTVVVNNHSPDSKIYPR 120

Query: 416 GHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIA 475
           G  GYAL PS+ S+GY+IYVP L K +DT+NYV+   + +     NYD+  FD  +  + 
Sbjct: 121 GITGYALHPSRNSYGYIIYVPSLKKTIDTTNYVISHGEQSRLDQFNYDALTFDADINRLT 180

Query: 476 RPYDDFLNDTSA 487
            PY  F+    A
Sbjct: 181 APYQSFIEQNEA 192

>NDAI0D00680 Chr4 (145699..146403) [705 bp, 234 aa] {ON} 
          Length = 234

 Score =  189 bits (481), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 95/228 (41%), Positives = 146/228 (64%), Gaps = 6/228 (2%)

Query: 205 KSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPL 264
           +S +H H VGSR+KYQ+ Y  F+++HTD+FGPV ++    P++F++FTDE +RFRWVFPL
Sbjct: 8   QSRKHNHTVGSRLKYQKNYEPFQYIHTDVFGPV-SVDKPYPSWFVAFTDEATRFRWVFPL 66

Query: 265 RSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVG 324
            +K A  +  V   +V T   QF++KVL FQ D G E+ N  ++++   NGIQ  + SV 
Sbjct: 67  ENKTADLMLHVITALVNTIKRQFNSKVLCFQFDHGREYDNKLLQNYLESNGIQSIFNSVA 126

Query: 325 DSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXX 384
           DS ++GVAER+N TLL+DCRTLL+++ L  +LWFY+++F+T+IRN++ N + K+      
Sbjct: 127 DSASNGVAERMNLTLLNDCRTLLKAAQLPDNLWFYAIQFSTVIRNSVYNESIKSSPRAIA 186

Query: 385 XXX---XXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESH 429
                      TI   G    +++ N +    +  + G+ALTPS  S+
Sbjct: 187 GLSGLDVQNNLTIWSTGYR--SYEPNLLLSYILEANLGFALTPSTHSY 232

>Kpol_423.17 s423 complement(41262..42812) [1551 bp, 516 aa] {ON}
            complement(41262..42812) [1551 nt, 517 aa]
          Length = 516

 Score =  199 bits (505), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 152/485 (31%), Positives = 259/485 (53%), Gaps = 25/485 (5%)

Query: 816  EVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANT--IHHEALMTCMAI 873
            +V+ +KII    IFT KRDGTHK R V RGD+Q   TY    + NT  +  + L   + I
Sbjct: 14   QVSKEKIIPVQTIFTVKRDGTHKARIVCRGDRQTPSTYG---VINTDLLQMDTLKLLLMI 70

Query: 874  ALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYEN 933
            A +N M +  LDI+ A+LYADL+E +YI   PH    NK+ +L K+LYGLKQS   W ++
Sbjct: 71   ANNNRMVVQTLDINHAFLYADLQEVIYI---PHPYEPNKVVQLNKALYGLKQSPKEWNDH 127

Query: 934  IKKYLTEDCGMSNIRGWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYET 991
            ++KYL  DC + +    P  F +++  +I+ ++VDD I+  K +      +  LK  +E 
Sbjct: 128  LRKYLN-DCSLFDTEYTPGLFMDKEKLIIIAVYVDDCIIAAKDNIILKRFINKLKETFEL 186

Query: 992  KVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAP 1051
            K+V  G ++K   +  DILG+++ Y  +K     +  SLE  +  +      E + +K  
Sbjct: 187  KIV--GTMDKGILKT-DILGMDLDYNITKG---EISLSLETYLTGIENDWIDELKYIKYD 240

Query: 1052 GQPGIILSDSKLD----MSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTL 1107
              P     + K D    +SE+  K   K +Q + G+ +Y+  + RYD+ +  N LA+   
Sbjct: 241  NSPHWSSYNYKDDLIPILSESRKKEMTKKLQIMSGIINYILTRCRYDIAFAANKLARIVN 300

Query: 1108 YPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTA-ITDAAFANQPGYKSQVGYF 1166
             P+ Q + + +++++Y++ T+N++LI+   +E  ++ +   ITDA+   +  +KS++G  
Sbjct: 301  SPNEQSIKIAHKILKYLFTTKNQKLIY--LRENGSKPIIEIITDASLGTEWDHKSRIGVM 358

Query: 1167 ILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMET-ITGNQVKNKLITD 1225
            +     +    S   T    SSTE+EL AI         +K ++ET    N +K  + TD
Sbjct: 359  VWYGRNLYKVISRATTSIRESSTEAELDAIYEGYKEGKLLKKVLETINISNNIKINIFTD 418

Query: 1226 SAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKR 1285
            S P I  +N +  +K R+K+   +  K+ ++V+ + + +  +    N+ADILTK +   +
Sbjct: 419  SKPGIQFLNKKYRSKKRDKFLDLKVAKLTEQVRENIIAIGKITGIFNVADILTKPVTTIQ 478

Query: 1286 FNDLT 1290
            F  L 
Sbjct: 479  FKKLV 483

>TBLA0B08200 Chr2 (1957742..1959115) [1374 bp, 457 aa] {ON}
           possible pseudogene; NNN added to avoid internal stop
           codon
          Length = 457

 Score =  193 bits (490), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 146/253 (57%), Gaps = 8/253 (3%)

Query: 16  EFDLPGYLLLDSGAST-SIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFANG 74
           +  L   L+LDSGA   S+I+++ +LH      +  +  A D  I +S  G +KF  AN 
Sbjct: 205 KLSLDDVLILDSGAQXXSVIKNTGILHDFSSITNSQLFAADDRKIDVSGEGKIKFMKANN 264

Query: 75  PPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTK 134
               I    S ++  +LISL  L+ AG   + S R L D D ++I   + +  +  +   
Sbjct: 265 KITPIPVLYSKDVACNLISLFNLEQAGFTVELSDRKLLDSDEHLITKFVDYDRYVCIKIS 324

Query: 135 YLMLPARSRNHRINNILPR-------FSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDN 187
            L LP  S+     N + +       +S   +HRLFGH+NIK I+ +I  GLI +I    
Sbjct: 325 DLQLPTPSKTIVKGNKVLKVSTTDKPYSMSLLHRLFGHINIKDIRKTISSGLIGSIQSHM 384

Query: 188 IDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTY 247
           +DW+  D FQC DC+KGK+ +H+H VGSR+KYQ+EY+ F++LH DLFGPV  MP ++  Y
Sbjct: 385 VDWTDIDKFQCADCMKGKARKHQHVVGSRLKYQKEYSKFQYLHCDLFGPVSGMPINTAKY 444

Query: 248 FISFTDEQSRFRW 260
           FI+FTDE +R+RW
Sbjct: 445 FITFTDENTRYRW 457

>TBLA0B05400 Chr2 (1268360..1269490,1269492..1273817) [5457 bp, 1818
            aa] {ON} 
          Length = 1818

 Score =  204 bits (519), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 154/537 (28%), Positives = 286/537 (53%), Gaps = 24/537 (4%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPK-KIINSMII 828
            S+ Y++AI++N+N++++E + K++ KE++ L+K   +D   I   K   PK KII+++I+
Sbjct: 1266 SIYYKEAITNNKNLKQRERFIKSFKKEVENLVKMGVYD-PDIRLPKSAIPKNKIISTVIV 1324

Query: 829  FTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISS 888
            F  K+DGT K R+ ARGD QN  +Y ++  A  +  ++L   +++A +  + I   DIS 
Sbjct: 1325 FIVKQDGTCKARYCARGDLQNQESYGNTDSA-ILSLDSLKVLLSVANNKQLHIRTADISH 1383

Query: 889  AYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIR 948
            A+LYA L EELYI  P     K     L+K+LYGLKQS  NW E +++++       +  
Sbjct: 1384 AFLYATLDEELYINHP---SDKRVYTPLKKALYGLKQSPKNWNETLREFMNS-YDFYDTE 1439

Query: 949  GWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRD 1006
              P  F + D   ++  +VDD ++  +  +   +++++ K  +E KV+  G + + +  +
Sbjct: 1440 FAPVLFASSDGNKLIAAYVDDCVLAAETEEDLDEIIEMFKNTFELKVI--GIMNEEKQLE 1497

Query: 1007 YDILGLEITYRRSKSL-SFGMEKSLEQ--------KIPSLGVTLNSEKRRMKAPGQPGII 1057
             DILG+++ Y  +K + +  M+  +++        K+      L +E+++   P      
Sbjct: 1498 PDILGIDLKYDLNKGIVTLSMKSYIDKFNDDFPLLKLKEYENNLTTEQKKDLTPHFSEYN 1557

Query: 1058 LSDSK--LDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLS 1115
            L+ ++  L M++ E+K KVK +QK +G  +YL  + R DL + ++ +A+  LYP  +V+ 
Sbjct: 1558 LNPNEYILLMNKTEHKEKVKYIQKSIGKLNYLRTRGRLDLEFAVSNIARFALYPHVKVIK 1617

Query: 1116 LTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIIT 1175
               +LI+Y +  R+  ++  + K++    +T ITDA+  ++    S++G  I   N  + 
Sbjct: 1618 TVDRLIKYTYVKRDLNVVMKREKKQ-PDEITVITDASLGSEYDVTSRIGGIIWFGNTFMF 1676

Query: 1176 ARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINS 1235
              S K ++ C SS E EL A++    L   +K  +E +     K  +ITDS P I  +  
Sbjct: 1677 GFSNKPSIVCDSSAECELDALNKGEKLALHLKFKLEKLFKKNFKINIITDSKPVIEWL-K 1735

Query: 1236 QDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDLTNV 1292
            +     R K+ G R  ++++ +K     L  ++   N+ D L K +    F +L  +
Sbjct: 1736 KPYIVGRTKFLGIRIGRLKERLKDKSTFLRKIDGLENVTDPLIKPVSPTDFKNLNKI 1792

 Score =  111 bits (278), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 86/313 (27%), Positives = 132/313 (42%), Gaps = 10/313 (3%)

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKY 219
           H    H+    I++SI+  + +++     + +  +   C  C+ GK T+H HY  S   Y
Sbjct: 576 HLRLNHLPTVAIQESIKNKIFEDVEVIQENKNN-NHIWCEICVAGKMTKHFHYTNSMNNY 634

Query: 220 QREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFP-LRSKDASTVTTVFRN 278
               +       DLFG V  + + +P Y +   D  SR+      L   D   V  + +N
Sbjct: 635 TMLKSPGSSWSIDLFGLVNKVSSGTPRYMMIMVDNVSRYVICTTHLYKTDDEIVDQIDKN 694

Query: 279 IVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRT 338
           I     TQF  K+  F  DRGSEFTN  ++    + GIQ  +TS  D  A+  AER  RT
Sbjct: 695 I-RFIETQFGRKIQEFITDRGSEFTNNNLKQLPEKKGIQLRFTSTQDHSANARAERAIRT 753

Query: 339 LLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTX--XXXXXXXXXXXXXTILP 396
           ++ D RTLL  + L    W Y+V  +  +RN   N   K                   LP
Sbjct: 754 IITDTRTLLLQAKLPLKFWHYAVMASAEVRNCTYNKNTKDAPLNVISELPVKIILRNFLP 813

Query: 397 FG--QHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDT 454
           FG    +  H +    K          L+   +S GY  Y+P  ++V+ T+N+ +     
Sbjct: 814 FGAPATIWNHKSK---KTSAPSLQAVVLSKDPQSFGYFFYIPKENRVITTTNFKIPDYSV 870

Query: 455 NISADHNYDSTVF 467
           N     N + T+ 
Sbjct: 871 NSQQKSNPEETII 883

>Skud_82.1 Chr82 complement(248..757) [510 bp, 169 aa] {ON} YNL054W-B
            (REPEAT)
          Length = 169

 Score =  180 bits (456), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 121/163 (74%), Gaps = 5/163 (3%)

Query: 1083 LASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPK---AKE 1139
            LASY+GYKYR+DLLYYIN L QH L+PS QVL++TY+LIQ++WDTR+K+LIW K   AK 
Sbjct: 1    LASYVGYKYRFDLLYYINTLVQHILFPSKQVLNMTYELIQFLWDTRDKQLIWHKNTSAKR 60

Query: 1140 RNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMV 1199
             N  ++ AI+DA++ NQP YKSQ+G   L+N K+I  +STKA+LTC S+TE+E++A+S  
Sbjct: 61   EN--KIVAISDASYGNQPYYKSQIGSIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEA 118

Query: 1200 IPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLR 1242
            IPLL+++  L++ +    +   L TDS   ISII S++E  L 
Sbjct: 119  IPLLDNLSHLVQELHNKPITKGLFTDSRSTISIIMSKNERSLE 161

>Kpol_1046.15 s1046 complement(34637..37375) [2739 bp, 912 aa] {ON}
            complement(34637..37375) [2739 nt, 913 aa]
          Length = 912

 Score =  198 bits (504), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 155/534 (29%), Positives = 269/534 (50%), Gaps = 19/534 (3%)

Query: 763  PPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKI 822
            P    N SM Y++AI+ N N+ E++L+++AY KEL  L +   +D        +VN +KI
Sbjct: 357  PVVYTNRSMCYKEAIAKNTNMEERKLFQEAYKKELRNLKRMLVFDIKAGIPRNQVNGEKI 416

Query: 823  INSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIV 882
            I    IFT ++DGTHK R V RGDQQ   TY D   A  +  + L   + IA ++ M I 
Sbjct: 417  IPVKTIFTVEQDGTHKARIVCRGDQQTPSTYGDISTA-LLDMDTLKLLLMIANNSKMVIQ 475

Query: 883  QLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDC 942
             LDI++A+LYADLKE +YI   PH     K+ +L K+LYGLKQS   W ++++KYL   C
Sbjct: 476  TLDINNAFLYADLKEVIYI---PHPYEPKKVVQLNKALYGLKQSMKKWNDHLRKYLN-SC 531

Query: 943  GMSNIRGWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIE 1000
             + +    P  F N++  +I+ + V + I+           +  LK  +E K+V  G +E
Sbjct: 532  ALYDTEYTPGLFMNKEKTIIIAVHVSNCIIAANNKMTLKKFINNLKETFELKIV--GTME 589

Query: 1001 KAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSD 1060
            K   +  + LG+++ Y   K     +  SLE  +  +      E + +     P     +
Sbjct: 590  KGILKT-NFLGMDLYYDIKKG---EISLSLETYLKGIENDWIDELKYINFDNCPHWSSYN 645

Query: 1061 SKLD----MSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSL 1116
            +K      +SEA  K   K ++ + G+ +Y+  + RYD+ +  N LA+    P  Q + +
Sbjct: 646  NKNKVIPTLSEARKKEITKKLRIMSGIINYIMTRCRYDIAFAANKLARIVNSPDEQSIKI 705

Query: 1117 TYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITA 1176
              ++++Y+  T+N+RLI+ + +  +   +  + DA+   +  +KS++G  +     +   
Sbjct: 706  AQKILKYLLTTKNQRLIY-RRETVSKPIINIVIDASLGTEWDFKSRIGVMVWYGRNLYKV 764

Query: 1177 RSTKATLTCISSTESELYAISMVIPLLNSIKMLMETI-TGNQVKNKLITDSAPAISIINS 1235
             S   T    SSTE+EL AI         +K ++E +   N +   +  D  P +  +  
Sbjct: 765  ISRATTSIRASSTEAELDAIYEGFQEGRLLKRVLEKLIISNNININIFIDLKPNVQFLKK 824

Query: 1236 QDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
               +K R+K+   +  K+ ++V+   + +E ++   N+A+ILT  +   +F  L
Sbjct: 825  DYRSKKRDKFLDLKLAKLSEQVRRGIIVIENISGIFNVANILTIPVTTNQFKKL 878

>Kwal_27.12442 s27 (1221132..1221728) [597 bp, 199 aa] {ON} YER160C
           - TyB Gag-Pol protein [contig 457] PARTIAL
          Length = 199

 Score =  179 bits (454), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/167 (53%), Positives = 113/167 (67%), Gaps = 1/167 (0%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 34  KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 92

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
           WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 93  WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 152

Query: 866 ALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNK 912
           AL  C+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K
Sbjct: 153 ALTMCLAITLEKGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDK 199

>Kwal_47.17664 s47 complement(504858..505484) [627 bp, 208 aa] {ON}
            YAR009C - TyB Gag-Pol protein [contig 206] FULL
          Length = 208

 Score =  179 bits (453), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 88/185 (47%), Positives = 130/185 (70%), Gaps = 3/185 (1%)

Query: 1025 GMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVG 1082
            GMEK++ +K+P LG++L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VG
Sbjct: 4    GMEKTIIEKLPKLGLSLQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVG 62

Query: 1083 LASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNT 1142
            L SY+ +K R+++ YY+N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+     
Sbjct: 63   LLSYITHKCRFEMAYYVNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGD 122

Query: 1143 QRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPL 1202
              + AITDA+ A Q  YKSQ+GYF  VN  II ARST++T++CISSTE+EL A+   +P 
Sbjct: 123  INIDAITDASHATQEEYKSQLGYFYKVNGHIIFARSTRSTISCISSTEAELNALYNSLPK 182

Query: 1203 LNSIK 1207
            L S++
Sbjct: 183  LKSLQ 187

>Kwal_27.11215 s27 complement(689663..690304) [642 bp, 213 aa] {ON}
            YAR009C - TyB Gag-Pol protein [contig 345] FULL
          Length = 213

 Score =  178 bits (451), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 136/212 (64%), Gaps = 1/212 (0%)

Query: 1065 MSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYI 1124
            MS+ E+  KV  +Q++VGL SY+ +K R+++ YY+N+LAQHTL+P ++V  L  Q +QY+
Sbjct: 2    MSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYYVNVLAQHTLFPCDEVFDLALQCVQYL 61

Query: 1125 WDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLT 1184
            W  ++K+L W K+       + AITDA+ A Q  YKSQ+GYF  VN  II ARST++T++
Sbjct: 62   WTNKHKKLTWIKSNIPGDINIDAITDASHATQEEYKSQLGYFYKVNGHIIFARSTRSTIS 121

Query: 1185 CISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNK 1244
            CISSTE+EL A+   +P L S++ +   + G + +  + TDS   IS I   D +K RN+
Sbjct: 122  CISSTEAELNALFNSLPKLKSLQDITAAL-GYKSQTTIYTDSQTVISSITKTDTSKFRNR 180

Query: 1245 YFGARSMKIRDEVKYSHLKLEYVNTDNNIADI 1276
            +FG+++ ++R E      ++ YV+    I  I
Sbjct: 181  FFGSKAFRLRQEYDAGEFQVAYVSDARKIRQI 212

>TPHA0L01530 Chr12 (320935..325509) [4575 bp, 1524 aa] {ON} 
          Length = 1524

 Score =  195 bits (496), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 130/434 (29%), Positives = 234/434 (53%), Gaps = 20/434 (4%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            ++ ++ AI++N +VRE++L+ +A+ KEL  L+K   +D S      +V   +II    IF
Sbjct: 1091 TLYFKTAITNNTDVRERKLFSEAFEKELQNLLKMQVFDTSISIPRNQVPANRIIPLQTIF 1150

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
            T KRDGTHK R V RGD+Q   TY +    + +  + L   + IA +  M+I  LDI+ A
Sbjct: 1151 TVKRDGTHKARIVCRGDKQTEATYSN-YHTDLLQIDTLKLFLMIANNRKMWIQTLDINHA 1209

Query: 890  YLYADLKEELYIRTPPHLGHKNK-IFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIR 948
            +LYADL+EE+Y+  P    H  + +  L+K+LYGLKQS   W E++KK+L     + + R
Sbjct: 1210 FLYADLREEIYVPLP----HDRRFVTPLKKALYGLKQSPKEWNEHLKKFLNS-IDLDDSR 1264

Query: 949  GWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRD 1006
              P  F+N D  +++ ++VDD ++  K  +   + V  L+ R+E K++  GK+ +     
Sbjct: 1265 HTPGIFRNHDYSIMIAVYVDDCVIAAKSQELLDEFVSTLRNRFELKII--GKMNQG-ILP 1321

Query: 1007 YDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKL--- 1063
             D+LG+++ Y   +     +  SL+  I S+      +   +K    P +   +  +   
Sbjct: 1322 TDVLGMDLDYNIDEG---KISLSLQSYIESIENDWLDKISHIKTTSTPHVSSYEHNIKNI 1378

Query: 1064 -DMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQ 1122
              M      +K+  +QK+ G+ +Y+  + RYD+ +  N LA+   +P++ V  +  +L+ 
Sbjct: 1379 DSMDTKTRSKKINELQKINGVINYIRSRCRYDIEFAANKLARSVNFPADNVFYMADKLMN 1438

Query: 1123 YIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKAT 1182
            YI+ T++++L++ +    N   +T ++DA+   +   KS++G  +     +    S  ++
Sbjct: 1439 YIFQTKSEKLVFTRETTDNPA-ITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASS 1497

Query: 1183 LTCISSTESELYAI 1196
                SSTE+EL AI
Sbjct: 1498 AVRNSSTEAELDAI 1511

 Score =  124 bits (311), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 104/396 (26%), Positives = 161/396 (40%), Gaps = 29/396 (7%)

Query: 111 LRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKI 170
           L  KDN     L K     W+       P+ S N++        +    H    H+ + +
Sbjct: 531 LSSKDNRTSEKLTKASSIRWIK------PSTSFNNKT------VTIHEAHERSNHLPVDV 578

Query: 171 IKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLH 230
           I  +I      +++  N+  S    F C  C++ K  QH H   S  K+  +    +   
Sbjct: 579 IVHNIENNAFSDVNKINLKKSELINFYCEQCVQAKMKQHDHIKDSMNKHYEQMQPGQSWS 638

Query: 231 TDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTK 290
            D+ GP+         Y +   D  SRF  V    +K+  T++   +N +     Q+D  
Sbjct: 639 LDIRGPLGKNLAKVDNYLLLMVDNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRI 698

Query: 291 VLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESS 350
           V    +DRGSEFTN  ++ +  E GI+   T   D  ++  AER    + +D RTL+ +S
Sbjct: 699 VKELIVDRGSEFTNDSLKTYVSEKGIKLMLTDTNDHASNARAERFIGIMNNDIRTLMHNS 758

Query: 351 GLSPHLWFYSVEFATLIRNALLNTTYKTX--XXXXXXXXXXXXXTILPFGQHV-ITHDTN 407
            L   LW Y+   A  IRN  +                      + LPFG H  + + TN
Sbjct: 759 DLPWALWKYAALAAARIRNLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTN 818

Query: 408 PIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVF 467
             +KL  +G     L     S GYL Y+P   KV+ T +Y++  S+ N            
Sbjct: 819 --NKLTNQGIPAITLCKDPNSFGYLFYLPQTRKVISTMSYILANSEVN--------GDFI 868

Query: 468 DP--LMQSIARPYDDFLNDTSAPALIDDNSSEPDNS 501
           DP  ++  I    DD    TS  AL  +  +EP N+
Sbjct: 869 DPNKVLSEIVPDNDDTNEVTSEDAL--EIEAEPSNA 902

>TPHA0I02520 Chr9 (556711..561240) [4530 bp, 1509 aa] {ON} 
          Length = 1509

 Score =  194 bits (493), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 130/434 (29%), Positives = 234/434 (53%), Gaps = 20/434 (4%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            ++ ++ AI++N +VR ++L+ +A+ KEL  L+K   +D S      +V   +II    IF
Sbjct: 1058 TLYFKTAITNNTDVRGRKLFSEAFEKELQNLLKMQVFDTSISIPRNQVPANRIIPLQTIF 1117

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
            T KRDGTHK R V RGD+Q   TY +    + +  + L   + IA +  M+I  LDI+ A
Sbjct: 1118 TVKRDGTHKARIVCRGDKQTEATYSN-YHTDLLQIDTLKLFLMIANNRKMWIQTLDINHA 1176

Query: 890  YLYADLKEELYIRTPPHLGHKNK-IFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIR 948
            +LYADL+EE+Y+  P    H  + +  L+K+LYGLKQS   W E++KK+L     + + R
Sbjct: 1177 FLYADLREEIYVPLP----HDRRFVTPLKKALYGLKQSPKEWNEHLKKFLNS-IDLDDSR 1231

Query: 949  GWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRD 1006
              P  F+N D  +++ ++VDD ++  K  +   + V  L+ R+E K++  GK+ +   R 
Sbjct: 1232 HTPGIFRNHDYSIMIAVYVDDCVIAAKSQELLDEFVSTLRNRFELKII--GKMNQGILRT 1289

Query: 1007 YDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKL--- 1063
             D+LG+++ Y   +     +  SL+  I S+      +   +K    P +   +  +   
Sbjct: 1290 -DVLGMDLDYNIDEG---KISLSLQSYIESIENDWLDKISHIKTTSTPHVSSYEHNIKNI 1345

Query: 1064 -DMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQ 1122
              M      +K+  +QK+ G+ +Y+  + RYD+ +  N LA+   +P++ V  +  +L+ 
Sbjct: 1346 DSMDTKTRSKKINELQKINGVINYIRSRCRYDVEFAANKLARSVNFPADNVFYMADKLMN 1405

Query: 1123 YIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKAT 1182
            YI+ T++++L++ +    N   +T ++DA+   +   KS++G  +     +    S  ++
Sbjct: 1406 YIFQTKSEKLVFTRETTDNPA-ITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASS 1464

Query: 1183 LTCISSTESELYAI 1196
                SSTE+EL AI
Sbjct: 1465 AVRNSSTEAELDAI 1478

 Score =  122 bits (306), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 104/396 (26%), Positives = 159/396 (40%), Gaps = 29/396 (7%)

Query: 111 LRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKI 170
           L  KDN     L K     W+       P+ S N++        +    H    H+ + +
Sbjct: 498 LSSKDNRTSEKLTKASSIRWIK------PSTSFNNKT------VTIHEAHERSNHLPVDV 545

Query: 171 IKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLH 230
           I  +I      +++  N+  S    F C  C + K  QH H   S  K+  +    +   
Sbjct: 546 IVHNIENNAFSDVNKINLKKSELINFYCEQCAQAKMKQHDHIKDSMNKHYEQMQPGQSWS 605

Query: 231 TDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTK 290
            D+ GP+         Y +   D  SRF  V    +K+  T++   +N +     Q+D  
Sbjct: 606 LDIRGPLGKNLAKVDNYLLLMVDNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRI 665

Query: 291 VLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESS 350
           V    +DRGSEFTN  ++ +  E GI+   T   D  ++  AER    + +D RTL+  S
Sbjct: 666 VKELIVDRGSEFTNDSLKTYVSEKGIKLMLTDTNDHASNARAERFIGIMNNDIRTLMHYS 725

Query: 351 GLSPHLWFYSVEFATLIRNALLNTTYKTX--XXXXXXXXXXXXXTILPFGQHV-ITHDTN 407
            L   LW Y+   A  IRN  +                      + LPFG H  + + TN
Sbjct: 726 DLPWALWKYAALAAARIRNLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTN 785

Query: 408 PIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVF 467
             +KL  +G     L     S GYL Y+P   KV+ T +Y++  S+ N            
Sbjct: 786 --NKLTNQGIPAITLCKDPNSFGYLFYLPQTRKVISTMSYILANSEVN--------GDFI 835

Query: 468 DP--LMQSIARPYDDFLNDTSAPALIDDNSSEPDNS 501
           DP  ++  I    DD    TS  AL  +  +EP N+
Sbjct: 836 DPNKVLSEIVPDNDDTNEVTSEDAL--EIEAEPSNA 869

>Smik_31.1 Chr31 complement(2..3544) [3543 bp, 1181 aa] {ON}
            YPL060C-A (REPEAT)
          Length = 1181

 Score =  189 bits (480), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 124/405 (30%), Positives = 224/405 (55%), Gaps = 25/405 (6%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            ++ Y +AIS N +++EK  Y++AY KEL  L     +D    Y+  +V    II +  IF
Sbjct: 791  TIYYNEAISGNADLKEKHAYKEAYRKELQNLKDMKVFDVDVKYNRSDVPSNLIIPTNTIF 850

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
            + KR+G +K R V RGD Q   TY + +   +++H  +   + IA + +MF+  LDI+ A
Sbjct: 851  SKKRNGIYKARIVCRGDIQTPDTY-NVIGTESLNHNHIKIFLMIANNRNMFMKTLDINHA 909

Query: 890  YLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRG 949
            +LYA L+E++YI   PH   +  + KL+K+LYGLKQS   W +++++YL    G+ +   
Sbjct: 910  FLYAKLEEDIYI---PHPHDRRCVVKLDKALYGLKQSPKEWNDHLRRYLNS-VGLKDNTY 965

Query: 950  WPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVN---DGKIEKAES 1004
             P  ++++D  L++ ++VDD ++     ++  D +  LK  +E K+     DG +     
Sbjct: 966  TPGLYQSKDKKLMIAVYVDDCVIAASDEQRLDDFINNLKKTFELKITGTLIDGIL----- 1020

Query: 1005 RDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIIL-----S 1059
             D DILG+++ Y  +K L   ++ +L   I  +G     E  +++    P I +      
Sbjct: 1021 -DTDILGMDLIY--NKKLG-TVDLTLISFIEKMGEKYKKELDKVRKRSIPHISIYKIDPK 1076

Query: 1060 DSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQ 1119
            + +L M+E EYK  V  +Q+L+G  +Y+ YK RYD+ + +  +A+   +P  QV  + Y+
Sbjct: 1077 NGELKMTEKEYKDGVLKLQQLLGELNYVRYKCRYDVEFAVKKVARLVNFPHKQVFYMIYK 1136

Query: 1120 LIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVG 1164
            +IQY+    N  + + +   ++ +++T ITDA+   +   +S++G
Sbjct: 1137 IIQYLVQHTNIGIHYDRDLNKD-KKITTITDASVGTEYDAQSRIG 1180

 Score =  138 bits (348), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 101/337 (29%), Positives = 152/337 (45%), Gaps = 18/337 (5%)

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDW-SGFDTFQCPDCLKGKSTQHKHYVGSRVK 218
           H   GH  I+ IK+SI+    +    +N+D     + F C  C   K+T+  HY GS  +
Sbjct: 91  HNRMGHTGIQQIKNSIKHSHYE----ENLDLIKEPNEFWCETCKVSKATRRNHYKGSMNE 146

Query: 219 YQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRN 278
           +  ++        D+FGPV N  + +  Y +   D  +R+       +K+A T+    + 
Sbjct: 147 HSIDHEPGSSWCMDIFGPVSNSNSDTKRYMLIMVDNNTRYCITSTHFNKNAETILAQIKK 206

Query: 279 IVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRT 338
            +    TQFD KV     D+G+EFTN +I  +F   GI   +++  D  A+G AER  RT
Sbjct: 207 NIQYVETQFDRKVREINSDQGTEFTNDQIAKYFVSKGIHHIFSATQDHAANGRAERYIRT 266

Query: 339 LLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLN--TTYKTXXXXXXXXXXXXXXTILP 396
           ++ D  TLL+ S L    W Y+V  AT +RN L N  T                  + LP
Sbjct: 267 IVTDATTLLKHSKLRIKFWEYAVTSATNVRNCLENKATGQLPLQAISSQPVKVRFMSFLP 326

Query: 397 FGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYV-------- 448
           FG+  I  + N  +KL   G     L     SHGY  +VP + K+L + NY         
Sbjct: 327 FGEQGIIWNHNH-NKLKPSGLRAIILCKDPNSHGYKFFVPSIKKILTSDNYTIPDYAVDP 385

Query: 449 VIRSDTNISADHNYDSTVFDPLMQS--IARPYDDFLN 483
           ++R+  NI  D    S   +    S  ++R YD   N
Sbjct: 386 ILRNTQNIYPDDQSRSDSINEAENSDAVSRLYDALEN 422

>TPHA0G01020 Chr7 complement(201378..205652) [4275 bp, 1424 aa] {ON} 
          Length = 1424

 Score =  187 bits (474), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 123/426 (28%), Positives = 231/426 (54%), Gaps = 22/426 (5%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            ++ ++ AI++N +VRE++L+ +A+ KEL  L+K   +D S      +V   +II    IF
Sbjct: 1011 TLYFKTAITNNTDVRERKLFSEAFEKELQNLLKMQVFDTSISIPRNQVPANRIIPLQTIF 1070

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
            T KRDGTHK R V RGD+Q   TY +    + +  + L   + +A +  M+I  LDI+ A
Sbjct: 1071 TVKRDGTHKARIVCRGDKQTEATYSN-YHTDLLQIDTLKLFLMMANNRKMWIQTLDINHA 1129

Query: 890  YLYADLKEELYIRTPPHLGHKNK-IFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIR 948
            +LYADL+EE+Y+  P    H  + +  L+K+LYGLKQS   W E++KK+L     + + R
Sbjct: 1130 FLYADLREEIYVPLP----HDRRFVTPLKKALYGLKQSPKEWNEHLKKFLNS-IDLDDSR 1184

Query: 949  GWPCAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRD 1006
              P  F+N D  +++ ++VDD ++  K  +   + V  L+ R+E K++  GK+ +   R 
Sbjct: 1185 HTPGIFRNHDYSIMIAVYVDDCVIAAKSQELLDEFVSTLRNRFELKII--GKMNQGILRT 1242

Query: 1007 YDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKL--- 1063
             D+LG+++ Y   +     +  SL+  I S+      +   +K    P +   +  +   
Sbjct: 1243 -DVLGMDLDYNIDEG---KISLSLQSYIESIENDWLDKISHIKTTSIPHVSSYEHNIKNI 1298

Query: 1064 -DMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQ 1122
              M      +K+  +QK+ G+ +Y+  + RYD+ +  N LA+   +P++ V  +  +L+ 
Sbjct: 1299 DSMDTKTRSKKINELQKINGVINYIRSRCRYDIEFAANKLARSVNFPADNVFYMADKLMN 1358

Query: 1123 YIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKI--ITARSTK 1180
            YI+ T+++++++ +    N   +T ++DA+   +   KS++G  +     +  + +R++ 
Sbjct: 1359 YIFQTKSEKIVFTRETTGNPA-ITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASS 1417

Query: 1181 ATLTCI 1186
            A+   I
Sbjct: 1418 ASQKLI 1423

 Score =  123 bits (309), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 104/396 (26%), Positives = 161/396 (40%), Gaps = 29/396 (7%)

Query: 111 LRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKI 170
           L  KDN     L K     W+       P+ S N++        +    H    H+ + +
Sbjct: 451 LSSKDNRTSEKLTKASSIRWIK------PSTSFNNKT------VTIHEAHERSNHLPVDV 498

Query: 171 IKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLH 230
           I  +I      +++  N+  S    F C  C++ K  QH H   S  K+  +    +   
Sbjct: 499 IVHNIENNAFSDVNKINLKKSELINFYCEQCVQAKMKQHDHIKDSMNKHYEQMQPGQSWS 558

Query: 231 TDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTK 290
            D+ GP+         Y +   D  SRF  V    +K+  T++   +N +     Q+D  
Sbjct: 559 LDIRGPLGKNLAKVDNYLLLMVDNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRI 618

Query: 291 VLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESS 350
           V    +DRGSEFTN  ++ +  E GI+   T   D  ++  AER    + +D RTL+ +S
Sbjct: 619 VKELIVDRGSEFTNDSLKTYVSEKGIKLMLTDTNDHASNTRAERFIGIMNNDIRTLMHNS 678

Query: 351 GLSPHLWFYSVEFATLIRNALLNTTYKTX--XXXXXXXXXXXXXTILPFGQHV-ITHDTN 407
            L   LW Y+   A  IRN  +                      + LPFG H  + + TN
Sbjct: 679 DLPWALWKYAALAAARIRNLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTN 738

Query: 408 PIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVF 467
             +KL  +G     L     S GYL Y+P   KV+ T +Y++  S+ N            
Sbjct: 739 --NKLTNQGIPAITLCKDPNSFGYLFYLPQTRKVISTMSYILANSEVN--------GDFI 788

Query: 468 DP--LMQSIARPYDDFLNDTSAPALIDDNSSEPDNS 501
           DP  ++  I    DD    TS  AL  +  +EP N+
Sbjct: 789 DPNKVLSEIVPDNDDTNEVTSEDAL--EIEAEPSNA 822

>TBLA0E02360 Chr5 (589208..590245) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score =  173 bits (439), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 116/187 (62%), Gaps = 11/187 (5%)

Query: 296 MDRGSEFTNAEIRHFFRENGIQPCY-TSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSP 354
           MDRGSEFTN E+R  FR++GIQP Y T+  DS ++G+ ER N TLL+DCRTLL ++GL  
Sbjct: 1   MDRGSEFTNNELRGIFRKSGIQPIYITTTADSSSNGITERTNLTLLNDCRTLLAATGLPN 60

Query: 355 HLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHV 414
            LWF++V FATL+RNA   ++ K+              ++LPFGQ VI H  N   KL V
Sbjct: 61  QLWFHAVSFATLMRNAFHTSSIKSTPRAKAGLVGLAASSLLPFGQDVILHTPNTHSKLDV 120

Query: 415 RGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHN----------YDS 464
           RG   +ALTPS ESH YL YVP  HKV+D+SN+ +IR D   + +            YDS
Sbjct: 121 RGLKAFALTPSNESHRYLFYVPSSHKVVDSSNFSLIRGDKATATESAPNVFDELLALYDS 180

Query: 465 TVFDPLM 471
           T+  P +
Sbjct: 181 TIATPTL 187

>KNAG0B03890 Chr2 (747968..748774) [807 bp, 268 aa] {ON} 
          Length = 268

 Score =  169 bits (427), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 121/196 (61%)

Query: 279 IVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRT 338
           ++ T   QF+  VL FQ++RGSEFTN  +R +  E G    YTSV D +++GVAERLN T
Sbjct: 1   MIGTVRNQFEVNVLAFQVNRGSEFTNNALRDYLSEEGNHTYYTSVADHQSNGVAERLNLT 60

Query: 339 LLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFG 398
           LL+DCRTLL+++ L  HLWF++V+FATL RN++ N + +               TI  FG
Sbjct: 61  LLNDCRTLLKTTKLPYHLWFHAVQFATLQRNSVYNDSIRASARAKAGLPGIDVKTIPTFG 120

Query: 399 QHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISA 458
           Q  I H T   +KL  RG  G+ALTPS  S+ Y+IY+     V+DT++Y VIR    I  
Sbjct: 121 QPAIAHFTKIHNKLRYRGEQGFALTPSSASYDYIIYLQSKGTVIDTTHYAVIRLSVKIDP 180

Query: 459 DHNYDSTVFDPLMQSI 474
           +  YD+++F+ ++  +
Sbjct: 181 NEEYDNSIFNSIITKL 196

>KAFR0K02295 Chr11 complement(469108..469680) [573 bp, 190 aa] {ON}
          Length = 190

 Score =  163 bits (413), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/173 (45%), Positives = 110/173 (63%), Gaps = 1/173 (0%)

Query: 903  TPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVC 962
            T P +G K K F+L KSLYGLKQSGANWY  IK YL +DC +  I GW C  KN+++IVC
Sbjct: 2    TLPRMGLKGKAFRLNKSLYGLKQSGANWYSTIKTYLQQDCKLLEIPGWSCVLKNDEIIVC 61

Query: 963  LFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSL 1022
            LFVDD++V        M+LV+ L+ +++TKVV  G++++     YDILGL+I YR  K +
Sbjct: 62   LFVDDMVVMPSDLAYNMNLVKKLRKKFDTKVVKSGRLDQDGVAQYDILGLDIEYRYGKDM 121

Query: 1023 SFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVK 1075
              GMEK LE K+ +L V LN   +++K P  P   ++      ++  YK+ VK
Sbjct: 122  KMGMEKILEAKLKTLDVPLNKSGKKLKVPSPPNTYITKEDYVATKG-YKKNVK 173

>Kwal_47.19342 s47 (1199239..1199979) [741 bp, 246 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 344] FULL
          Length = 246

 Score =  157 bits (398), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/236 (36%), Positives = 128/236 (54%), Gaps = 19/236 (8%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI I+  GI++ +   G  V
Sbjct: 10  PQMFLIDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAITGKGIIELNL--GRVV 66

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 67  KLEAYLSPDIFCDIISTTQLEQFGIYPNFEMRSLRTQEGIEVAKLIRYQAVYWLSTD--- 123

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   +NNI           +   E +H    H+N+K I+ S+  GLIK++   ++
Sbjct: 124 --VAAQFKHVNNIRGMKSLIKPGRKIPLEILHESLSHINVKYIRKSVELGLIKDVKISDV 181

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSS 244
           DWS  + F+C  C+ GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP  S
Sbjct: 182 DWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPIWS 237

>NCAS0E00690 Chr5 complement(124188..124931) [744 bp, 247 aa] {ON} 
          Length = 247

 Score =  155 bits (391), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 77/138 (55%), Positives = 96/138 (69%)

Query: 804 NTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIH 863
           NTWD+S I   KEV+  KIIN+M IFT KRDG  KCR VAR  QQ  GT+++   ++T+H
Sbjct: 2   NTWDSSDIKGEKEVDKNKIINTMFIFTIKRDGRKKCRCVARDHQQKLGTFNEDATSSTVH 61

Query: 864 HEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGL 923
           H ALMT +A+ALD   ++ Q DISSA+LYA L+EELYIR PPH+    K  KL KSLYGL
Sbjct: 62  HYALMTFLALALDKGQYVTQPDISSAHLYATLEEELYIRIPPHMHMPGKAMKLNKSLYGL 121

Query: 924 KQSGANWYENIKKYLTED 941
           KQSG     +I ++ T D
Sbjct: 122 KQSGVQLINDIPEHTTID 139

>Kwal_9.622 s9 (3778..4317) [540 bp, 179 aa] {ON} YLR410W-B - TyB
            Gag-Pol protein [contig 351] FULL
          Length = 179

 Score =  152 bits (384), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/159 (47%), Positives = 110/159 (69%), Gaps = 4/159 (2%)

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT 1040
            LVQL K  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK++ +K+P LG++
Sbjct: 15   LVQLQK-EFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKTIIEKLPKLGLS 73

Query: 1041 LNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYY 1098
            L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VGL SY+ +K R+++ YY
Sbjct: 74   LQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVGLLSYITHKCRFEMAYY 132

Query: 1099 INILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKA 1137
            +N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+
Sbjct: 133  VNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKS 171

>NDAI0B00740 Chr2 (166514..168262) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 140/232 (60%), Gaps = 11/232 (4%)

Query: 22  YLLLDSGASTSIIRHSSLLHFPQQ----PIHIGVQDAQDNPIPISSTGILKFHFANGPPV 77
           + +LDSGAS +++++ S+LH   Q    P+   +  +Q+ P+  +  G L+    +   +
Sbjct: 354 HFILDSGASVTVVKNGSILHDLHQTASPPV---ISSSQNIPMRCTGQGTLRLKLYHSKTI 410

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
            I A   P + ++L+S + L+  GI+ D    +L  +D N +A  ++     WL+  +++
Sbjct: 411 DIPAYVIPELEHNLLSTNSLEHHGIFVDAKHGTLESRDGNTLAQFVRFNSLPWLTFHHVV 470

Query: 138 LPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQ 197
           +P  +R   INN++ +F  + +HRL GHVN+K ++ SI+     + + ++IDW+G  TFQ
Sbjct: 471 IPPHAR---INNLIQKFPLDVVHRLLGHVNVKSLQQSIKNKTFDHFTIEDIDWTGISTFQ 527

Query: 198 CPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFI 249
           C   L+GKS +H H VGSR+KYQ+ Y  F+++HTD+FGPV ++    P++F+
Sbjct: 528 CITGLQGKSRKHNHTVGSRLKYQKNYEPFQYIHTDVFGPV-SVDKPYPSWFV 578

>NCAS0A09640 Chr1 (1924869..1926374) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score =  160 bits (406), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 112/161 (69%)

Query: 19  LPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFANGPPVK 78
           LPG+LLLDSGASTS+I +   LH  Q      + DAQ+NPI   ++G L F+F +  P+ 
Sbjct: 290 LPGHLLLDSGASTSLIHYPDFLHDIQYDSDPKIHDAQNNPIASQASGSLMFNFKHQSPIP 349

Query: 79  ISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLML 138
           + A  +  + YDL+SLDELD AGI A+F+  +L DK+ N +A+++K+GP+YWL  +YL+ 
Sbjct: 350 VQAVLTDAVAYDLLSLDELDKAGITANFTKMALEDKNGNNVASIIKYGPYYWLPYRYLVP 409

Query: 139 PARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGL 179
            + ++  R++N+LP+F++ FIHRL GHVN + I+ SI K L
Sbjct: 410 ASHAKMERVHNVLPKFTYPFIHRLLGHVNARHIRKSINKEL 450

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 94/190 (49%), Gaps = 22/190 (11%)

Query: 984  LLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNS 1043
            L  L Y+TKV+ DG  +  E  +YDILGLEI Y R + +  GMEKSL +KIP+L   LN+
Sbjct: 4    LYTLCYDTKVIKDGNSKIGELIEYDILGLEIEYTRGRKMLCGMEKSLTEKIPNLDTPLNT 63

Query: 1044 EKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILA 1103
              R+M AP QPG  + +  ++M E EY  +VK M      A+Y+    R    Y I+I  
Sbjct: 64   VGRKMNAPCQPGFTIENKDIEMDELEYNTRVKKMHSFS--ANYVRNLLRRAKQYEISI-- 119

Query: 1104 QHTLYPSNQVLSLT-------YQLIQ--YIWDTRNKRLIWPKAKERNTQRVTAITDAAFA 1154
                 P N +  +        Y+ +Q  Y  D  NK +    A  ++ QR+  +      
Sbjct: 120  -----PDNAICDILLNGLKGPYKTLQSKYALDDSNKSM---SAILQDIQRLYHL-HGPTP 170

Query: 1155 NQPGYKSQVG 1164
            N P  KS  G
Sbjct: 171  NTPSNKSNSG 180

>Kpol_1055.48 s1055 complement(119033..119347) [315 bp, 104 aa] {ON}
           complement(119033..119347) [315 nt, 105 aa]
          Length = 104

 Score =  145 bits (366), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (81%)

Query: 40  LHFPQQPIHIGVQDAQDNPIPISSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDD 99
           +HF Q P +IG +D QD+PIP+SSTG+  FHF NG  V+ISAASSP +RYDL+SLDELD 
Sbjct: 1   MHFSQLPSNIGAKDMQDSPIPVSSTGVRDFHFNNGSTVRISAASSPKVRYDLLSLDELDI 60

Query: 100 AGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSR 143
           AGIYADFST SL D++N+++  ++K G FYW+STKYL+LP RS+
Sbjct: 61  AGIYADFSTCSLCDRNNHILTDIIKRGRFYWISTKYLILPIRSK 104

>Kwal_12.676 s12 complement(40672..41061) [390 bp, 129 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 461] FULL
          Length = 129

 Score =  145 bits (365), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 81/120 (67%)

Query: 239 NMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDR 298
           +MP+  P YFI+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+
Sbjct: 3   HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDK 62

Query: 299 GSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWF 358
           GSE+TN   R F    GI   YTSVGDS +HG+AERLN TL++DCRT+L+ S +  HLWF
Sbjct: 63  GSEYTNQSTRMFLANEGIDAYYTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKHLWF 122

>Kwal_1.407 s1 (1976..2536) [561 bp, 186 aa] {ON} YAR009C - TyB
           Gag-Pol protein [contig 695] FULL
          Length = 186

 Score =  147 bits (370), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 102/183 (55%), Gaps = 14/183 (7%)

Query: 109 RSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILP---------RFSFEFI 159
           RSLR ++   +A L+++   YWLST        ++   INNI           +   E +
Sbjct: 2   RSLRTQEGLEVAKLIRYQAAYWLSTD-----VATKCKHINNIRGIKSLIKPGRKIPLEIL 56

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKY 219
           H    H+N+K I+ S+  GLIK++   ++DW   + F+C  C+ GK  +H H   SR  Y
Sbjct: 57  HESLSHINVKYIRKSVELGLIKDVKISDVDWIELEWFECESCMAGKGKRHNHIANSRDTY 116

Query: 220 QREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNI 279
           Q +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWVFPL  K    V   F+  
Sbjct: 117 QEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVGSFQKT 176

Query: 280 VAT 282
             T
Sbjct: 177 NCT 179

>Smik_5.284 Chr5
            complement(444948..445094,445098..445289,445293..445307,
            445311..445322,445326..445343,445347..445358,
            445365..445388,445398..445412,445416..445430,
            445434..445463,445467..445478,445482..445586,
            445590..445769,445779..445793,445803..445835,
            445839..445889) [876 bp, 292 aa] {OFF} YNL054W-B (PSEUDO)
          Length = 292

 Score =  150 bits (378), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 104/318 (32%), Positives = 161/318 (50%), Gaps = 53/318 (16%)

Query: 792  AYMKELDQLMK-HNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNA 850
            AY KE++QL K H    N+ I         +I+  + +F+T+           R D Q+ 
Sbjct: 7    AYQKEVNQLQKIHGIQTNTTI---------EIVKKLCLFSTRNVMAPTKLDFTRNDIQHP 57

Query: 851  GTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHK 910
             TYD  +  NT++H   M  +++ALDND ++ QLD +SAY YAD+KEELYI++  HLG  
Sbjct: 58   DTYDSIMQLNTVYHYVFMKSLSLALDNDYYVTQLD-TSAYFYADIKEELYIKSSAHLGLN 116

Query: 911  NKI------FKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLF 964
            NK+      FK+ K +     SG   Y          C M               ++C+ 
Sbjct: 117  NKLICLRSHFKINKVVNYQILSGGKIYAK--------CSM---------------VMCIS 153

Query: 965  VDDIIVFGKKHKKCMDLVQ--LLKLRYETKVVNDGKIEKAESRD---YDILGLEITYRRS 1019
            +D++++       C  +VQ  + +  Y  K       +  ES D   Y ILGLEI +++ 
Sbjct: 154  IDNLLI-------CYGIVQGLICEKSYSMKETIHSDYKSNESDDEIQYVILGLEIKHQKG 206

Query: 1020 KSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQK 1079
            K +    E SL +K+P L V LN + +++ AP QP       KL++ E  Y  K+ +M+K
Sbjct: 207  KYMKLCTENSLTEKLPKLNVPLNPKGKKLAAPSQPS-FKDQEKLELKEDNYNMKIHVMRK 265

Query: 1080 LVGLASYLGYKYRYDLLY 1097
            L+ LASY+GY +R+D +Y
Sbjct: 266  LIRLASYVGYNFRFDPIY 283

>Skud_62.1 Chr62 complement(2..1015) [1014 bp, 338 aa] {ON} YNL054W-B
            (REPEAT)
          Length = 338

 Score =  148 bits (373), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/343 (29%), Positives = 192/343 (55%), Gaps = 19/343 (5%)

Query: 832  KRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYL 891
            KR+G +K R V RGD Q   TY+  +   +++H  +   + IA + +MF+  LDI+ A+L
Sbjct: 2    KRNGIYKARIVCRGDIQTPDTYN-VIATESLNHNHIKIFLMIANNRNMFMKTLDINHAFL 60

Query: 892  YADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWP 951
            YA L+EE+YI   PH   +  + KL K+LYGLKQS   W +++++YL    G+ +    P
Sbjct: 61   YAKLEEEIYI---PHPHDRRCVVKLNKALYGLKQSPKEWNDHLRQYLNS-IGLKDNTYTP 116

Query: 952  CAFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDI 1009
              +++ED  L++ ++VDD ++     ++  + +  L+  +E K+   G +   +  D DI
Sbjct: 117  GLYQSEDKNLMIAVYVDDCVIAADDEQRLDEFINELESNFELKIT--GTL-IDDVLDTDI 173

Query: 1010 LGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQP-----GIILSDSKLD 1064
            LG+++ Y  +K L   ++ +L+  I  +      E  +++    P      I     +L 
Sbjct: 174  LGMDLVY--NKKLG-TIDLTLKSFIERMTEKYKKELEKVRKSSIPHTSTYKIDPKKDELQ 230

Query: 1065 MSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYI 1124
            MS+ E+++ V  +Q+L+G  +Y+ YK RYD+ + +  +A+   YP  QV  + Y++IQY+
Sbjct: 231  MSDKEFRQGVLKLQQLLGELNYVRYKCRYDIEFAVKKVARLVNYPHEQVFYMIYKIIQYL 290

Query: 1125 WDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFI 1167
               +N  + + +  +++ +++ +ITDA+  ++   +S++G  I
Sbjct: 291  ARHKNIGIHYDRDLDKD-KKIISITDASVGSEYDAQSRIGVII 332

>Kpol_464.1 s464 complement(2019..5558) [3540 bp, 1179 aa] {ON}
            complement(2019..5558) [3540 nt, 1180 aa]
          Length = 1179

 Score =  154 bits (388), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 131/510 (25%), Positives = 233/510 (45%), Gaps = 34/510 (6%)

Query: 789  YRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQ 848
            +R A +KEL    +H T+       V   +  + + +  +FT K DG  K R VA+G +Q
Sbjct: 685  WRAACLKELSAFKEHQTFSL-----VPPPSDGRSLGTRWVFTIKDDGRKKARLVAQGFRQ 739

Query: 849  NAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHL- 907
              G       A  I ++++   +A+A   ++ I Q+D+++A+L +D++E +Y++ PP   
Sbjct: 740  KEGIDYTETFAPVIRYDSVRVFLALACCLNLRIHQMDVNTAFLNSDMEESVYVKQPPGFI 799

Query: 908  ----GHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFK---NEDLI 960
                 H+  ++KL   +YGLKQ+   W ++I + LT      N + +   FK   +  L 
Sbjct: 800  DSDPAHEGWVWKLHGGMYGLKQAPLLWNKHINRSLTSLGFTRNEKEFGLYFKQTADGPLF 859

Query: 961  VCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSK 1020
            V L+VDD+++     +      + L+  Y  K +  G + K        LG+ IT   + 
Sbjct: 860  VALYVDDLLIAAPSPRIISLTKKKLQEIYSMKDL--GPVSK-------FLGMNITQFPNG 910

Query: 1021 SLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKL 1080
            +++  +   + +        L+   +++  P  P I   DS      +   + +   Q +
Sbjct: 911  NITLSLADYIAKAAADQQTPLH---KKVHIPLSPTINYFDSN-----SPAAKNITTYQSI 962

Query: 1081 VGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKER 1140
            VG   ++    R D+ Y +++L++    P    L+  ++++QY++ TR   L +      
Sbjct: 963  VGQLIFIANAGRPDIAYAVSLLSRFLKDPRVVHLNAAHRVLQYLYTTRFHGLAYRAGSPL 1022

Query: 1141 NTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTK-ATLTCISSTESELYAISMV 1199
                 +  +  + A+ P   S  GY   +    +T  S K  T  C+SSTE+E  A S  
Sbjct: 1023 QLTVYSDASHGSLADMPF--STGGYVTRLAGGCVTWSSKKIKTTVCLSSTEAEYIAASEA 1080

Query: 1200 IPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKY 1259
            +  +  +  L   +     K KL  D+ PAI  ++       R K+   R  KIR  V+ 
Sbjct: 1081 VKEIEWLGDLTTVMDLTLNKTKLYVDNEPAIK-LSKNPVMHPRTKHIALRYHKIRHAVEQ 1139

Query: 1260 SHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
              + LEYVNT +  ADILTK L   +F  L
Sbjct: 1140 DIVDLEYVNTKDQQADILTKILAKSQFETL 1169

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 74/174 (42%), Gaps = 6/174 (3%)

Query: 198 CPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSR 257
           CP C  GK    K    SR KY    +  + +  DL G        S  YF++  D  +R
Sbjct: 40  CPTCSLGKGLIKKG-TNSRTKYT---SPLQLIQVDLCGNFRYKEYQSNRYFMTIRDAYTR 95

Query: 258 FRWVFPLRSK-DASTVTTVFRNIVATFGTQFDT-KVLVFQMDRGSEFTNAEIRHFFRENG 315
           +  V  L++K DA+     + N    F T   + KV   + D G EF N  +  +    G
Sbjct: 96  YYTVIHLKTKKDATQKLIDWINQTENFFTSRGSYKVGSIRTDNGGEFKNNILHEYMTSKG 155

Query: 316 IQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRN 369
           I    T    S  +G  ER +RT+ +  R LL S  + P LW  +V  A  + N
Sbjct: 156 ITHELTIPYSSFQNGAVERAHRTIEERTRCLLISGRVPPQLWSEAVSCAVYLIN 209

>Kpol_440.15 s440 (39287..39952,39954..40301) [1014 bp, 337 aa] {ON}
            (39287..39952,39954..40301) [1014 nt, 338 aa]
          Length = 337

 Score =  140 bits (354), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/357 (29%), Positives = 187/357 (52%), Gaps = 28/357 (7%)

Query: 811  IYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTC 870
            ++D+K   P+  +      + KRDGTHK R V RGD+Q   TY   +  + +  + L   
Sbjct: 2    VFDLKAGIPRNQV------SIKRDGTHKARIVCRGDRQTPSTYG-VIHTDLLQMDTLKLL 54

Query: 871  MAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANW 930
            + IA +N M + +LDI+ A+LYADL+E +YI   PH    NK+ +L K+LYGLKQS   W
Sbjct: 55   LMIANNNRMVVQKLDINHAFLYADLQEVIYI---PHPYEPNKVVQLNKALYGLKQSPKEW 111

Query: 931  YENIKKYLTEDCGMSNIRGWPCAF--KNEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLR 988
             ++++KYL  DC + +    P  F  K + +I+ ++V D I+  K +      +  LK  
Sbjct: 112  NDHLRKYLN-DCSLYDTEYTPGLFIDKEKSIIIAVYVVDCIIAAKNNIILKRFINKLKET 170

Query: 989  YETKVVNDGKIEKAESRDYDILGLEITYRRSKS-LSFGMEKSLEQKIPSLGVTLNSEKRR 1047
            +E K+V  G +EK   +  D LG+++ Y  +K  +S  +E  L       G+  +     
Sbjct: 171  FELKLV--GTMEKGILKT-DTLGMDLDYNITKGEISLSLETYLR------GIKNDWIDEL 221

Query: 1048 MKAPGQPGIILSDSKLD----MSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILA 1103
             K    P     ++K +    +S++  K   K +Q + G+ + +  + RYD+ +  N L 
Sbjct: 222  KKIDNSPHWSSYNNKNELIPILSKSRKKEMTKKLQIMSGIINSILTRCRYDIAFAANKLG 281

Query: 1104 QHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYK 1160
            +    P+ Q + +  ++ +Y++ T+N++LI+ +  E +   +  ITDA+   + G+K
Sbjct: 282  RLVNSPNEQSIKIADKISKYLFTTKNRKLIYLRENE-SKPIIEIITDASLGTEWGFK 337

>Kpol_1066.34 s1066 complement(55995..56357) [363 bp, 120 aa] {ON}
           complement(55995..56357) [363 nt, 121 aa]
          Length = 120

 Score =  130 bits (328), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (80%)

Query: 869 TCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGA 928
           TC    L + +FIVQLDISS YLYA+LKEELYIRTPPHLGHKNK+FK++KSLYGLKQS  
Sbjct: 5   TCQTGQLIHKLFIVQLDISSPYLYANLKEELYIRTPPHLGHKNKVFKVQKSLYGLKQSSG 64

Query: 929 NWYENIKKYLTEDCGMSNIRGWPC 952
           NWYENIKK+ TE CGMS+     C
Sbjct: 65  NWYENIKKFRTETCGMSSCCNLKC 88

>NDAI0I02670 Chr9 (625423..630015) [4593 bp, 1530 aa] {ON} 
          Length = 1530

 Score =  145 bits (366), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 128/513 (24%), Positives = 237/513 (46%), Gaps = 34/513 (6%)

Query: 785  EKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKI-INSMIIFTTKRDGTHKCRFVA 843
            E + +  A  +EL     H+      IY++  +   +I + +  +FT K +  HK R VA
Sbjct: 1036 ESDSWLTACQQELQAFRDHD------IYELVRLPSGRIPLGTRWVFTLKDNHRHKARLVA 1089

Query: 844  RGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRT 903
            +G +Q  G       A  I ++++   +AI+    + + Q+D+ +A+L +++ E +Y++ 
Sbjct: 1090 QGFKQVEGIDYQETFAPVIRYDSVRVFLAISACLGLRVHQMDVDTAFLNSEIDEPVYVKQ 1149

Query: 904  PP---HLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNED-- 958
            PP    L H + ++KL+  +YGLKQ+   W ++I   LT   G +   G  C +  +   
Sbjct: 1150 PPGFEDLQHPDWVWKLKGGMYGLKQAPLLWNKHIHTSLTS-LGFNRHPGEHCLYYKDTSE 1208

Query: 959  --LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITY 1016
              + V L+VDD+++     +      Q L   Y  K +  G I K        LG   + 
Sbjct: 1209 GPVFVALYVDDLLIAAPSPRIMKLAKQALNNIYSMKDL--GPINK-------FLGTNCSQ 1259

Query: 1017 RRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKL 1076
             +  +++  M   + +   ++    N  K+    P   G        D++    +  +K 
Sbjct: 1260 DKDGNITLKMTDYITKATDAMD---NESKKPTYNPMSGG----KDYFDITSPPVQ-SIKA 1311

Query: 1077 MQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPK 1136
             Q ++G   ++    R D+ + ++ L++    P    +    ++++Y++ TR+  + +  
Sbjct: 1312 YQSIIGQLLFIANAGRPDVAFPVSFLSRFLKDPREVHMDAATRIMRYLYTTRDYGIRYRS 1371

Query: 1137 AKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAI 1196
              +R     T  +  A  + P   S    F+        +R  ++T+ C+SSTE+E  A 
Sbjct: 1372 KLKRQLTVYTDASQGAAWDMPFSTSGYATFLAGGAITWCSRRIRSTI-CLSSTEAECIAA 1430

Query: 1197 SMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDE 1256
            S  +     +  L+E +     +N L+ D+ PAI +  S      R K+   R  KIR+ 
Sbjct: 1431 SEAVLETMWLYNLLEHMGYPLSENLLVIDNEPAIKLA-SHPILHSRTKHIKLRYHKIREA 1489

Query: 1257 VKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
            V    +K+EYVNT + +ADILTKALP K+FN L
Sbjct: 1490 VDDGIVKIEYVNTLDQVADILTKALPQKQFNHL 1522

 Score = 62.8 bits (151), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 79/178 (44%), Gaps = 14/178 (7%)

Query: 198 CPDCLKGKSTQHKHYVGSRVKYQREYNT-FEFLHTDLFGPVPNMPTSSPTYFISFTDEQS 256
           CP C     +  K  + + +   +EY++  + +  DL G        +  YF++  D  S
Sbjct: 381 CPTC-----SLSKGLISTGILSTQEYSSPLQLIQVDLCGNFRYNEFQAHNYFLTIRDAYS 435

Query: 257 RFRWVFPLRSK-DASTV----TTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFF 311
           R+  V  L++K DA+       T   N    F  +   KV   + D G EF N ++  FF
Sbjct: 436 RYYAVIHLKNKSDAAQALIDWVTAQENY---FSHRGGYKVAAVRSDNGGEFCNDQLNIFF 492

Query: 312 RENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRN 369
           +  GIQ   T    S  +G AER +R++ +  R LL    + P LW  +V  A  + N
Sbjct: 493 KNKGIQHQLTIPHQSFQNGGAERAHRSIQEKARCLLLGGRVPPSLWAEAVSTAVYLLN 550

>Suva_10.195 Chr10 (373045..373104,373108..373407) [360 bp, 120 aa]
            {ON} YNL054W-B (REPEAT)
          Length = 120

 Score =  129 bits (323), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 86/121 (71%), Gaps = 3/121 (2%)

Query: 985  LKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSE 1044
            LK +Y+TK +N G+   AE   YDILGLEI YRR K +  G+E SL  K+P + V LN +
Sbjct: 2    LKRQYDTKTINLGE---AEGEIYDILGLEIKYRRGKYMKLGIESSLTDKLPKVNVPLNPK 58

Query: 1045 KRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQ 1104
             +++ APGQPG+ ++  +L + E +Y  KV  MQ L+GLASY+GYK+R+DLLYYIN LAQ
Sbjct: 59   GKKISAPGQPGLYINKEELKLDEDDYNSKVHKMQMLIGLASYVGYKFRFDLLYYINTLAQ 118

Query: 1105 H 1105
            H
Sbjct: 119  H 119

>Suva_3.98 Chr3 complement(142812..143252) [441 bp, 147 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 147

 Score =  129 bits (324), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 92/147 (62%), Gaps = 4/147 (2%)

Query: 86  NIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM---LPARS 142
           NI YDL SL +L    I A+FS  +L+  +  ++A +++HG FYWLS  +LM   LP ++
Sbjct: 1   NIAYDLFSLTKLACQNITANFSNNTLQRSEGTILAPIVQHGDFYWLSKDFLMPSNLPTKT 60

Query: 143 RNHRINN-ILPRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDC 201
            N+  NN    ++ +  IHR+ GH N + I+ S+++  I  I   + DWS   T+QCPDC
Sbjct: 61  INNVDNNKSTQKYPYPLIHRMLGHANARTIRHSLKRNSITYIKESDGDWSNATTYQCPDC 120

Query: 202 LKGKSTQHKHYVGSRVKYQREYNTFEF 228
           L GKST+HKH  GSR+KYQ  Y  F++
Sbjct: 121 LIGKSTKHKHLKGSRLKYQEAYEHFQY 147

>Smik_1.82 Chr1 complement(155637..157145) [1509 bp, 503 aa] {ON}
           YPL060C-A (REPEAT)
          Length = 503

 Score =  138 bits (347), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/337 (29%), Positives = 152/337 (45%), Gaps = 18/337 (5%)

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDW-SGFDTFQCPDCLKGKSTQHKHYVGSRVK 218
           H   GH  I+ IK+SI+    +    +N+D     + F C  C   K+T+  HY GS  +
Sbjct: 67  HNRMGHTGIQQIKNSIKHSHYE----ENLDLIKEPNEFWCETCKVSKATRRNHYKGSMNE 122

Query: 219 YQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRN 278
           +  ++        D+FGPV N  + +  Y +   D  +R+       +K+A T+    + 
Sbjct: 123 HSIDHEPGSSWCMDIFGPVSNSNSDTKRYMLIMVDNNTRYCITSTHFNKNAETILAQIKK 182

Query: 279 IVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRT 338
            +    TQFD KV     D+G+EFTN +I  +F   GI   +++  D  A+G AER  RT
Sbjct: 183 NIQYVETQFDRKVREINSDQGTEFTNDQIAKYFVSKGIHHIFSATQDHAANGRAERYIRT 242

Query: 339 LLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLN--TTYKTXXXXXXXXXXXXXXTILP 396
           ++ D  TLL+ S L    W Y+V  AT +RN L N  T                  + LP
Sbjct: 243 IVTDATTLLKHSKLRIKFWEYAVTSATNVRNCLENKATGQLPLQAISSQPVKVRFMSFLP 302

Query: 397 FGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYV-------- 448
           FG+  I  + N  +KL   G     L     SHGY  +VP + K+L + NY         
Sbjct: 303 FGEQGIIWNHNH-NKLKPSGLRAIILCKDPNSHGYKFFVPSIKKILTSDNYTIPDYAVDP 361

Query: 449 VIRSDTNISADHNYDSTVFDPLMQS--IARPYDDFLN 483
           ++R+  NI  D    S   +    S  ++R YD   N
Sbjct: 362 ILRNTQNIYPDDQSRSDSINEAENSDAVSRLYDALEN 398

>Kpol_462.1 s462 complement(798..5978) [5181 bp, 1726 aa] {ON}
            complement(798..5978) [5181 nt, 1727 aa]
          Length = 1726

 Score =  142 bits (358), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 129/510 (25%), Positives = 233/510 (45%), Gaps = 34/510 (6%)

Query: 789  YRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQ 848
            +R A +KEL    +H T+       V   +  + + +  +FT K DG  K R VA+G +Q
Sbjct: 1232 WRAACLKELSAFKEHKTFSL-----VPPPSDARSLGTRWVFTIKDDGRKKARLVAQGFRQ 1286

Query: 849  NAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHL- 907
              G       A  I ++++   +A+A   ++ I Q+D+ +A+L + +++ +Y++ PP   
Sbjct: 1287 KEGIDYTETFAPVIRYDSVRVLLALACCLNLRIHQMDVDTAFLNSQMEDAVYVKQPPGFI 1346

Query: 908  ----GHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFK---NEDLI 960
                 H+  ++KL   +YGLKQ+   W ++I + LT      N + +   FK   +  L+
Sbjct: 1347 DSDPAHEGWVWKLHGGMYGLKQAPLLWNKHINRSLTALGFTRNEKEFGLYFKQTADGPLL 1406

Query: 961  VCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSK 1020
            + L+VDD+++     +      Q L+  Y  K +  G + K        LG+ IT   + 
Sbjct: 1407 IGLYVDDLLIAAPSPRILSLTKQKLQELYSMKDL--GPVSK-------FLGMNITQFSNG 1457

Query: 1021 SLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKL 1080
            +++  +   + +        L+   +++  P  P I   D K  ++E      +   Q +
Sbjct: 1458 NITLSLADYITKAAADQQTPLH---KKVHIPLSPTINYFDDKSPVAE-----NITAFQSI 1509

Query: 1081 VGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKER 1140
            VG   ++    R D+ Y +++L++    P    +S  ++++QY++ TR   L +      
Sbjct: 1510 VGQLIFIANAGRPDIAYSVSLLSRFLKDPRVVHVSAAHRVMQYLYTTRFHGLGYRAGSPL 1569

Query: 1141 NTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTK-ATLTCISSTESELYAISMV 1199
                 +  +  + A+ P   S  GY   +    +T  S K  T  C+SSTE+E  A S  
Sbjct: 1570 QLTVYSDASHGSLADMPF--STGGYVTRLAGGCVTWSSKKIKTTVCLSSTEAEYIAASEA 1627

Query: 1200 IPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKY 1259
            +  +  +  L   +     K +L  D+ PAI  ++       R K+   R  KIR  V+ 
Sbjct: 1628 VKEIEWLCDLTAVMDFKLDKTRLYVDNEPAIK-LSKNPVMHPRTKHIALRYHKIRHAVEQ 1686

Query: 1260 SHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
              + LEYVNT +  ADILTK L   +F  L
Sbjct: 1687 DIVDLEYVNTKDQQADILTKVLAKYQFEAL 1716

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 82/212 (38%), Gaps = 13/212 (6%)

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKY 219
           H  FGH  I+      R   +  +  +NI         CP C  GK    K    SR  Y
Sbjct: 529 HSRFGHPGIEAYNSLARTFSLPRMHPENIT-------VCPTCSLGKGLIKKGG-NSRTTY 580

Query: 220 QREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTV--FR 277
               +  + +  DL G        S  YF++  D  SR+  V  L +K  +T   +    
Sbjct: 581 S---SPLQLIQVDLCGNFRYKEYRSNRYFMTIRDAYSRYYTVIHLNAKKDATQELIDWIN 637

Query: 278 NIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNR 337
                F ++   KV   + D G EF N  +  +    GI    T    S  +G  ER +R
Sbjct: 638 RTENFFSSRGGHKVGSIRTDNGGEFKNNVLHEYLISKGITHELTIPYSSFQNGAVERAHR 697

Query: 338 TLLDDCRTLLESSGLSPHLWFYSVEFATLIRN 369
           T+ +  R LL S  + P LW  +V  A  + N
Sbjct: 698 TIEERTRCLLISGRVPPELWSEAVSCAVYLIN 729

>Kwal_47.17033 s47 complement(218594..218947) [354 bp, 117 aa] {ON}
           YDR261W-B - TyB Gag-Pol protein [contig 215] FULL
          Length = 117

 Score =  126 bits (316), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 71/115 (61%)

Query: 202 LKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWV 261
           + GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWV
Sbjct: 1   MAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWV 60

Query: 262 FPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGI 316
           FPL  K    V  VFR ++A    Q   KV   QMD+GSE+TN   R F    GI
Sbjct: 61  FPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGSEYTNQSTRMFLANEGI 115

>TPHA0I03315 Chr9 (735235..735657) [423 bp, 140 aa] {ON}
          Length = 140

 Score =  126 bits (317), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 86/123 (69%), Gaps = 2/123 (1%)

Query: 1077 MQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPK 1136
            MQ+ + LASY+GYK+ +D+LY +N LA+HTLYPS QV+    +L+Q++W TR+KRL+W K
Sbjct: 1    MQQTITLASYIGYKFWFDILYCVNCLARHTLYPSKQVIRFFKELLQFLWQTRSKRLVWNK 60

Query: 1137 --AKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELY 1194
                + +   +T I DA+FA Q  YKSQ   FI +N+ +I A S+K  LTC SS ++ELY
Sbjct: 61   RDKTDDDANYITGIVDASFAKQEEYKSQYRAFIQLNSNMIGAVSSKLKLTCASSIKTELY 120

Query: 1195 AIS 1197
             IS
Sbjct: 121  GIS 123

>Kwal_23.3714 s23 (401122..401952) [831 bp, 276 aa] {ON} YJL113W -
           TyB Gag-Pol protein [contig 254] FULL
          Length = 276

 Score =  131 bits (329), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 95/161 (59%), Gaps = 1/161 (0%)

Query: 296 MDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPH 355
           MD+GSE+TN   R F    GI   YTSVGDS +HG+AERLN TL++DCRT+L+ S +  H
Sbjct: 1   MDKGSEYTNQSTRMFLANEGIDAYYTSVGDSSSHGIAERLNLTLMNDCRTILKGSKMPKH 60

Query: 356 LWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPI-DKLHV 414
           LWF++V+ A   RN+L N T  T               +  FGQ  + HD + +  KL  
Sbjct: 61  LWFHAVKTACNHRNSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQPCMVHDYSALKKKLKE 120

Query: 415 RGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 121 RSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 161

>Kwal_23.3717 s23 (402155..402676) [522 bp, 173 aa] {ON} YER160C -
           TyB Gag-Pol protein [contig 254] FULL
          Length = 173

 Score =  127 bits (318), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 64/126 (50%), Positives = 82/126 (65%), Gaps = 1/126 (0%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 34  KRKRINYIRAIRHAKMKA-EIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 92

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHE 865
           WD S   D+  V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HE
Sbjct: 93  WDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHE 152

Query: 866 ALMTCM 871
           AL  C+
Sbjct: 153 ALTPCV 158

>Suva_4.242 Chr4 complement(428432..431371) [2940 bp, 979 aa] {ON}
           YPL060C-A (REPEAT)
          Length = 979

 Score =  139 bits (351), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 102/356 (28%), Positives = 162/356 (45%), Gaps = 21/356 (5%)

Query: 154 FSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDW-SGFDTFQCPDCLKGKSTQHKHY 212
            S +  H+  GH  ++ I++SI+    +    ++ID     + F C  C   K+T+  HY
Sbjct: 47  ISLKDAHKRMGHTGVQQIENSIKHSHYE----ESIDLIKEPNEFWCETCKVSKATRRNHY 102

Query: 213 VGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTV 272
            GS  ++  ++        D+FGPV N    +  Y +   D  +R+       +K+A T+
Sbjct: 103 AGSMNEHSIDHEPGSSWCMDIFGPVSNSNLDTKRYMLIMVDNNTRYCITSTHFNKNAETI 162

Query: 273 TTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVA 332
               +  +    TQFD KV     D+G+EFTN +I  +F   GI   +++  D  A+G A
Sbjct: 163 LAQIKKNIQYVETQFDRKVREINSDQGTEFTNDQIAKYFVSKGIHHIFSATQDHAANGRA 222

Query: 333 ERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKT--XXXXXXXXXXXX 390
           ER  RT++ D  TLL+ S L    W Y+V  AT +RN L N T                 
Sbjct: 223 ERYIRTIVTDATTLLKHSNLRIKFWEYAVISATNVRNCLENKTTGQLPLKAISSQPVKVR 282

Query: 391 XXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYV-- 448
             + LPFG+  I  + N  +KL   G     L     SHGY  +VP + K++ + NY   
Sbjct: 283 FMSFLPFGEQGIIWNHNH-NKLKPSGLSAIILCKDPNSHGYKFFVPSIKKIVTSDNYTIP 341

Query: 449 ------VIRSDTNISADHNYDSTVFDPL--MQSIARPYD---DFLNDTSAPALIDD 493
                 ++R+  NI  D    S  F+    + +++R YD   D+ +D     L+ D
Sbjct: 342 DYAVDPILRNTQNIYLDDQSRSDTFNEAENIDAVSRLYDSLEDYEDDHKQVTLLTD 397

 Score =  131 bits (330), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/224 (33%), Positives = 129/224 (57%), Gaps = 7/224 (3%)

Query: 773 YRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTK 832
           Y +AIS N +++EK  Y++AY KEL  L   N +D    Y+  +V    II +  IF+ K
Sbjct: 761 YNEAISRNVDLKEKHAYKEAYRKELQNLKDMNVFDVDVKYNRSDVPSNLIIPTNTIFSKK 820

Query: 833 RDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLY 892
           R+G +K R V RGD Q   TY + +   +++H  +   + IA + +MF+  LDI+ A+LY
Sbjct: 821 RNGIYKARIVCRGDIQTPDTY-NVIGTESLNHNHIKIFLMIANNRNMFMKTLDINHAFLY 879

Query: 893 ADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPC 952
           A L+E++YI   PH   +  + KL K+LYGLKQS   W +++++YL    G+ +    P 
Sbjct: 880 AKLEEDIYI---PHPHDRRCVVKLNKALYGLKQSPKEWNDHLRRYLNS-IGLKDNTYTPG 935

Query: 953 AFKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVV 994
            ++ +D  L++ ++VDD ++     ++  D +  L+  +E K+ 
Sbjct: 936 LYQCKDKKLMIAVYVDDCVIAASDEQRLDDFINNLENTFELKIT 979

>YPL060C-A Chr16 complement(439428..442742) [3315 bp, 1104 aa] {OFF}
           TyA Gag protein; the main structural constituent of
           virus-like particles (VLPs)
          Length = 1104

 Score =  134 bits (338), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 98/324 (30%), Positives = 144/324 (44%), Gaps = 20/324 (6%)

Query: 154 FSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYV 213
            + E  H+  GH  I+ I++SI+    +  S D I     + F C  C   K+T+  HY 
Sbjct: 555 ITLEDAHKRMGHTGIQQIENSIKHNHYEE-SLDLIKEP--NEFWCQTCKISKATKRNHYT 611

Query: 214 GSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVT 273
           GS   +  ++        D+FGPV +    +  Y +   D  +R+       +K+A T+ 
Sbjct: 612 GSMNNHSTDHEPGSSWCMDIFGPVSSSNADTKRYMLIMVDNNTRYCMTSTHFNKNAETIL 671

Query: 274 TVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAE 333
              R  +    TQFD KV     DRG+EFTN +I  +F   GI    TS  D  A+G AE
Sbjct: 672 AQIRKNIQYVETQFDRKVREINSDRGTEFTNDQIEEYFISKGIHHILTSTQDHAANGRAE 731

Query: 334 RLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXT 393
           R  RT++ D  TLL  S L    W Y+V  AT IRN L    +K+              T
Sbjct: 732 RYIRTIVTDATTLLRQSNLRVKFWEYAVTSATNIRNCL---EHKSTGKLPLKAISRQPVT 788

Query: 394 I-----LPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYV 448
           +     LPFG+  I  + N   KL   G     L     S+GY  ++P  +K++ + NY 
Sbjct: 789 VRLMSFLPFGEKGIIWNHNH-KKLKPSGLPSIILCKDPNSYGYKFFIPSKNKIVTSDNYT 847

Query: 449 V--------IRSDTNISADHNYDS 464
           +        +R+  NI   H + S
Sbjct: 848 IPNYTMDGRVRNTQNIYKSHQFSS 871

>Kwal_34.16304 s34 (280776..281711) [936 bp, 311 aa] {ON} YOL103W-B
           - TyB Gag-Pol protein [contig 710] FULL
          Length = 311

 Score =  124 bits (311), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 111/218 (50%), Gaps = 19/218 (8%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 75  PQMFLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 131

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 132 KLEAYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLSTD--- 188

Query: 138 LPARSRNHRINNIL---------PRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNI 188
               ++   INNI           +   E +H    H+N+K I+ S+  GLIK+++  ++
Sbjct: 189 --VATKCKHINNIRGIKSLIKPGKKIPLEILHESLSHINVKYIRKSVELGLIKDVTISDV 246

Query: 189 DWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTF 226
           DWS  + F+C  C+ GK  +H H         RE   F
Sbjct: 247 DWSELEWFECESCMAGKGKRHNHNCQLTRHISREICRF 284

>Kwal_47.19344 s47 (1199885..1200262) [378 bp, 125 aa] {ON} YAR009C
           - TyB Gag-Pol protein [contig 344] FULL
          Length = 125

 Score =  112 bits (280), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (64%)

Query: 241 PTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGS 300
           P+  P YFI+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+GS
Sbjct: 19  PSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDKGS 78

Query: 301 EFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLN 336
           E+TN   R F    GI   YTSVGDS +HG+AERLN
Sbjct: 79  EYTNQSTRMFLANEGIDAYYTSVGDSSSHGIAERLN 114

>Suva_10.196 Chr10 (373428..373835) [408 bp, 135 aa] {ON} YNL054W-B
            (REPEAT)
          Length = 135

 Score =  112 bits (279), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 81/112 (72%), Gaps = 1/112 (0%)

Query: 1116 LTYQLIQYIWDTRNKRLIWPKAK-ERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKII 1174
            +TY+LIQY+WDTR+K+LIW K+K ++   ++  I DA++ NQ  Y+ Q+G  IL+N K+I
Sbjct: 1    MTYELIQYLWDTRDKQLIWHKSKPKKRENKLVTIRDASYGNQLYYRPQIGNIILLNRKVI 60

Query: 1175 TARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDS 1226
              +STKA+LTC S+TESE++A+S  IPLLN++  L++ +    +   L TDS
Sbjct: 61   GGKSTKASLTCTSTTESEIHAVSEAIPLLNNLSYLVQELDKKPIIKGLFTDS 112

>Kwal_13.687 s13 complement(1533..1835) [303 bp, 100 aa] {ON}
           YAR009C - TyB Gag-Pol protein [contig 292] PARTIAL
          Length = 100

 Score =  109 bits (272), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 59/73 (80%)

Query: 865 EALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLK 924
           E++ TC+AI L+    I QLDI+SAYLYA LKEELYI+ PPH G ++K+FKL KSLYGLK
Sbjct: 26  ESMTTCLAITLEQGWTIKQLDITSAYLYAPLKEELYIKAPPHYGLRDKVFKLNKSLYGLK 85

Query: 925 QSGANWYENIKKY 937
           QSGANWYE IK Y
Sbjct: 86  QSGANWYEVIKNY 98

>KNAG0G00960 Chr7 complement(191524..192205,192207..194551) [3027 bp,
            1008 aa] {ON}  Ty-like protein; ribosomal frameshifting
            site uncertain
          Length = 1008

 Score =  122 bits (306), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 121/524 (23%), Positives = 237/524 (45%), Gaps = 43/524 (8%)

Query: 772  SYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTT 831
            +Y++A+ S     + EL+  A  +E+D L++   ++  R+   ++  P + + S+     
Sbjct: 509  TYKEAMGST----DHELWSAACKREMDSLVRTKPFEEIRLPPGRKAIPARWVLSI----- 559

Query: 832  KRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYL 891
            K  G +K R V +G +Q  G   D   A  I +E++   +AI     + + Q+D+ +A+L
Sbjct: 560  KDSGLYKARVVVQGFRQTEGLDYDETFAPVIRYESVRLFLAIFACQGVKVHQMDVVTAFL 619

Query: 892  YADLKEELYIRTP-PHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGW 950
             + + +EL+++ P  +    + ++KL  +LYGLKQS   W E+IK  L       +   +
Sbjct: 620  NSPIDKELFVKPPVSYKSTGDSVWKLRSALYGLKQSPLLWNEHIKGKLLTQGFTQHPSEF 679

Query: 951  PCAFKNEDLIVC---LFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDY 1007
               F+     +C   L+VDD+++  +   +   + + L   YE K  + G++ K      
Sbjct: 680  GLYFRRRAGKLCLIALYVDDLLISSQSDAEIAAIKRFLLSTYEMK--DLGEVNK------ 731

Query: 1008 DILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGI-ILSDSKLDMS 1066
              LG+ +   + K ++  +   + +K+  LG+T          P Q  +    +S   M+
Sbjct: 732  -FLGMSVAQTKGK-ITLSLCDYITKKVTELGLT---NFHPTHTPLQKHVDYYGESPCSMT 786

Query: 1067 EAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQV-LSLTYQLIQYIW 1125
                       Q L+G   ++    R D+ + ++ L++  L  S +V  +   +++ Y+ 
Sbjct: 787  A---------YQSLIGTLLFVANSGRPDVAHSVSFLSRF-LKDSREVHYNAAKRIMAYLH 836

Query: 1126 DTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTC 1185
             T+N+ + +          +   TDA++A+    +S  GY        ++  S +     
Sbjct: 837  TTKNQEITY---HNNGKPYLEIFTDASYADCSNGQSTYGYMAKYGGGPVSWCSKRIPCVV 893

Query: 1186 ISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKY 1245
            +S+TE+ + A   V  +L  +  ++  +   + ++ L  ++AP I ++        R K+
Sbjct: 894  VSTTEAFVAANESVKEIL-WLDEILGILGIPKERHILYVNNAPTIKMLK-HPVFHSRTKH 951

Query: 1246 FGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
               R   IR  +    LK EY NT N IADI TK L    F  L
Sbjct: 952  IRVRYHFIRQNLSEKLLKTEYANTRNQIADICTKMLEGPEFQYL 995

>Kwal_33.14867 s33 (850184..852346) [2163 bp, 720 aa] {ON} YLR035C-A -
            Ty ORF [contig 101] FULL
          Length = 720

 Score =  121 bits (303), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 124/530 (23%), Positives = 228/530 (43%), Gaps = 36/530 (6%)

Query: 771  MSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFT 830
            +SY +AI+ N +V E+  +  AY   +++L    +W+++       V  +++I     F 
Sbjct: 208  LSYDEAITYNGDVYERAWFSLAYELAVERLESLGSWNSASGIPTSSVGAEQLIELDFSFE 267

Query: 831  TKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAY 890
            T   G   CR     D ++  T     IA+   +   MT +++A +    I  +  S   
Sbjct: 268  TSPSGEKHCR--CEWDHRDLETVT---IAHNCPYVDFMTYLSVAFEKGWTIQHISTS--- 319

Query: 891  LYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGW 950
              +D    +Y++  PHL      +  +   Y         ++ I        G+S I G 
Sbjct: 320  -LSD-APNMYLKALPHL------YLFDTGFYFTAAPSFQLFDQICACNAIQKGVSRIMGS 371

Query: 951  P--CA--FKNED---LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEK-A 1002
            P  C   F++     L++C   + I +F  +      LV+ +K    + V    +  K  
Sbjct: 372  PGKCGVYFQSNSKGVLLMCHPGNSIFIFTSQQNLSRRLVKWIKKSSFSSVFQSHQEPKPG 431

Query: 1003 ESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEK-RRMKAPGQ--PGIILS 1059
             +  +   G+EI +   KS+ F ME+++ ++   L V    EK   +  P    P   + 
Sbjct: 432  VTAHFYEYGMEIKFTHGKSVKFNMEQAITEECRMLEVNRELEKYENIPGPAHHFPDRYIY 491

Query: 1060 DSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQ 1119
            +     +   ++RK + ++ +         K R+D+ YY+N+L  HT +PS  VLSL   
Sbjct: 492  NRAKVRALPLHERKERFLKSVCE-------KCRFDIAYYVNVLTDHTRHPSKDVLSLADW 544

Query: 1120 LIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARST 1179
             ++Y+  TR   L W     + T  + +  DA+   Q  Y SQ+G++ ++N   I   S 
Sbjct: 545  ALRYLRTTRKLELTWSNPCSQ-TLTLASTADASLGTQAHYLSQIGFYYMINGNAICGFSR 603

Query: 1180 KATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDET 1239
            +       +  +E  A+   +P L  IK L++ +  + V++ + TDS   I  +N+    
Sbjct: 604  RTEKELGFNNRAEALAVIASLPQLVKIKKLIKDLDID-VESCVFTDSKTVIHHVNNPHNI 662

Query: 1240 KLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
                  F      +  +++  +L L+YV +  N AD+LTK L    F  L
Sbjct: 663  CDSQDNFVENIKTLICQLRDHNLTLDYVCSKKNFADLLTKPLFYYEFKTL 712

>KNAG0L00780 Chr12 complement(133367..138013) [4647 bp, 1548 aa] {ON} 
          Length = 1548

 Score =  121 bits (304), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 116/489 (23%), Positives = 223/489 (45%), Gaps = 32/489 (6%)

Query: 808  NSRIYDVKEVNP-KKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEA 866
            +++ +++ ++ P ++ I +  +F+ K  G  K R V +G +Q AG       A  I +E+
Sbjct: 1074 DTKTFELVDLPPNRRAIPTKWVFSVKDSGLFKARLVVQGFRQTAGIDYHETFAPVIRYES 1133

Query: 867  LMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLG-HKNKIFKLEKSLYGLKQ 925
            +   +AIA   +M I Q+D+ +A+L + +  E+Y++  P     + K++KL  +LYGLKQ
Sbjct: 1134 VRLFLAIAARYNMSIHQMDVVTAFLNSPIDTEIYVKQAPGFNLDETKVWKLNSALYGLKQ 1193

Query: 926  SGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVC---LFVDDIIVFGKKHKKCMDLV 982
            S   W E+IK  L     + +   +   ++     +C   L+VDD+++     K+   + 
Sbjct: 1194 SPLLWNEHIKSTLRNVGFIQHPAEFGLYYRMTGTRLCLLALYVDDLLIASPSDKEINKIK 1253

Query: 983  QLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVT-L 1041
              L   Y  K +  G I+K        LG+ I  +    +S  +   +E+K+  LG   L
Sbjct: 1254 AYLSSVYRMKDL--GHIQK-------FLGMNIK-QSPGMISLSLHDYIEKKVRELGYKDL 1303

Query: 1042 NSEKRRMKAPGQPGIILSDSKLDMSEAEYK-RKVKLMQKLVGLASYLGYKYRYDLLYYIN 1100
                  ++  G+             EA  K   +   Q+L+G   ++    R D+ + ++
Sbjct: 1304 KPTHTPLQTHGR-----------YEEASPKISNITEYQRLIGTLLFVANTGRPDVAFSVS 1352

Query: 1101 ILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYK 1160
             L+     P    L    +++ Y+  T+++ +++   +  N  R    TDA++A+ P  K
Sbjct: 1353 YLSSFLKDPREVHLLGAKRVLAYLDSTKDQSIVY---QNDNKSRFDIYTDASYADTPEAK 1409

Query: 1161 SQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKN 1220
            S  GY +   +  ++  S K     +S+TE+E  A +  I     +  +++ +   +  +
Sbjct: 1410 STYGYVLKYADGSVSWASRKIPCVVLSTTEAEYVAANESIKETIWLDEILKCLKIPKDAH 1469

Query: 1221 KLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKA 1280
             L  D+  A+  +        + K+   R   IR+ VK + +   Y+NT    ADI TK 
Sbjct: 1470 NLYVDNESALESLK-HPVFHSKTKHIRVRYHFIRENVKGNVVIPSYINTKKQQADICTKI 1528

Query: 1281 LPAKRFNDL 1289
            L    F+ L
Sbjct: 1529 LARPDFDRL 1537

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 77/183 (42%), Gaps = 10/183 (5%)

Query: 191 SGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFIS 250
           S  DT  CP C  GK   HK     R          + + TDL G           YF++
Sbjct: 310 SAKDTPVCPTCAIGKGKIHK----GRHISSASTAPLQLIQTDLCGGFRYNECVDSKYFLT 365

Query: 251 FTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDT----KVLVFQMDRGSEFTNAE 306
            +D  SR+    PL+SK  +  T    N +    T FD+    KV   + D G EFTN  
Sbjct: 366 ISDSYSRYYSAIPLKSK--ADATKALINWIIAQETFFDSRGGYKVCAVRTDNGGEFTNHV 423

Query: 307 IRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATL 366
           +  FF + GI    T    S  +G  ER +RTL +  R LL    + P LW  ++  A  
Sbjct: 424 LHDFFAQRGIDHQLTVPHSSYQNGAVERAHRTLQERVRCLLLHGRVPPFLWSEALRCAVY 483

Query: 367 IRN 369
           + N
Sbjct: 484 LLN 486

>Kpol_377.1 s377 (245..1684) [1440 bp, 479 aa] {ON} (245..1684) [1440
            nt, 480 aa]
          Length = 479

 Score =  115 bits (289), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 103/424 (24%), Positives = 197/424 (46%), Gaps = 39/424 (9%)

Query: 789  YRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQ 848
            +R A +KEL    +H T+       V   +  + + +  +FT K DG  K R VA+G +Q
Sbjct: 78   WRAACLKELSAFKEHQTFSL-----VPPPSDGRSLGTRWVFTIKDDGRKKARLVAQGFRQ 132

Query: 849  NAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHL- 907
              G       A  I ++++   +A+A   ++ I Q+D+++A+L +D++E +Y++ PP   
Sbjct: 133  KEGIDYTETFAPVIRYDSVRVFLALACCLNLRIHQMDVNTAFLNSDMEESVYVKQPPGFI 192

Query: 908  ----GHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFK---NEDLI 960
                 H+  ++KL   +YG KQ+   W ++I + LT      N + +   FK   +  L 
Sbjct: 193  DSDPAHEGWVWKLHGGMYGFKQAPLLWNKHINRSLTALGFTRNEKEFGLYFKQTADGPLF 252

Query: 961  VCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSK 1020
            V L+VDD+++     +      + L+  Y  K  + G + K        LG+ IT   + 
Sbjct: 253  VALYVDDLLIAAPSPRIISLTKKKLQEIYSMK--DLGPVSK-------FLGMNITQFPNG 303

Query: 1021 SLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKL 1080
            +++  +   + +        L+   +++  P  P I   D     S +   + +   Q +
Sbjct: 304  NITLSLADYIAKAAADQQTPLH---KKVHIPLSPTINYFD-----SNSPAAKNITTYQSI 355

Query: 1081 VGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKER 1140
            VG   ++    R D+ Y +++L++    P    L+  ++++QY++ TR   L +   +  
Sbjct: 356  VGQLIFIANAGRPDIAYAVSLLSRFLKDPRVVHLNAAHRVLQYLYTTRFHGLAY---RAG 412

Query: 1141 NTQRVTAITDA---AFANQPGYKSQVGYFILVNNKIITARSTK-ATLTCISSTESELYAI 1196
            +  ++T  +DA   + A+ P   S  GY   +    +T  S K  T  C+SSTE+E  A 
Sbjct: 413  SPLQLTVYSDASHGSLADMP--FSTGGYVTRLAGGCVTWSSKKIKTTVCLSSTEAEYIAA 470

Query: 1197 SMVI 1200
            S  +
Sbjct: 471  SEAV 474

>TBLA0B08350 Chr2 (1999702..2001012) [1311 bp, 436 aa] {ON} 
          Length = 436

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 99/391 (25%), Positives = 195/391 (49%), Gaps = 19/391 (4%)

Query: 916  LEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNED--LIVCLFVDDIIVFGK 973
            L+K+LYGLKQS  NW E +++++       +    P  F + D    +  +VDD ++   
Sbjct: 5    LKKALYGLKQSPKNWNETLREFMNSH-DFYDTEFAPGLFVSSDGNKRIAAYVDDCVLAAD 63

Query: 974  KHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSL-SFGMEKSLEQ 1032
              +   +++++ K  +E K +     EK    + DILG+++ Y  +K + +  M+  +++
Sbjct: 64   TEEDLDEIIEMFKNTFEIKAIVIMNEEK--QLETDILGIDLKYDLNKGIITLSMKSYIDK 121

Query: 1033 --------KIPSLGVTLNSEKRRMKAP--GQPGIILSDSKLDMSEAEYKRKVKLMQKLVG 1082
                    K+      L +E+++   P   +  +  ++  L M++ EYK KVK +QK +G
Sbjct: 122  FNNDFPLLKLKEYENNLTTEQKKDLTPHFSEYNLNPNEDTLLMNKTEYKEKVKYIQKSIG 181

Query: 1083 LASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNT 1142
            + +YL  + R DL + ++ +A+   Y   +V+    +LI+Y +  R+  ++  + K +  
Sbjct: 182  MPNYLRTRGRLDLEFAVSKIARFAFYAHAKVIKAVDRLIKYTYVKRDLNVVIKREK-KQP 240

Query: 1143 QRVTAITDAAFANQPGYKSQVGYFILVNNKIITA-RSTKATLTCISSTESELYAISMVIP 1201
              +T ITDA+  ++   KS++G  I   N  +      K+++ C SS E EL A++    
Sbjct: 241  DEITVITDASLGSEYDVKSRIGGIIWFGNTFMFGFFKKKSSIVCDSSAECELDALNKGEK 300

Query: 1202 LLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSH 1261
            L   +K  +E +     K  +ITDS P +  +  +     R K+ G R  ++++ +K   
Sbjct: 301  LTLHLKFKLEKLFKKNFKINIITDSKPVLEWL-KKTYIGGRTKFLGIRIGRLKERLKDKS 359

Query: 1262 LKLEYVNTDNNIADILTKALPAKRFNDLTNV 1292
              L  ++   N+AD LTK + +  F +L+ +
Sbjct: 360  NFLRKIDGLENVADPLTKQVSSTDFKNLSKI 390

>Skud_7.460 Chr7 (755906..756418) [513 bp, 170 aa] {ON}  YNL054W-B
           (REPEAT)
          Length = 170

 Score =  107 bits (267), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (59%), Gaps = 6/144 (4%)

Query: 10  PNHVDDEFD-LPGYLLLDSGASTSIIRHSSLLHF--PQQPIHIGVQDAQDNPIPISSTGI 66
           PNHVD   D LP + L+DSGAS ++IR  + LH   P  PI   + DAQ   IPI++ G 
Sbjct: 15  PNHVDHSNDELPNHFLIDSGASQTLIRTVNHLHSASPNDPI--SLHDAQKQEIPINAIGN 72

Query: 67  LKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHG 126
           L F+F N     I+A  +PNI YDL+SL EL +  I A F+  +L   D  ++A ++KHG
Sbjct: 73  LHFNFQNDVQTSITALHTPNITYDLLSLSELANQNITACFTKNTLELSDGTILAPIVKHG 132

Query: 127 PFYWLSTKYLMLPARSRNHRINNI 150
            FYWLS  +L +P+  +    NN+
Sbjct: 133 DFYWLSKNFL-IPSTLQKQTANNV 155

>TBLA0E02365 Chr5 (590561..591022) [462 bp, 153 aa] {ON}
          Length = 153

 Score =  105 bits (261), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 64/94 (68%)

Query: 771 MSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFT 830
           +SY +AI+ N + +E++ +  AY KEL Q+ K  TWD + ++DVK V    IIN M IFT
Sbjct: 60  LSYHEAITMNNDTKERQEFIDAYNKELSQIRKTGTWDENNMFDVKSVLYSSIINMMFIFT 119

Query: 831 TKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHH 864
           TKR GT KC+ V+RGDQQ  GTYD    ANT+HH
Sbjct: 120 TKRHGTKKCKCVSRGDQQKPGTYDQDATANTVHH 153

>Kwal_47.17294 s47 complement(332940..333179) [240 bp, 79 aa] {ON}
           YGR161W-B - TyB Gag-Pol protein [contig 330] PARTIAL
          Length = 79

 Score = 99.8 bits (247), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/71 (64%), Positives = 57/71 (80%)

Query: 870 CMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGAN 929
           C+AIAL+    I QLDI+SAYLYA L++ELYI+ P H   ++K+F+L KSLYGLKQSGAN
Sbjct: 2   CLAIALEQGWTIRQLDITSAYLYAPLRKELYIKEPLHCELRDKVFELNKSLYGLKQSGAN 61

Query: 930 WYENIKKYLTE 940
           WYE IK YLT+
Sbjct: 62  WYEVIKNYLTK 72

>TPHA0O01180 Chr15 (229525..230487) [963 bp, 320 aa] {ON} 
          Length = 320

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 126/299 (42%), Gaps = 17/299 (5%)

Query: 208 QHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSK 267
           QH H   S  K+  +    +    D+ GP+         Y +   D  SRF  V    +K
Sbjct: 3   QHDHIKDSMNKHYEQMQPGQSWSLDIRGPLGKNLAKVDNYLLLMVDNVSRFLLVSTHTNK 62

Query: 268 DASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSR 327
           +  T++   +N +     Q+D  V    +DRGSEFTN  ++ +  E GI+   T   D  
Sbjct: 63  NKETISLQIKNNIQYIEKQYDRIVKELIVDRGSEFTNDSLKTYVSEKGIKLMLTDTNDHA 122

Query: 328 AHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKT--XXXXXXX 385
           ++  AER    + +D RTL+ +S L   LW Y+   A  IRN  +               
Sbjct: 123 SNARAERFIGIMNNDIRTLMHNSDLPWALWKYAALAAARIRNLFMTKKLNCSPMTTLSGK 182

Query: 386 XXXXXXXTILPFGQHV-ITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDT 444
                  + LPFG H  + + TN  +KL  +G     L     S GYL Y+P   KV+ T
Sbjct: 183 NEQIRFNSFLPFGAHAFVKNQTN--NKLTNQGIPAITLCKDPNSFGYLFYLPQTRKVIST 240

Query: 445 SNYVVIRSDTNISADHNYDSTVFDP--LMQSIARPYDDFLNDTSAPALIDDNSSEPDNS 501
            +Y++  S+ N            DP  ++  I    DD    TS  AL  +  +EP N+
Sbjct: 241 MSYILANSEVN--------GDFIDPNKVLSEIVPDNDDTNEVTSEDAL--EIEAEPSNA 289

>TDEL0H00120 Chr8 complement(3213..3533) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 97.4 bits (241), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/91 (52%), Positives = 63/91 (69%), Gaps = 1/91 (1%)

Query: 764 PSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKII 823
           P     S SY++A++ N N  EKE +  AY KE+ QL+K NTWDN ++ + ++V   KI+
Sbjct: 7   PHAERRSPSYKEAVTLNSNAEEKEKFIAAYEKEIGQLLKMNTWDNDKVVNTRDVRKNKIL 66

Query: 824 NSMIIFTTKRDGTHKCRFVARGDQ-QNAGTY 853
           N+M IFTTKRDGT K RFVARGDQ +N  TY
Sbjct: 67  NTMFIFTTKRDGTKKLRFVARGDQTKNRKTY 97

>TPHA0G00155 Chr7 (9997..10368) [372 bp, 123 aa] {ON}
          Length = 123

 Score = 97.4 bits (241), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 77/122 (63%)

Query: 1173 IITARSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISI 1232
            +I A S K  LTC SSTE+ELYAIS  IP + ++  L+  I G Q    + +DS   I+ 
Sbjct: 1    MIGAVSWKLKLTCASSTEAELYAISESIPRIANLSHLITEICGYQPTRTIYSDSQSGIAS 60

Query: 1233 INSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDLTNV 1292
            I S+D   L+NK++G R +KI +E K + + +EYVNT  NIA+ILTK +  K F +LT  
Sbjct: 61   IISKDAGILKNKFYGIRLLKIIEETKDNGINIEYVNTKENIANILTKPVETKTFKELTCD 120

Query: 1293 WM 1294
            W+
Sbjct: 121  WI 122

>TBLA0C00570 Chr3 (103399..104835) [1437 bp, 478 aa] {ON} 
          Length = 478

 Score =  105 bits (263), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 167/324 (51%), Gaps = 15/324 (4%)

Query: 980  DLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSL-SFGMEKSLEQ------ 1032
            +++++ K  +E KV+  G + + +  + DILG+++ Y  +K + +  M+  +++      
Sbjct: 133  EIIEMFKNTFELKVI--GIMNEEKQLETDILGIDLKYDLNKGIVTLSMKSYIDKFNDDFP 190

Query: 1033 --KIPSLGVTLNSEKRRMKAP--GQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLG 1088
              K+      L +E+++   P   +  +  ++  L M++ EYK KVK +QK +G  +YL 
Sbjct: 191  LLKLKEYENNLTTEQKKDLTPHFSEYNLNPNEDTLLMNKTEYKEKVKYIQKSIGKLNYLR 250

Query: 1089 YKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAI 1148
             + R DL + ++ + +  LYP  +V+    +L++Y +  R+  ++  + K +    +T I
Sbjct: 251  TRGRLDLEFAVSKITRFALYPHAKVIKTVDRLVKYTYVKRDLNVVMKREK-KQPDEITVI 309

Query: 1149 TDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKM 1208
            TDA+  ++   KS++G  I   N  +   S K+++ C SS E EL A++    L+  +K 
Sbjct: 310  TDASLGSEYDVKSRIGGIIWFGNTFMFGFSNKSSIVCDSSAECELDALNKGEKLVLHLKF 369

Query: 1209 LMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVN 1268
             +E +     K  +ITDS P I  +  +     R K+ G R  ++++ +K     L  ++
Sbjct: 370  KLEKLFKKNFKINIITDSKPVIEWL-KKPYIVGRTKFLGIRIGRLKERLKDKSTFLRKID 428

Query: 1269 TDNNIADILTKALPAKRFNDLTNV 1292
               N+AD LTK +    F +L+ +
Sbjct: 429  GLENVADPLTKPVSPTDFKNLSKI 452

>Kpol_381.2 s381 (6975..8186) [1212 bp, 403 aa] {ON} (6975..8186)
            [1212 nt, 404 aa]
          Length = 403

 Score =  103 bits (257), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 101/420 (24%), Positives = 194/420 (46%), Gaps = 29/420 (6%)

Query: 884  LDISSAYLYADLKEELYIRTPPHL---GHKNKIFKLEKSLYGLKQSGANWYENIKKYLTE 940
            +DI +A+L +   + +Y+R PP      H + ++KL   +YGLKQ+   W ++I K L  
Sbjct: 1    MDIDTAFLNSTKDDCVYVRQPPGFVNPSHPDWVWKLHGGVYGLKQAPLLWNKHINKSLI- 59

Query: 941  DCGMSNIRG-WPCAFKNE---DLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVND 996
            + G +   G +   F+N     L+V L+V D++V      + MD+ +  K++    + + 
Sbjct: 60   NLGFTRHEGEYGLYFRNTLDGILLVALYVVDLLV-ASPSARVMDVTKS-KIKSLYSIKDL 117

Query: 997  GKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGI 1056
            G + K        LG+ I+   +  +S  +   + +   + G  L+   +++  P  P +
Sbjct: 118  GPVSK-------FLGMNISQSSNGDISLSLADYISKAASTQGTPLH---KQVHTPLSPSV 167

Query: 1057 ILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSL 1116
               + K    E      +   Q +VG   ++    R D+ + +++L++    P    L+ 
Sbjct: 168  NYFNDKSSPVE-----DITSYQSIVGQLIFISNSGRPDVAHSVSLLSRFLKDPRVVHLNA 222

Query: 1117 TYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITA 1176
             ++++QY++  R + L +           +  +  +  + P   S  GY  L++   +  
Sbjct: 223  AHRVLQYLYTYRLRGLHYRTGSSLGLTVYSDASHGSLTDLPF--STGGYVTLLSGGCVIW 280

Query: 1177 RSTK-ATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINS 1235
             S K  T  C+SSTE+E  A S  +  +  +  L + +     + KL  D+ PAI++ + 
Sbjct: 281  SSKKIKTTICLSSTEAEYIAGSEAVKEIEWLSNLFKYMNLKFDQTKLFVDNEPAINL-SK 339

Query: 1236 QDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDLTNVWMV 1295
                  R K+   +  K+R  V+   L L+YVNT + +ADI+TK  P  +F  L N  +V
Sbjct: 340  NPVYHPRTKHIDLKFHKMRHVVEQGTLTLDYVNTKDQLADIMTKVFPRDKFESLRNELVV 399

>KNAG0M01670 Chr13 complement(303081..303899) [819 bp, 272 aa] {ON} 
          Length = 272

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 129/259 (49%), Gaps = 6/259 (2%)

Query: 1003 ESRDYDILGLEITYR-RSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIIL--S 1059
            E  D DILGL++ Y  R   +S  M   L +        +    +  K P      +   
Sbjct: 4    EKLDTDILGLDLKYDLRKGVISLDMRSYLTKLEEEYKNVIGDYGKIGKVPHVTSYKIHPK 63

Query: 1060 DSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQ 1119
            +   ++ + EYKRKVK +Q+L+G  +Y+  + R D+ + +    Q  LYP  +V+  T +
Sbjct: 64   EQVFEIDKTEYKRKVKYLQELIGKLNYVRSRGRLDIEFAVRKSCQLVLYPHPKVIEATEK 123

Query: 1120 LIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARST 1179
            + +Y++ T+   + + K        +T ++DA++  +   KS+ G  I + N      S 
Sbjct: 124  ITRYLFGTKTLGMTF-KRDVNKALNITVVSDASWNTEFDLKSRAGAAIWLENNFFYGFSK 182

Query: 1180 KATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKN-KLITDSAPAISIINSQDE 1238
            K+T+ C SS ESEL A++M   +   +K  +E I  N+ +   LITDSAPA+  +  QD 
Sbjct: 183  KSTIVCDSSAESELDALNMAEKIALFLKFKLEKICPNKKRKITLITDSAPALGWLK-QDY 241

Query: 1239 TKLRNKYFGARSMKIRDEV 1257
             K   K+ G R  ++++ V
Sbjct: 242  YKPHTKFIGLRVERLKERV 260

>Kwal_39.16392 s39 (2047..2574) [528 bp, 175 aa] {ON} YOR343C-B -
           TyB Gag-Pol protein [contig 349] FULL
          Length = 175

 Score = 97.4 bits (241), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 93/179 (51%), Gaps = 19/179 (10%)

Query: 23  LLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPVKIS 80
            L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +K+ 
Sbjct: 2   FLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVIKLE 58

Query: 81  AASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPA 140
           A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST       
Sbjct: 59  AYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLSTD-----V 113

Query: 141 RSRNHRINNILP---------RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDW 190
            ++   INNI           +   E +H    H+N+K I  S+  GLIK++   ++DW
Sbjct: 114 ATKCKHINNIRGIKSLIKPGRKIPLEILHESLSHINVKYIIKSVELGLIKDVKISDVDW 172

>Smik_13.226 Chr13 (361115..361414) [300 bp, 100 aa] {ON} YNL054W-B
            (REPEAT)
          Length = 100

 Score = 93.2 bits (230), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 66/99 (66%)

Query: 1196 ISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRD 1255
            +S  IPLLN++  L++ +    +   L+TDS   ISII S +E K RN++FG ++M++RD
Sbjct: 1    VSEAIPLLNNLSHLVQELNKKTIIKGLLTDSRSTISIIKSTNEEKFRNRFFGTKAMRLRD 60

Query: 1256 EVKYSHLKLEYVNTDNNIADILTKALPAKRFNDLTNVWM 1294
            EV  ++L + Y+ T  NIAD++TK LP K F  LTN W+
Sbjct: 61   EVSSNNLYIYYIETKKNIADVMTKPLPIKTFKRLTNKWI 99

>Kwal_2.432 s2 (4434..4706) [273 bp, 90 aa] {ON} YDR098C-B - TyB
            Gag-Pol protein [contig 305] FULL
          Length = 90

 Score = 92.8 bits (229), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 65/87 (74%), Gaps = 3/87 (3%)

Query: 1025 GMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIIL--SDSKLDMSEAEYKRKVKLMQKLVG 1082
            GMEK++ +K+P LG++L  +K R   PGQPG IL  S+ +L MS+ E+  KV  +Q++VG
Sbjct: 4    GMEKTIIEKLPKLGLSLQGKKERF-VPGQPGHILDLSNKELMMSKEEFDNKVNHLQRIVG 62

Query: 1083 LASYLGYKYRYDLLYYINILAQHTLYP 1109
            L SY+ +K R+++ YY+N+LAQHTL+P
Sbjct: 63   LLSYITHKCRFEMAYYVNVLAQHTLFP 89

>TBLA0F03530 Chr6 (867978..870614) [2637 bp, 878 aa] {ON} 
          Length = 878

 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 131/511 (25%), Positives = 234/511 (45%), Gaps = 44/511 (8%)

Query: 802  KHNTWDNSRIYDV---KEVNPKKIINSMIIFTTKRDGT-----HKCRFVARGDQQNAGT- 852
            +HN++    +Y      E N  K I   ++ T K D        K RFV +G +Q +G  
Sbjct: 376  EHNSFIKMEVYTAITKDETNGIKPIPLKVVLTKKTDEKCLFLKFKARFVCKGFKQISGID 435

Query: 853  YDDSLIANTIHH-EALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGH-- 909
            +D+  I++++   E L   +A+++   + I Q D+S+A+  + + +E+ +  P  L    
Sbjct: 436  FDELEISSSVSRLETLRIFIALSVSMKLDIKQYDVSTAFPNSKIDKEILVGLPKDLLEIL 495

Query: 910  ---KNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKN--EDLIVCL- 963
               K +++KL K++YGLKQS   W   ++ ++T+     N        +    ++I+CL 
Sbjct: 496  NLPKGQLWKLNKTVYGLKQSNKEWINLVRNFMTKQGFTVNNVDENIYLRKIGHNVIICLS 555

Query: 964  FVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLE-ITYRRSKSL 1022
            +VDD ++         +L   +   ++ K +  G ++K        LG+  ITY      
Sbjct: 556  YVDDFLIATDNPNLRKELFNQMNKEWDVKDM--GSVKK-------YLGMTFITYPDGSV- 605

Query: 1023 SFGMEKSLEQKI--PSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKL 1080
                  SL+Q+I    L    + +  +++A     I +  ++ D S    K +  + + +
Sbjct: 606  ------SLDQRIYLTELLERYHDKNHKIRATPMSEIPIPLNE-DNSTPLDKDETSVYRSI 658

Query: 1081 VGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKER 1140
            VG   +     R DL Y I+ L   +  P+     +    + YI  T N++L + +AK+ 
Sbjct: 659  VGAILWASLCTRADLSYAISKLGSKSSKPTIDDKKILMHTLSYIKGTINRKLYF-QAKKN 717

Query: 1141 NTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVI 1200
                +   +DA+F       SQ GY    +   I+  S K   T IS  ESEL+ +S V 
Sbjct: 718  KDNELIGFSDASFGTGKSILSQYGYIFTWSGTPISWCSKKQRSTSISMYESELFGLSEVY 777

Query: 1201 PLLNSIKMLMETITGNQVKNKLITDSAPAISI-INSQDETKLRNKYFGARSMKIRDEVKY 1259
                 ++ L ET + N     +  D+   IS  I ++D +   +K+ G R  K  +E+  
Sbjct: 778  KESLWMRSLFETFSLNTNTIVIYEDNKNVISTAIGTEDHS--ASKHIGFRK-KFINEITM 834

Query: 1260 SHLKLE-YVNTDNNIADILTKALPAKRFNDL 1289
            + L +  YV +++NIAD+LTK L    FN L
Sbjct: 835  TGLSVPFYVKSEHNIADLLTKPLGDIAFNKL 865

>Kwal_33.15086 s33 complement(955326..955595) [270 bp, 89 aa] {ON}
            YLR035C-A - Ty ORF [contig 94] FULL
          Length = 89

 Score = 91.7 bits (226), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 58/86 (67%)

Query: 1095 LLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFA 1154
            + YY+N+LAQHTL+P ++V  L  Q +QY+W  ++K+L W K+       + AITDA+ A
Sbjct: 1    MAYYVNVLAQHTLFPCDEVFDLALQCVQYLWTNKHKKLTWIKSNIPGDINIDAITDASHA 60

Query: 1155 NQPGYKSQVGYFILVNNKIITARSTK 1180
             Q  YKSQ+GYF  VN  II ARST+
Sbjct: 61   TQEEYKSQLGYFYKVNGHIIFARSTR 86

>TPHA0I00530 Chr9 (104925..106061) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/343 (23%), Positives = 170/343 (49%), Gaps = 14/343 (4%)

Query: 954  FKNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILG 1011
            F+N D  +++ ++VDD ++  K  +   + V  L+ R+E K++  GK+ +   R  D+LG
Sbjct: 10   FRNHDYSIMIAVYVDDCVIAAKSQELLDEFVSTLRNRFELKII--GKMNQGILRT-DVLG 66

Query: 1012 LEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKL----DMSE 1067
            +++ Y   +     +  SL+  I S+      +   +K    P +   +  +     M  
Sbjct: 67   MDLDYNIDEG---KISLSLQSYIESIENDWLDKISHIKTTSIPHVSSYEHNIKNIDSMDT 123

Query: 1068 AEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDT 1127
                +K+  +QK+ G+ +Y+  + RYD+ +  N LA+   +P++ V  +  +L+ YI+ T
Sbjct: 124  KTRSKKINELQKINGVINYIRSRCRYDIEFAANKLARSVNFPADNVFYMADKLMNYIFQT 183

Query: 1128 RNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCIS 1187
            +++++++ +    N   +T ++DA+   +   KS++G  +     +    S  ++    S
Sbjct: 184  KSEKIVFTRETTDNPA-ITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASSAVRNS 242

Query: 1188 STESELYAISMVIPLLNSIKMLMETITGNQVKNKL-ITDSAPAISIINSQDETKLRNKYF 1246
            STE+EL AI         +K ++E +   +    + ITDS P+I  + +   +  R+++ 
Sbjct: 243  STEAELDAIYEGSKEAYYLKKILEEMNLQKDPTVISITDSKPSIQYLKNNYNSNRRDRFL 302

Query: 1247 GARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
              +  K+ + ++   L +  +   +NIAD+LTK +  + F  L
Sbjct: 303  DLKLAKLEERIRADDLLIYKIAGTDNIADVLTKPVSCEDFKKL 345

>Smik_118.1 Chr118 complement(1..543) [543 bp, 181 aa] {ON}
           YPL060C-A (REPEAT)
          Length = 181

 Score = 93.6 bits (231), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 81/164 (49%)

Query: 194 DTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTD 253
           + F C  C   K+T+  HY GS  ++  ++        D+FGPV N  + +  Y +   D
Sbjct: 17  NEFWCETCKVSKATRRNHYKGSMNEHSIDHEPGSSWCMDIFGPVSNSNSDTKRYMLIMVD 76

Query: 254 EQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRE 313
             +R+       +K+A T+    +  +    TQFD KV     D+G+EFTN +I  +F  
Sbjct: 77  NNTRYCITSTHFNKNAETILAQIKKNIQYVETQFDRKVREINSDQGTEFTNDQIAKYFVS 136

Query: 314 NGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLW 357
            GI   +++  D  A+G AER  RT++ D  TLL+ S L    W
Sbjct: 137 KGIHHIFSATQDHAANGRAERYIRTIVTDATTLLKHSKLRIKFW 180

>Kwal_23.3713 s23 (400838..401074) [237 bp, 78 aa] {ON} YLR035C-A -
           Ty ORF [contig 254] FULL
          Length = 78

 Score = 89.4 bits (220), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%)

Query: 202 LKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWV 261
           + GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWV
Sbjct: 1   MAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWV 60

Query: 262 FPLRSKDASTVTTV 275
           FPL  K    V  V
Sbjct: 61  FPLSRKSDEAVVAV 74

>Kwal_39.16423 s39 (13455..13676) [222 bp, 74 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 372] PARTIAL
          Length = 74

 Score = 89.0 bits (219), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%)

Query: 202 LKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWV 261
           + GK  +H H   SR  YQ +Y   EFLHTD+FGP+ +MP+  P YFI+FTDE++R+RWV
Sbjct: 1   MAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMPSGVPKYFITFTDERTRYRWV 60

Query: 262 FPLRSKDASTVTTV 275
           FPL  K    V  V
Sbjct: 61  FPLSRKSDEAVVAV 74

>TBLA0A10570 Chr1 (2614203..2615624) [1422 bp, 473 aa] {ON} 
          Length = 473

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 58/93 (62%), Gaps = 1/93 (1%)

Query: 756 VKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVK 815
           V   +N  P   N SM Y +AIS N +  EK+LY++AY KE+  L+  N WD   I D  
Sbjct: 377 VTDMINKKPK-NNNSMQYYEAISQNSDPEEKDLYQRAYEKEIKSLINQNIWDEQNIIDAD 435

Query: 816 EVNPKKIINSMIIFTTKRDGTHKCRFVARGDQQ 848
            V   KIINSM IFTTKRDGTHK R VARGD Q
Sbjct: 436 TVPKDKIINSMFIFTTKRDGTHKSRCVARGDLQ 468

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 59/105 (56%), Gaps = 2/105 (1%)

Query: 367 IRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSK 426
           +RN   N+ Y T              T+LPF Q VI H T+   KL  RG   YALTPS 
Sbjct: 1   MRNVFCNSVYNTTPAAKAGLHGLDASTLLPFSQSVIIHVTDTDGKLDPRGLLAYALTPST 60

Query: 427 ESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLM 471
           ES+GYL+YVP  +KVLD+SNY ++R  T  + D   +  VFD L+
Sbjct: 61  ESNGYLLYVPAYNKVLDSSNYEIVRESTKPTIDSTPN--VFDELL 103

>Smik_13.224 Chr13 (360633..360995) [363 bp, 120 aa] {ON}  YNL054W-B
           (REPEAT)
          Length = 120

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 64/111 (57%), Gaps = 1/111 (0%)

Query: 40  LHFPQQPIHIGVQDAQDNPIPISSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDD 99
           LH       I + DAQ   IPI++ G L F+F NG    I A  +PNI YDL+SL EL +
Sbjct: 1   LHHATPNSEINIVDAQKEDIPINAIGNLYFNFQNGTKTSIKALHTPNIAYDLLSLSELAN 60

Query: 100 AGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNI 150
             I A F+  +L   D  V+A + KHG FYWLS KYL +P++     INN+
Sbjct: 61  QDITACFTRNTLERSDGTVLAPIFKHGDFYWLSKKYL-IPSQISKLTINNV 110

>TPHA0B03180 Chr2 complement(728704..731073) [2370 bp, 789 aa] {ON} 
          Length = 789

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 108/446 (24%), Positives = 199/446 (44%), Gaps = 46/446 (10%)

Query: 764  PSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKII 823
            P   N +MS+ DA            ++ A ++EL     H T++      V     ++ +
Sbjct: 364  PRTINQAMSHPDAAE----------WKAACIRELSAFRSHETYEL-----VPLPTGRRSL 408

Query: 824  NSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQ 883
             S  +FT K +G  K R VA+G+ Q  G       A  I ++++   +A+A    + I Q
Sbjct: 409  GSRWVFTEKSNGLKKARLVAQGNSQKEGIDYSETFAPVIRYDSVRLFLAMAASLKLRIHQ 468

Query: 884  LDISSAYLYADLKEELYIRTPPHL---GHKNKIFKLEKSLYGLKQSGANWYENIKKYLTE 940
            +D+ +A+L + +  E+Y+R PP      +   ++KL+  +YGLKQ+   W  +I + L  
Sbjct: 469  MDVDTAFLNSAIDGEVYVRQPPGFLDSHYPTHVWKLKGGMYGLKQAPFLWNTHINETLLS 528

Query: 941  DCGMSNIRGWPCAF-KNED--LIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDG 997
                 +   +   F K+ D  ++V L+VDD+++     K    L +LL   Y  K +  G
Sbjct: 529  FGFTRHAGEYGLYFSKSADGLVLVALYVDDLLIAAPSSKAMTPLKELLCSSYSMKDL--G 586

Query: 998  KIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGII 1057
             + K        LG+ I  +   S+S  + + +     +  + ++      KA   P   
Sbjct: 587  PVNK-------FLGMTIK-QSENSISLDLSEYISSAASTSQINVD------KAVHTPLSK 632

Query: 1058 LSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLT 1117
             +D   D S       +   Q L+G   +     R D+ + ++ L++    P     +  
Sbjct: 633  TTDLFGDTSPLLI--NITPYQSLIGQLLFAANAGRPDISFAVSTLSRFLESPRQVHFAAA 690

Query: 1118 YQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYK-SQVGYFILVNNKIIT- 1175
             +L+QY++ TR   L +   K  +   ++  TDA+ A++     S  GY   + +  +T 
Sbjct: 691  QRLLQYLYTTRYDSLCY---KTSHPLSISIYTDASTASKDDLPFSTGGYITTMADGAVTW 747

Query: 1176 -ARSTKATLTCISSTESELYAISMVI 1200
             +R  K+T+ C+SSTE+E  A S  +
Sbjct: 748  SSRKIKSTV-CLSSTEAECIAGSEAV 772

>KNAG0M01680 Chr13 (304150..304884) [735 bp, 244 aa] {ON} 
          Length = 244

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 129/246 (52%), Gaps = 10/246 (4%)

Query: 770  SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
            S+ Y++AI++N+N++    + KAY KELD L+K   ++        EV+  +I      F
Sbjct: 7    SIFYKEAITNNKNIQANFEFIKAYQKELDNLVKMKVYNPKIKIPKGEVHKDEIEPINTTF 66

Query: 830  TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
              +RD T K R V RGD Q+  +Y + +  + ++  +L   + +A +N++ +  LDI+ A
Sbjct: 67   NIRRDKTRKARIVCRGDLQSESSYSN-IETSILNMNSLKMLLILANNNNLRLRTLDINHA 125

Query: 890  YLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRG 949
            +LYA + E  +I  P        +  L K+LYGLKQS   W + +K+++    GM +   
Sbjct: 126  FLYASIDENFFITHP---NDSRMVTPLHKALYGLKQSPKRWNDTLKRFMNS-IGMHDSVS 181

Query: 950  WPCAF--KNEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDY 1007
                +  KN  +++  +V+D I  G+  K    LV  L+  Y  +++  G +E  +  D 
Sbjct: 182  SHGLYVSKNGKVMIAAYVNDCITAGQDEKDIDSLVSQLQHEYSFQII--GTMENGK-LDT 238

Query: 1008 DILGLE 1013
            + LGL+
Sbjct: 239  NTLGLD 244

>TBLA0A00240 Chr1 complement(34706..35521) [816 bp, 271 aa] {ON}
          Length = 271

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 98/173 (56%), Gaps = 15/173 (8%)

Query: 770 SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNP----KKIINS 825
           S+ Y++AI++N+N++++ L   +  K         TW   R   +    P    +KII++
Sbjct: 102 SIYYKEAITNNKNLKQRHLSSHSRKKL-------KTWLRCRFMILIFAYPNQLYQKIIST 154

Query: 826 MIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLD 885
           +I+FT KRDGT K R+ ARGD QN  +Y ++  A  +  ++L   +++A +  + I   D
Sbjct: 155 VILFTVKRDGTCKARYCARGDLQNQESYGNTDSA-ILSLDSLKILLSVANNKQLHIRTAD 213

Query: 886 ISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYL 938
           IS A+LYA L E+LYI  P     K     L+K+L GLKQS  NW   +++++
Sbjct: 214 ISHAFLYATLDEDLYINHP---SDKRVYTPLKKALNGLKQSPKNWNGTLREFM 263

>TDEL0H00100 Chr8 (1355..1744) [390 bp, 129 aa] {ON} 
          Length = 129

 Score = 87.8 bits (216), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 356 LWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVR 415
           LWFY+V+FATL+RN+++ T+ K               T+LPFGQ VI +      KLH R
Sbjct: 28  LWFYAVKFATLMRNSIVTTSTKESPRAKAGLTGLDISTVLPFGQPVIVNKPKTFSKLHSR 87

Query: 416 GHHGYALTPSKESHGYLIYVPHLHK-VLDTSNYVVIRSDTN 455
           G  GYAL PS  S GYLIYVP   + ++DT +Y  IR +  
Sbjct: 88  GWKGYALCPSSISFGYLIYVPGAPQDIIDTRHYRAIRDEVG 128

>Kwal_2.426 s2 (3117..4001) [885 bp, 294 aa] {ON} YLR035C-A - Ty ORF
           [contig 305] FULL
          Length = 294

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/101 (48%), Positives = 65/101 (64%), Gaps = 2/101 (1%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 158 KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 216

Query: 806 WDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFV-ARG 845
           WD S   D+  V   KI++SM IFTTKRDG  +   V ARG
Sbjct: 217 WDLSNPIDMNLVPANKIVSSMFIFTTKRDGREEAADVLARG 257

>Kwal_14.771 s14 (34780..35118) [339 bp, 112 aa] {ON} YBL101W-B -
           TyB Gag-Pol protein [contig 245] FULL
          Length = 112

 Score = 85.5 bits (210), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 1/86 (1%)

Query: 783 VREKELYRKAYM-KELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRF 841
            R+KE   + +M +E+DQL KH TWD S   D+  V   KI++SM IFTTKRDG  KCR 
Sbjct: 8   TRKKEASIRQHMTREIDQLEKHKTWDLSNPIDMNLVPANKIVSSMFIFTTKRDGRRKCRC 67

Query: 842 VARGDQQNAGTYDDSLIANTIHHEAL 867
           VARGD+Q   TYD    A T+ HEAL
Sbjct: 68  VARGDRQKPETYDPDAEAYTVAHEAL 93

>NDAI0G00540 Chr7 (116135..116962) [828 bp, 275 aa] {ON} 
          Length = 275

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 3/108 (2%)

Query: 367 IRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLHVRGHHGYALTPSK 426
           +RNA +N++  +              TILPFGQ V+ HD     KL  RG  G+ALTPSK
Sbjct: 1   MRNAFINSSTNSSARAKAGLAGLDARTILPFGQEVMIHDYTQTSKLKSRGITGFALTPSK 60

Query: 427 ESHGYLIYVPHLHKVLDTSNY-VVIRSDTNISADHNYDSTVFDPLMQS 473
           ESHGYLI+VP L KV+ TSNY +V+   T++S    +  +VFD L++S
Sbjct: 61  ESHGYLIFVPSLRKVIGTSNYAIVVHDSTSLSESSTH--SVFDNLLES 106

>Kwal_34.16307 s34 (281659..281892) [234 bp, 77 aa] {ON} YAR009C -
           TyB Gag-Pol protein [contig 710] FULL
          Length = 77

 Score = 84.0 bits (206), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 46/73 (63%)

Query: 239 NMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDR 298
           +MP+  P YFI+FTDE++R+RWVFPL  K    V  VFR ++A    Q   KV   QMD+
Sbjct: 3   HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIARQHGVKVKAIQMDK 62

Query: 299 GSEFTNAEIRHFF 311
           GSE+TN   R F 
Sbjct: 63  GSEYTNQSTRMFL 75

>Skud_12.513 Chr12 complement(912157..912666) [510 bp, 170 aa] {ON}
           YPL060C-A (REPEAT)
          Length = 170

 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 74/144 (51%)

Query: 232 DLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKV 291
           D+FGPV N  + +  Y     DE +R+       +++A T+    +  +    +QFD KV
Sbjct: 2   DIFGPVSNSNSDTKRYMFIMVDESTRYCITSTHFNRNAETILAQIKKNIQYVESQFDRKV 61

Query: 292 LVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSG 351
                D+G+EFTN +I       GI+  +++  D  A+G AER  RT++ D  TLL+ S 
Sbjct: 62  KEINSDQGNEFTNDQIEKHLVSKGIRHIFSASQDHAANGRAERYIRTIVTDATTLLKHSN 121

Query: 352 LSPHLWFYSVEFATLIRNALLNTT 375
           L    W Y+V   T +RN L + T
Sbjct: 122 LRIKFWEYAVTSTTNVRNCLEDET 145

>Smik_12.565 Chr12 complement(995800..996096,996100..996126) [324
           bp, 108 aa] {ON}  YNL054W-B (REPEAT)
          Length = 108

 Score = 82.8 bits (203), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (60%)

Query: 354 PHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQHVITHDTNPIDKLH 413
           P+ WF +VEF+ +IRN+L  +                  T+LPFGQ +I +  +P  +++
Sbjct: 7   PYHWFSAVEFSPIIRNSLAASKNGKSARQRVVLGALNSFTLLPFGQRIIVNKHDPEAEVY 66

Query: 414 VRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
            RG  GYAL PS++  GY+IY+P L K +DT+NY+V++  ++
Sbjct: 67  PRGKPGYALYPSRDPDGYVIYLPSLKKTVDTANYIVLQESSS 108

>Kpol_1026.3 s1026 complement(6141..6605) [465 bp, 154 aa] {ON}
           complement(6141..6605) [465 nt, 155 aa]
          Length = 154

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 70/138 (50%)

Query: 232 DLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKV 291
           D FGPV   P ++  + +   D  SR+  +    +KD +T T    N +    TQF   V
Sbjct: 17  DTFGPVKPSPNNNYRFMLVMIDNVSRYVIISTHLTKDMNTYTNQIENSIHFIKTQFGRTV 76

Query: 292 LVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSG 351
               MDRGS F N++++    E GI   +T+V D  A+  AER  RT++ D RTLL  + 
Sbjct: 77  QELIMDRGSGFNNSQLKELCDEFGIHRVFTAVQDHSANARAERGIRTIISDARTLLIQAR 136

Query: 352 LSPHLWFYSVEFATLIRN 369
           +    W Y+ + A  +RN
Sbjct: 137 IRLKFWHYAAKAAVNVRN 154

>Kpol_489.22 s489 (62613..62927,62930..63304) [690 bp, 229 aa] {ON}
           (62613..62927,62930..63304) [690 nt, 230 aa]
          Length = 229

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 110/219 (50%), Gaps = 16/219 (7%)

Query: 770 SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
           ++ Y+DAI+ N N++ K  Y +AY KEL  L+    +D +      +    KI+    IF
Sbjct: 20  ALYYKDAITKNTNLQTKIKYMEAYEKELQNLITTKVFDPTLRIPRSDAPRDKIVPINTIF 79

Query: 830 TTKRDGTHKCRFVARGDQQNAGTYDDSLIANT----IHHEALMTCMAIALDNDMFIVQLD 885
           + KRDGT+K   V R      GTYD      T    +  ++L   + I  + ++ ++ +D
Sbjct: 80  SVKRDGTYKSHIVCR------GTYDLLTALETERSILKMDSLKLLLTIVNNKELRMLTMD 133

Query: 886 ISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMS 945
            + A+LYA+++EE+YI  P        +  L+K+L GLKQS     + +K+Y+     M 
Sbjct: 134 TNHAFLYAEIEEEIYITHP---KDNRMVTPLKKALCGLKQSPKKLNDTLKEYMNSIGLMD 190

Query: 946 NIRG--WPCAFKNEDLIVCLFVDDIIVFGKKHKKCMDLV 982
           +I       +   E+ I   +VDD ++  K  +K  D++
Sbjct: 191 SIFSPRLYSSMDGENFIAA-YVDDCVITAKSDEKLQDII 228

>Skud_2.338 Chr2
           complement(611182..611319,611323..611421,611425..611442,
           611446..611487,611491..611496,611500..611604) [408 bp,
           136 aa] {OFF}  YNL054W-B (PSEUDO)
          Length = 136

 Score = 80.9 bits (198), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 79/177 (44%), Gaps = 43/177 (24%)

Query: 187 NIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPT 246
           ++DWSG   +QCP CL     +H+H  G R K++ E     ++ TD+ GP+         
Sbjct: 3   DVDWSGTAAYQCPGCLNCNGIEHRHVKGLRPKHESE----PYVSTDISGPI--------- 49

Query: 247 YFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAE 306
                 D   R           AS  +++ + + +     F    +V +    S   NA 
Sbjct: 50  ------DHSER----------TASLSSSMMKKLGSN---GFIHYTMVLKKLFTSSLWNA- 89

Query: 307 IRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEF 363
                     + C T+   SR  GVAE LN TLL DC T L+SSGLS H+WF  VEF
Sbjct: 90  ----------KSCPTTAAGSRIDGVAESLNSTLLYDCNTKLQSSGLSSHVWFSPVEF 136

>Kwal_34.16311 s34 (283168..283434) [267 bp, 88 aa] {ON} YER160C -
           TyB Gag-Pol protein [contig 710] FULL
          Length = 88

 Score = 78.6 bits (192), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 45/68 (66%)

Query: 817 VNPKKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALD 876
           V   KI++SM IFTTKRDG  KCR VARGD+Q   TYD    A T+ HEAL TC+AI L+
Sbjct: 4   VPANKIVSSMFIFTTKRDGRRKCRCVARGDRQKPETYDPDAEAYTVAHEALTTCLAITLE 63

Query: 877 NDMFIVQL 884
               I QL
Sbjct: 64  QGWTIKQL 71

>Skud_57.1 Chr57 (3..341) [339 bp, 112 aa] {ON} YNL054W-B (REPEAT)
          Length = 112

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 5/107 (4%)

Query: 832 KRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYL 891
           KR+G +K R V RGD Q   TY+  +IA    +   +    IA + +MF+  LDI+ A+L
Sbjct: 2   KRNGIYKARIVCRGDIQTPDTYN--VIATESLNHNHIKIFLIANNRNMFMKTLDINHAFL 59

Query: 892 YADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYL 938
           YA L+EE+YI   PH   +  + KL K+LYGLKQS   W +++++YL
Sbjct: 60  YAKLEEEIYI---PHPHDRRCVVKLNKALYGLKQSPKVWNDHLRQYL 103

>TBLA0B08190 Chr2 complement(1954681..1955820) [1140 bp, 379 aa]
           {ON}  frameshift location uncertain
          Length = 379

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 94/169 (55%), Gaps = 12/169 (7%)

Query: 770 SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
           S+ Y++AI++N+N++ + L   +  K     +K  TW   R   +    P ++  + II 
Sbjct: 217 SIYYKEAITNNKNLKLRHLSNHSSKK-----LK--TWLRCRFMILIFAYPNQLYQN-IIS 268

Query: 830 TTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSA 889
           T KRDGT K R+ ARGD QN   Y ++  A  +  ++L   +++A +  + I   DIS A
Sbjct: 269 TVKRDGTCKARYCARGDLQNQDYYGNTDSA-ILSLDSLKILLSVANNKQLHIRTADISHA 327

Query: 890 YLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYL 938
           +LYA L EELYI  P     K     L+K+LYGLKQS  NW   +++++
Sbjct: 328 FLYATLDEELYINHP---LDKRVYTPLKKALYGLKQSPKNWNGTLREFM 373

>Kwal_55.22271 s55 (1177701..1178192) [492 bp, 163 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 327] FULL
          Length = 163

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 81/161 (50%), Gaps = 19/161 (11%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQ+ PI I+  GI++ +   G  V
Sbjct: 10  PQMFLIDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQEQPIAITGKGIIELNL--GRVV 66

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTKYLM 137
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST    
Sbjct: 67  KLEAYLSPDIFCDIISTTQLEQFGIYPNFEMRSLRTQEGIEVAKLIRYQAVYWLSTD--- 123

Query: 138 LPARSRNHRINNILP---------RFSFEFIHRLFGHVNIK 169
               ++   +NNI           +   E +H    H+N+K
Sbjct: 124 --VAAQFKHVNNIRGMKSLIKPGRKIPLEILHESLSHINVK 162

>Skud_57.3 Chr57 (686..1111) [426 bp, 142 aa] {ON} YNL054W-B (REPEAT)
          Length = 142

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 42/132 (31%), Positives = 80/132 (60%), Gaps = 1/132 (0%)

Query: 1065 MSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYI 1124
            MS+ E+++ V  +Q+L+G  +Y+ YK RYD+ + +  +A+   YP  QV  + Y++IQY+
Sbjct: 1    MSDKEFRQGVLKLQQLLGELNYVRYKCRYDIEFAVKKVARLVNYPHEQVFYMIYKIIQYL 60

Query: 1125 WDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLT 1184
               +N  + + +  +++ +++  ITDA+  ++   +S++G  I     I    S K+T  
Sbjct: 61   ARHKNIGIHYDRDLDKD-KKIIGITDASVGSEYDAQSRIGVIIRYERNIHNVYSNKSTNR 119

Query: 1185 CISSTESELYAI 1196
            C+ STE+EL+AI
Sbjct: 120  CLFSTEAELHAI 131

>NDAI0D01220 Chr4 complement(291053..291919) [867 bp, 288 aa] {ON} 
          Length = 288

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 113/221 (51%), Gaps = 8/221 (3%)

Query: 1072 RKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKR 1131
            + +K  Q ++G   ++    R D+ + ++ L++    P    +    ++++Y++ TR   
Sbjct: 65   QSIKAYQSIIGQLLFIANAGRPDVAFPVSFLSRFLKDPREVHMDAATRIMRYLYTTREYG 124

Query: 1132 LIWPKAKERNTQRVTAITDA---AFANQPGYKSQVGYFILVNNKIITARSTKATLTCISS 1188
            +   K + ++ +++T  TDA   A  + P   S    F+        +R  ++T+ C+SS
Sbjct: 125  I---KYRSKSKRQLTVYTDASQGAAWDMPFSTSGYATFLAGGAITWCSRRIRSTI-CLSS 180

Query: 1189 TESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGA 1248
            TE+E  A S  +     +  L+E +     +N L+ D+ PAI +  S      R K+   
Sbjct: 181  TEAEYIAASEAVLETMWLYNLLEHMGYPLSENLLMIDNEPAIKLA-SHPILHSRTKHIKL 239

Query: 1249 RSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFNDL 1289
            R  KIR+ V    +K+EYVNT + +ADILTKALP K+FN L
Sbjct: 240  RYHKIREAVDDGIVKIEYVNTLDQVADILTKALPQKQFNYL 280

>TBLA0F01880 Chr6 (471887..472561) [675 bp, 224 aa] {ON} 
          Length = 224

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 91/169 (53%), Gaps = 1/169 (0%)

Query: 1063 LDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQ 1122
            L M++ EYK KVK +QK +G  +YL  + R DL + ++ +A+  LYP  +V+    +LI+
Sbjct: 48   LLMNKTEYKEKVKYIQKSIGKLNYLRTRGRLDLKFAVSKIARFALYPHVKVIKAVDRLIK 107

Query: 1123 YIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKAT 1182
              +  R+  ++  + K +    +T ITDA+  ++   KS++G  I   N  +   S K++
Sbjct: 108  CTYVKRDLNVVMKREK-KQPDEITVITDASLGSEYDVKSRIGGIIWFGNTFMFGFSNKSS 166

Query: 1183 LTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAIS 1231
            + C SS E EL A++    L   +K  +E +     K  +ITDS P I 
Sbjct: 167  IVCDSSAECELDALNKGEKLALHLKFKLEKLFKKNFKINIITDSKPVIE 215

>Smik_12.567 Chr12 complement(996596..997171) [576 bp, 191 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 191

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 90/188 (47%), Gaps = 11/188 (5%)

Query: 12  HVDDEF-----DLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGI 66
           HV + F     DL G+ ++ SGAS S++R +  L+F    +       Q + +P+   G 
Sbjct: 5   HVGNRFKNSPPDLHGHFVIASGASKSLVRTTDNLYFESPNVTRNTATIQKHNVPLKFLGN 64

Query: 67  LKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHG 126
           L+F+F       ISA    N  YDL+SL+E     I   F+   L   D  ++  ++++ 
Sbjct: 65  LRFNFFKNFQASISALHEQNHTYDLLSLNEPAKQNITPCFTRNVLELYDGTMLTFIIEYD 124

Query: 127 PFYWLSTKYLMLPARSRNHRINNI-----LPRFSFEFIHRLFGHVNIKIIKDSIRKGLIK 181
            FY LS +YL+ P+      IN +       R+ +  IH +F H N + IK SI    +K
Sbjct: 125 DFYRLSKEYLISPSNPV-QAINKVDSAESTHRYPYHIIHSIFSHANARFIKHSIGNSSVK 183

Query: 182 NISYDNID 189
            +   ++D
Sbjct: 184 FLKESDVD 191

>Kwal_47.17669 s47 complement(507896..508297) [402 bp, 133 aa] {OFF}
           [contig 206] FULL
          Length = 133

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 23  LLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPVKIS 80
            L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +K+ 
Sbjct: 2   FLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVIKLE 58

Query: 81  AASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLST 133
           A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST
Sbjct: 59  AYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLST 111

>KAFR0B06625 Chr2 (1380125..1381207,1381209..1381694) [1569 bp, 522
           aa] {ON}
          Length = 522

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 85/166 (51%), Gaps = 11/166 (6%)

Query: 14  DDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFAN 73
           +D+      L++DSGA  S+++ SS+L+    P    + DA    + + S G L   F  
Sbjct: 364 EDQIHPEELLIIDSGAEISVVQSSSMLNNTFNPTRDILYDAGSKELTVESGGYLCLSFDT 423

Query: 74  GPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLST 133
               +I A +SP I  +++SL  L+ A I  D   R L DK  N++  L+ +G       
Sbjct: 424 AS-YRIKALASPEISCNILSLHALERASISVDLINRVLIDKKGNILTKLIDYG------- 475

Query: 134 KYLMLPAR--SRNHRINNILPRFSFEFIHRLFGHVNIKIIKD-SIR 176
           +Y+ +P         +NN+  +F+  F H+LFGH+NI+ IK  SIR
Sbjct: 476 RYVCIPLSVICTTQVVNNVRTKFAMNFFHKLFGHINIRDIKKLSIR 521

>Suva_10.194 Chr10 (372743..373060) [318 bp, 106 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 106

 Score = 73.6 bits (179), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%)

Query: 916 LEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDIIVFGK 973
           L+  L GLKQSGA  YE IK YL   C M  +RGW C FKN  + +CLFV+D+I+F +
Sbjct: 44  LQSPLVGLKQSGATRYETIKSYLIIQCYMKEVRGWSCVFKNSQVTICLFVNDMILFSE 101

>Smik_3.3 Chr3 (1903..3120) [1218 bp, 405 aa] {ON} YCL074W (REPEAT)
          Length = 405

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 96/413 (23%), Positives = 179/413 (43%), Gaps = 31/413 (7%)

Query: 884  LDISSAYLYADLKEELYIRTPPHLGHKNK---IFKLEKSLYGLKQSGANWYENIKKYLTE 940
            + + +A+L + + E +Y++ PP   +++    ++KL   +YGLKQ+   W E+I   L +
Sbjct: 1    MHVDTAFLNSTMDEPVYVKQPPGFVNESNPYYVWKLYGGMYGLKQAPLLWNEHINNTL-K 59

Query: 941  DCGMSNIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVND 996
              G     G    +     +  + + L+VDD++V     K    + Q L   Y  K  + 
Sbjct: 60   KIGFCRHEGEHGLYFRSTPDGPIYIALYVDDLLVAAPSPKIYDRVKQELAKLYSMK--DL 117

Query: 997  GKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGI 1056
            GK++K        LGL I    +  ++  ++  + +          SE    K    P  
Sbjct: 118  GKVDK-------FLGLNIHQSSNGDITLSLQDYIAK------AASESEINICKLTQTP-- 162

Query: 1057 ILSDSK-LDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLS 1115
             L DSK L  + + + + +   Q +VG   +     R D+ Y +++L++    P    L 
Sbjct: 163  -LCDSKPLFETTSPHLKDITPYQSIVGQLLFCANTGRPDISYPVSLLSRFLREPRAIHLE 221

Query: 1116 LTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIIT 1175
               ++++Y++ TR+  L +    +         +  A  + P   S  G   L+    +T
Sbjct: 222  SARRVLRYLYTTRSMCLKYRSGSQFALTVYCDASHGAIHDLP--HSTGGCVTLLAGAPVT 279

Query: 1176 ARSTK-ATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIIN 1234
              S K   +  +SSTE+E    S  +  +  I+ L E +    + +    D+ PAI + +
Sbjct: 280  WSSKKHKGVIPVSSTEAEYITASETVMEIEWIQNLFEHLGQPLISSTSYVDNKPAIKL-S 338

Query: 1235 SQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALPAKRFN 1287
                   R K+   R  K+R+ V    + +E+V T   +A+I TK LPA+ F 
Sbjct: 339  KHPVFHTRAKHIALRYHKLRNAVAEGIIIIEHVITKKQVANIFTKILPAESFK 391

>Kwal_1.410 s1 (2688..3320) [633 bp, 210 aa] {ON} YJL113W - TyB
           Gag-Pol protein [contig 695] FULL
          Length = 210

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 64/117 (54%), Gaps = 1/117 (0%)

Query: 340 LDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQ 399
           ++DCRT+L+ S +  HLWF++V+ A   RN+L N T  T               +  FGQ
Sbjct: 1   MNDCRTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQ 60

Query: 400 HVITHDTNPI-DKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
             + HD + +  KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 61  PCMVHDYSALKKKLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 117

>Kwal_39.16421 s39 (12905..13270) [366 bp, 121 aa] {OFF} [contig
           372] FULL
          Length = 121

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/113 (39%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 23  LLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPVKIS 80
            L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +K+ 
Sbjct: 2   FLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVIKLE 58

Query: 81  AASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLST 133
           A  SP+I  D+IS  +L+  GIY +F  RSLR ++   +A L+++   YWLST
Sbjct: 59  AYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQEGLEVAKLIRYQAAYWLST 111

>Kwal_26.7403 s26 complement(347312..347884) [573 bp, 191 aa] {ON}
           [contig 439] PARTIAL
          Length = 191

 Score = 74.3 bits (181), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 65/116 (56%), Gaps = 5/116 (4%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 75  PQMFLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 131

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLST 133
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR +    +A L+++   YWLST
Sbjct: 132 KLEAYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQRWLEVAKLIRYQAAYWLST 187

>NDAI0B04850 Chr2 complement(1188719..1188940) [222 bp, 73 aa] {ON} 
          Length = 73

 Score = 69.3 bits (168), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 47/72 (65%)

Query: 335 LNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTI 394
           +N TLL+D RTLL+++ L  +LWFY+++F+T+IRN++ N T K+              TI
Sbjct: 1   MNLTLLNDYRTLLKAAQLPDNLWFYAIQFSTIIRNSVYNETIKSSPRAIAAQSGLDVKTI 60

Query: 395 LPFGQHVITHDT 406
           LPFGQ VI H T
Sbjct: 61  LPFGQPVIAHRT 72

>Smik_124.1 Chr124 complement(1..501) [501 bp, 167 aa] {ON} YNL054W-B
            (REPEAT)
          Length = 167

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 90/176 (51%), Gaps = 17/176 (9%)

Query: 956  NEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVN---DGKIEKAESRDYDILGL 1012
            ++ L++ ++VDD ++     ++  D +  LK  +E K+     DG +      D DILG+
Sbjct: 1    DKKLMIAVYVDDCVIAASDEQRLDDFINNLKKTFELKITGTLIDGIL------DTDILGM 54

Query: 1013 EITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIIL-----SDSKLDMSE 1067
            ++ Y +       ++ +L   I  +G     E  +++    P I +      + +L M+E
Sbjct: 55   DLIYNKKLGT---VDLTLISFIEKMGEKYKKELDKVRKRSIPHISIYKIDPKNGELKMTE 111

Query: 1068 AEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQY 1123
             EYK  V  +Q+L+G  +Y+ YK RYD+ + +  +A+   +P  QV  + Y++IQY
Sbjct: 112  KEYKDGVLKLQQLLGELNYVRYKCRYDVEFAVKKVARLVNFPHKQVFYMIYKIIQY 167

>TBLA0E03550 Chr5 complement(885508..888024,888026..888394) [2886
           bp, 961 aa] {ON}  ribosomal frameshifting
          Length = 961

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 79/178 (44%), Gaps = 7/178 (3%)

Query: 294 FQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLS 353
           F  DRGSEFTN  ++    + GIQ  +TS  D  A+  AER  RT++ D RTLL  + L 
Sbjct: 336 FITDRGSEFTNNNLKQLAEKKGIQLRFTSTQDHSANARAERAIRTIITDTRTLLFQAKLP 395

Query: 354 PHLWFYSVEFATLIRNALL--NTTYKTXXXXXXXXXXXXXXTILPFG--QHVITHDTNPI 409
              W Y+V+ +  +R+     NT                    LPFG    +  H +   
Sbjct: 396 LKFWHYAVKASAEVRSCAYNKNTEDAPLNVVFELLVKIILRNFLPFGAPATIWNHKSKKT 455

Query: 410 DKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVF 467
             L ++      L+   +S GY  Y+P  ++V+ T+N+ +     N     N + T+ 
Sbjct: 456 AALSLQ---AVVLSKDPQSFGYFFYIPKENRVITTTNFKIPDHSVNSQQKSNPEETII 510

 Score = 65.5 bits (158), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 53/77 (68%)

Query: 770 SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIF 829
           S+ Y++AI++N+N++++E + K++ KE++ L+K   +D         +   KII+++I+F
Sbjct: 877 SIYYKEAITNNKNLKQRERFIKSFKKEVENLVKMGVYDPDIRLPKSAIPQNKIISTVIVF 936

Query: 830 TTKRDGTHKCRFVARGD 846
           T KRDGT K R+ ARGD
Sbjct: 937 TVKRDGTCKARYCARGD 953

>TBLA0C00120 Chr3 (6741..8573) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 84/135 (62%), Gaps = 6/135 (4%)

Query: 770 SMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPK-KIINSMII 828
           S+ Y++AI++N+N++++E + K++ KE++ L+K   +D   I   K   PK KII+++I+
Sbjct: 477 SIYYKEAITNNKNLKQRERFIKSFKKEVENLVKMGVYD-PDIRLPKSAIPKNKIISTVIV 535

Query: 829 FTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDN---DMFIVQLD 885
           FT KRDGT K R+ ARGD QN  +Y ++  ++ +  ++L   +++  D+   D+ I  L 
Sbjct: 536 FTVKRDGTCKARYCARGDLQNQESYGNTE-SSILSLDSLKILLSVYWDSRELDIVIQCLR 594

Query: 886 ISSAYLYADLKEELY 900
               Y Y+++  + Y
Sbjct: 595 CKDDYFYSEIYSKYY 609

>Kpol_202.1 s202 complement(2237..2872) [636 bp, 211 aa] {ON}
            complement(2237..2872) [636 nt, 212 aa]
          Length = 211

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 93/202 (46%), Gaps = 4/202 (1%)

Query: 1089 YKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAI 1148
            Y  R D+ Y +++L++    P    L+  ++++QY++ TR   L +           +  
Sbjct: 3    YAGRPDIAYAVSLLSRFLKDPRVVHLNAAHRVLQYLYTTRFHGLAYRAGSPLQLTVYSDA 62

Query: 1149 TDAAFANQPGYKSQVGYFILVNNKIITARSTK-ATLTCISSTESELYAISMVIPLLNSIK 1207
            +  + A+ P   S  GY   +    +T  S K  T  C+SSTE+E  A S  +  +  + 
Sbjct: 63   SHGSLADMPF--STGGYVTRLAGGCVTWSSKKIKTTVCLSSTEAEYIAASEAVKEIEWLG 120

Query: 1208 MLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYV 1267
             L   +     K KL  D+ PAI + +       R K+   R  KIR  V+   + LEYV
Sbjct: 121  DLTTVMDLTLNKTKLYVDNEPAIKL-SKNPVMHPRTKHIALRYHKIRHAVEQDIVDLEYV 179

Query: 1268 NTDNNIADILTKALPAKRFNDL 1289
            NT +  ADILTK L   +F  L
Sbjct: 180  NTKDQQADILTKILAKSQFETL 201

>TPHA0M02160 Chr13 (448670..450370) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 79/177 (44%), Gaps = 9/177 (5%)

Query: 198 CPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSR 257
           CP C   K+T +K   G       E+   E +  DL G           YF++  D  SR
Sbjct: 88  CPSCSLSKATMNK---GKPSATHYEH-VLELIQVDLCGGFRYNGYEDNKYFMTIRDAASR 143

Query: 258 FRWVFPLRSKDASTVTTVFRNIVATFGTQF---DTKVLVFQMDRGSEFTNAEIRHFFREN 314
           +  V  L SK  +       + +    TQF     KVL  + D G+EF +  +  F    
Sbjct: 144 YYSVIHLNSKAGAA--KELMSWITKAETQFTHRGLKVLKLRTDNGTEFVSQVLHEFCSSK 201

Query: 315 GIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNAL 371
           GI+   T   +S  +G  ER +RT++D  RTLL S G+ P+LW  +V  A  + N L
Sbjct: 202 GIEHQLTVPHNSFQNGGVERAHRTIMDKARTLLVSGGVPPYLWPEAVSCAAYLINRL 258

>NDAI0D00670 Chr4 (145289..145612) [324 bp, 107 aa] {ON} 
          Length = 107

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 62  SSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIAT 121
           +  G L+    +   + I A   P + ++L+S + L+  GI+ D    +L  +D N +A 
Sbjct: 4   TGQGTLRLKLYHSKTIDIPAYVIPELEHNLLSTNSLEHHGIFVDAKHGTLESRDGNTLAQ 63

Query: 122 LLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVN 167
            ++     WL+  ++++P  +   RINN++ +F  + +HRL GHVN
Sbjct: 64  FVRFNSLPWLTFHHVVIPPHA---RINNLIQKFPLDVVHRLLGHVN 106

>Skud_12.299 Chr12 complement(546128..546313,546317..546328) [198 bp,
            66 aa] {ON} YNL054W-B (REPEAT)
          Length = 66

 Score = 63.5 bits (153), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 41/61 (67%)

Query: 1022 LSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLV 1081
            +  GME SL  K+P L V LN + R++ APGQPG+ +   +L++ E +YK KV  MQKL+
Sbjct: 6    MKLGMENSLTDKLPKLNVPLNPKGRKISAPGQPGLYIEQDELELDEYDYKSKVHEMQKLI 65

Query: 1082 G 1082
            G
Sbjct: 66   G 66

>Suva_14.55 Chr14 (94266..96023) [1758 bp, 585 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 585

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 66/132 (50%), Gaps = 1/132 (0%)

Query: 6   PLGSPNHVDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTG 65
           P   P H     + PG+ L+ SGAS ++IR ++  H         +  AQ     I++ G
Sbjct: 448 PFSQP-HDQSNSEFPGHFLIGSGASHTLIRTTNPHHLTSPNNTKSLTGAQKKKTLINAIG 506

Query: 66  ILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIATLLKH 125
            L F F N     I+A  +PN   D++SL EL    I A+F+  +L   D   +A +++ 
Sbjct: 507 RLHFKFQNNVQTSITALYTPNAACDILSLTELAYQNITANFTKMTLDGSDGTTLAPIVEQ 566

Query: 126 GPFYWLSTKYLM 137
           G FYWLS  +L+
Sbjct: 567 GNFYWLSKDFLV 578

>Kwal_12.672 s12 complement(39524..39994) [471 bp, 156 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 461] FULL
          Length = 156

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 83  KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 141

Query: 806 WD 807
           WD
Sbjct: 142 WD 143

>KNAG0G00963 Chr7 complement(194859..195845) [987 bp, 328 aa] {ON}
          Length = 328

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 75/182 (41%), Gaps = 10/182 (5%)

Query: 194 DTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTD 253
           +T  C  C   KST  K  V S V         + L  DL GP          YF++  D
Sbjct: 5   ETSVCATCAISKSTVRKGSVSSSVYTA----PLQLLQADLCGPFRYDNYVDGRYFLTIRD 60

Query: 254 EQSRFRWVFPLRSKDASTVTTVFRNIVAT----FGTQFDTKVLVFQMDRGSEFTNAEIRH 309
             SR    F L  KD S  T  F N +      F T+   KV   + D G EF N  +  
Sbjct: 61  AYSRC--YFALVLKDKSAATLAFTNWILEQENYFSTRGGYKVGTVRTDNGGEFNNTVLHD 118

Query: 310 FFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRN 369
           F +  GI   YT    S  +G  ER +RT+ +  R L  +  + P+LW  ++  A  + N
Sbjct: 119 FLKRKGICHEYTIPHSSYQNGGVERAHRTIQEKVRYLFYAGRVPPYLWPEALSCAVYLIN 178

Query: 370 AL 371
            L
Sbjct: 179 RL 180

>Kwal_54.19474 s54 (1826..2470) [645 bp, 214 aa] {OFF} [contig 416]
           FULL
          Length = 214

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 141 KRKRINYIRAIRHAKMKA-EIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 199

Query: 806 WD 807
           WD
Sbjct: 200 WD 201

>TBLA0F03190 Chr6 (773382..774350) [969 bp, 322 aa] {ON} 
          Length = 322

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 102/216 (47%), Gaps = 19/216 (8%)

Query: 820  KKIINSMIIFTTKRDGTHKCRFVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDM 879
            ++ + S  +FT K DG +K R VA+  +Q  G       A  + + ++   +AIA    +
Sbjct: 35   RQCLGSRWVFTMKDDGRYKSRLVAQEYKQKIGIDYYETFAPVVRYASVRLFLAIADQFSL 94

Query: 880  FIVQLDISSAYLYADLKEELYIRTPPHL---GHKNKIFKLEKSLYGLKQSGANWYENIKK 936
             + ++D  +A+L +++  ++YI+ P       H   + KL+K +YGLKQ+   W  +I  
Sbjct: 95   SVHKMDADTAFLKSEIDGDVYIKQPQGFVDPTHPEYVRKLKKGMYGLKQAPLLWNRHIHH 154

Query: 937  YLTEDCGMSNIRGWPCAFKNED----LIVCLFVDDIIVFGKKHKKCMDLVQL-LKLRYET 991
             LTE  G        C +        +++ L+VDD+++        +D+V+  LK+ Y  
Sbjct: 155  TLTE-LGFQRHAIEHCFYFRYSTTGLILIALYVDDLLI-AAPDNDSLDIVKCTLKIYYSM 212

Query: 992  KVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGME 1027
            K  + G +        + LG+ +      S+S  ME
Sbjct: 213  K--DLGPVN-------NFLGINVNQPSDHSVSISME 239

>Kpol_1054.13 s1054 (30961..32157,32161..32685,32813..33538) [2448 bp,
            815 aa] {ON} (30961..32157,32161..32685,32813..33538)
            [2448 nt, 816 aa]
          Length = 815

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 109/498 (21%), Positives = 207/498 (41%), Gaps = 74/498 (14%)

Query: 802  KHNTWDNSRIYDVKEVNPK--KIINSMIIFTTKRDGT----HKCRFVARGDQQNAGTYDD 855
            +H ++    +Y++ +  PK  K+I    + +TK D      +K RFV +G +Q AG   D
Sbjct: 366  EHESFIKKGVYEIYD-GPKGVKVIPIRTLLSTKTDSANIVKYKARFVCQGFRQVAGEDFD 424

Query: 856  SL-IANTIH-HEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPH----LGH 909
             L I++++   E L   +A+    ++  +Q D+S+A+L  ++ + + ++  P     +G 
Sbjct: 425  PLDISSSVSILETLRIFIALTYTLNLNNLQYDVSTAFLNCNIDKNIIVKPEPLRLNIIGQ 484

Query: 910  K-NKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLIVCLFVDDI 968
            +   ++KL+K++YGLK+S   W + ++ ++T+       +G+     +E+L       DI
Sbjct: 485  REGTLWKLKKTVYGLKRSNIEWIKLVRNFMTK-------QGFTPNSADENLYHKTIGKDI 537

Query: 969  IVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEK 1028
            I+       C+  V    +      + D  I   ES+ ++I  L +              
Sbjct: 538  II-------CLSYVDDFLIATNNLSLRDKLISNMESQ-WEINCLRMV------------- 576

Query: 1029 SLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKLVGLASYLG 1088
                KIP                     I  D   D  EA  +++ +     +G   +  
Sbjct: 577  ----KIP---------------------IPKDE--DHFEARSEKEHENYWSTIGALPWAS 609

Query: 1089 YKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAI 1148
               R ++ Y I+ L      P+     +  ++++YI  T NK L + K  E N   V   
Sbjct: 610  SYTRPEMCYGISKLGAKASKPTINDQRILKRVLRYIKGTLNKSLTFNKC-EWNKAEVLGY 668

Query: 1149 TDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNSIKM 1208
               ++       SQ GY    N   I+  S K   +  S+ E+EL+ I         I+ 
Sbjct: 669  ---SYGTMNQRLSQYGYVFTWNKTPISWCSRKQKSSSTSTFEAELFGIVEAYREGIWIRR 725

Query: 1209 LMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVN 1268
            L+E +  + V   ++ +   ++       E    +K+ G R   +++          Y  
Sbjct: 726  LLEDMNYS-VNTIVVYEDNKSVIATACGSEEHGTSKHIGFRKKFLKEITHSGQCIPHYTK 784

Query: 1269 TDNNIADILTKALPAKRF 1286
            +++N+ADI TK LP   F
Sbjct: 785  SEHNLADIFTKPLPKITF 802

>Kwal_12.680 s12 complement(41412..41750) [339 bp, 112 aa] {OFF}
           [contig 461] FULL
          Length = 112

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 5/100 (5%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 10  PQMFLIDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 66

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNN 117
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR ++ +
Sbjct: 67  KLEAYLSPDIFCDIISTTQLEQFGIYPNFEMRSLRTQEGD 106

>Smik_12.566 Chr12 complement(996127..996498) [372 bp, 123 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 123

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 5/121 (4%)

Query: 223 YNTFEFLHTDLFGPVPNMPTSSPTY-FISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVA 281
           ++T+ F H D F     +   + ++  I   D Q    WV+ L +    ++  VF  I+A
Sbjct: 4   FSTYMFQHVDPFSICQRVYQLALSHSLIRKKDSQ----WVYLLYNCRKESILRVFTTILA 59

Query: 282 TFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLD 341
               QF+++V VF++   S +TN  +  F  + GI PC T+  DSR   VA+R+N  L D
Sbjct: 60  LIDRQFNSEVSVFELQYRSGYTNKVVPIFLMKRGITPCNTNSTDSRTDSVAKRVNPVLFD 119

Query: 342 D 342
           D
Sbjct: 120 D 120

>Kwal_34.16309 s34 (282156..283190) [1035 bp, 344 aa] {ON} YJL113W -
           TyB Gag-Pol protein [contig 710] FULL
          Length = 344

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNT 805
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY KE+DQL KH T
Sbjct: 271 KRKRINYIRAIRHAKMKA-EIAEKSIQYRDAISRNNNSKERSEYKAAYDKEIDQLEKHKT 329

Query: 806 WD 807
           WD
Sbjct: 330 WD 331

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 411 KLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 11  KLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 55

>KNAG0G02840 Chr7 (628866..630110) [1245 bp, 414 aa] {ON} 
          Length = 414

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 90/219 (41%), Gaps = 17/219 (7%)

Query: 157 EFIHRLFGHVNIKIIKDSIRK--GLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVG 214
           E  H   GH   K++ D + K  GL K   Y+   +S      C  C   K    K  + 
Sbjct: 31  ELWHARLGHPG-KLVYDKLAKEIGLAK---YEPSPYS-----LCSTCATAKGQLSKGVIS 81

Query: 215 SRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTT 274
                 +     + +  DL G            F++  D  SR+ +V PL++K A+T   
Sbjct: 82  DF----KTTAPLQLVQVDLCGGFRYEEYVDSKCFLTIRDSYSRYYFVIPLKNKAAATQAL 137

Query: 275 V--FRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVA 332
           +         F T+   KV   + D G EFT+  +  FF   GI    T   +S  +G  
Sbjct: 138 INWIHQQENYFSTRGGYKVGTVRTDNGGEFTSNVLHDFFGSKGITHQLTVTDNSSQNGAV 197

Query: 333 ERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNAL 371
           ER +RTL +  R+LL    + P+LW  ++  A  + N L
Sbjct: 198 ERAHRTLQEKMRSLLIGGRVPPYLWSEALRCAAFLLNRL 236

>Kwal_50.19421 s50 complement(2481..3014) [534 bp, 177 aa] {ON}
           [contig 328] FULL
          Length = 177

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 55/98 (56%), Gaps = 5/98 (5%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 75  PQMFLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 131

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKD 115
           K+ A  SP+I  D+IS  +L+  GIY +F  RSLR +D
Sbjct: 132 KLEAYLSPDIFCDIISTIQLEQFGIYPNFEMRSLRTQD 169

>KNAG0C06675 Chr3 complement(1300967..1301815) [849 bp, 282 aa] {ON}
          Length = 282

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 94/228 (41%), Gaps = 17/228 (7%)

Query: 148 NNILPRFSFEFIHRLFGHVNIKIIKDSIRK--GLIKNISYDNIDWSGFDTFQCPDCLKGK 205
           + + P    E  H   GH   K++ D + K  GL K   Y+   +S      C  C+  K
Sbjct: 22  SGLAPVTKGELWHPRLGHPG-KLVYDKLAKEIGLAK---YEPSPYS-----LCSTCVTAK 72

Query: 206 STQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLR 265
               K  +       +     + +  DL G            F++  D  SR+ +V PL+
Sbjct: 73  GQLSKGVISDF----KATAPLQLVQVDLCGGFRYEEYVDSKCFLTIRDSYSRYYFVIPLK 128

Query: 266 SKDASTVTTV--FRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSV 323
           +K A+T   +         F  +   KV   + D G EFT+  +  FF   GI    T  
Sbjct: 129 NKAAATQALINWIHQQENYFSIRGGYKVGTVRTDNGGEFTSNVLHDFFGSKGITHQLTVT 188

Query: 324 GDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNAL 371
            +S  +G  ER++RTL +  R+LL    + P+LW  ++  A  + N L
Sbjct: 189 HNSSQNGAVERVHRTLQEKMRSLLIGGRVPPYLWSEALRCAAYLLNRL 236

>TBLA0D02690 Chr4 complement(664761..665291) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 55/124 (44%)

Query: 194 DTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTD 253
           D  +C  C+ GK T+H HY  S   Y            +LFGPV  + + +P + +   D
Sbjct: 40  DLNKCEICVAGKMTKHFHYTNSMNNYTMLKTPGSSWTINLFGPVNKVTSGTPRFMMLMVD 99

Query: 254 EQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRE 313
             SR+        K    +     N +    TQF  KV  F  DRGSEFTN +++    +
Sbjct: 100 SVSRYVICTTHLYKIDDEIVAQIDNNIRFIETQFGRKVQEFITDRGSEFTNNDLKLLEDK 159

Query: 314 NGIQ 317
            GIQ
Sbjct: 160 KGIQ 163

>Kwal_2.422 s2 (1627..1932) [306 bp, 101 aa] {OFF} [contig 305] FULL
          Length = 101

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 23  LLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPVKIS 80
            L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +K+ 
Sbjct: 2   FLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVIKLE 58

Query: 81  AASSPNIRYDLISLDELDDAGIYADFSTRSLR 112
           A  SP+I  D+IS  +L+  GIY +F  RSLR
Sbjct: 59  AYLSPDIFCDIISTIQLEQFGIYPNFEMRSLR 90

>TBLA0A06870 Chr1 complement(1684530..1685090) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 66/113 (58%), Gaps = 1/113 (0%)

Query: 1059 SDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTY 1118
            ++  L M++ EYK KVK +QK +G  +YL  + R DL + ++ + +  LYP  +V+    
Sbjct: 53   NEDTLLMNKTEYKEKVKYIQKSIGKLNYLRTRGRLDLEFAVSKITRFALYPHVKVIKAVN 112

Query: 1119 QLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNN 1171
            +LI+Y +  R+  ++  + K++  + +T +TDA+  ++   KS++G  I   N
Sbjct: 113  RLIKYTYVKRDLNVVMKREKKQPDE-ITVVTDASLGSEYDVKSRIGGIIWFGN 164

>Skud_14.332 Chr14 complement(599559..600476) [918 bp, 306 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 306

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%)

Query: 419 GYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPY 478
           GYAL PS+ S+GY+IYVP L K +DT+NYV+   + +     NYD+  FD  +  +  PY
Sbjct: 3   GYALNPSRNSYGYIIYVPSLKKTIDTTNYVISHGEQSRLDQFNYDTLTFDADIIRLTAPY 62

Query: 479 DDFLNDTSA 487
             F+    A
Sbjct: 63  QSFIEQNEA 71

>Kpol_322.9 s322 (19758..20504) [747 bp, 249 aa] {ON} (19758..20504)
           [747 nt, 249 aa]
          Length = 249

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 88/223 (39%), Gaps = 23/223 (10%)

Query: 55  QDNPIPISSTGILKFHFANG-PPVKISAASSPNIRYDLISLDEL-DDAGI-----YADFS 107
           +++PI I   G L+    N    +K      P     ++S+  L +D G      Y   +
Sbjct: 16  ENHPITIKGEGFLQIKIDNSNKTIKTKVYFCPYESATVLSIATLQEDTGYELERGYKFLT 75

Query: 108 TRSLRDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPRF---------SFEF 158
              LR K + V  TL       W+++  L++    +N   +N   R          S + 
Sbjct: 76  NNILRIKVSKVDKTL-------WINSNNLLVKNEIKNKTTSNKTVRVVTNKTKKKVSIQE 128

Query: 159 IHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVK 218
            H  F H++  ++K +I  G+  ++       +    +QC DCL+GK   H HY GS   
Sbjct: 129 AHAKFNHIDKNVVKATIESGIFADVDGLKETSTEIAQYQCEDCLRGKLKNHNHYTGSMNA 188

Query: 219 YQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWV 261
           +            DL GP+     + P Y +   D  SR+  +
Sbjct: 189 HYVNVLPGASWSIDLRGPIVRSHKNVPHYLLVMVDNVSRYMMI 231

>KAFR0A01750 Chr1 complement(360823..362442) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 67/136 (49%), Gaps = 8/136 (5%)

Query: 785 EKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCRFVAR 844
           +  ++R A  KEL+   K +T+       V      + + +  +FT K + T K R VA+
Sbjct: 396 DANIWRAACEKELNAFQKQSTFKL-----VPAPGDARPLGTRWVFTLKSNNTAKARLVAQ 450

Query: 845 GDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTP 904
           G +Q A        +  IH+ ++   +A++      I Q+D+ +A+L + L E +Y+R P
Sbjct: 451 GHRQRASIDYTETFSPVIHYASVRVFLALSATMSYLIHQMDVDTAFLNSKLDEPVYVRQP 510

Query: 905 PHL---GHKNKIFKLE 917
           P      H + +++LE
Sbjct: 511 PGFIDTNHPDWVWRLE 526

>Kpol_137.2 s137 (1756..2184) [429 bp, 142 aa] {ON} (1756..2184) [429
            nt, 143 aa]
          Length = 142

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 60/127 (47%), Gaps = 2/127 (1%)

Query: 1164 GYFILVNNKIITARSTK-ATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKL 1222
            GY   +    +T  S K  T  C+SSTE+E  A S  +  +  +  L   +     K KL
Sbjct: 7    GYVTRLAGGCVTWSSKKIKTTVCLSSTEAEYIAASEAVKEIEWLGDLTTVMDLTLNKTKL 66

Query: 1223 ITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTKALP 1282
              D+ PAI + +       R K+   R  KIR  V+   + LEYVNT +  ADILTK L 
Sbjct: 67   YVDNEPAIKL-SKNPVMHPRTKHIALRYHKIRHAVEQDIVDLEYVNTKDQQADILTKILA 125

Query: 1283 AKRFNDL 1289
              +F  L
Sbjct: 126  KSQFETL 132

>Smik_12.38 Chr12
           (78253..78540,78544..78648,78655..78693,78697..78861,
           78865..79158) [891 bp, 297 aa] {OFF} YPL060C-A (PSEUDO)
          Length = 297

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 3/125 (2%)

Query: 285 TQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCR 344
           TQFD KV      +G+EF N +I  +F   GI   + +  D  A+G AER  RT++    
Sbjct: 161 TQFDRKVREINSAQGTEFINDQIAEYFVLKGIHHIFPAT-DHAANGRAERYIRTIVTYET 219

Query: 345 TLLESSGLSPHLWFYSVEFATLIRNALLN--TTYKTXXXXXXXXXXXXXXTILPFGQHVI 402
           TLL+ S L    W Y+V  AT +RN L N  T                  + LPFG+  I
Sbjct: 220 TLLKHSKLRIKFWEYAVTSATNVRNCLENKATVQLPLQAISSQFVKVRFMSFLPFGEQGI 279

Query: 403 THDTN 407
             + N
Sbjct: 280 IWNHN 284

>Kpol_377.2 s377 (4260..7559) [3300 bp, 1099 aa] {ON} (4260..7559)
           [3300 nt, 1100 aa]
          Length = 1099

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 74/174 (42%), Gaps = 6/174 (3%)

Query: 198 CPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSR 257
           CP C  GK    K    SR KY    +  + +  DL G        S  YF++  D  +R
Sbjct: 548 CPTCSLGKGLIKKG-TNSRTKYT---SPLQLIQVDLCGNFRYKEYQSNRYFMTIRDAYTR 603

Query: 258 FRWVFPLRSK-DASTVTTVFRNIVATFGTQFDT-KVLVFQMDRGSEFTNAEIRHFFRENG 315
           +  V  L++K DA+     + N    F T   + KV   + D G EF N  +  +    G
Sbjct: 604 YYTVIHLKTKKDATQKLIDWINQTENFFTSRGSYKVGSIRTDNGGEFKNNILHEYMTSKG 663

Query: 316 IQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRN 369
           I    T    S  +G  ER +RT+ +  R LL S  + P LW  +V  A  + N
Sbjct: 664 ITHELTIPYSSFQNGAVERAHRTIEERTRCLLISGRVPPQLWSEAVSCAVYLIN 717

>Kpol_267.2 s267 (3000..3956) [957 bp, 318 aa] {ON} (3000..3956) [957
            nt, 319 aa]
          Length = 318

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/310 (20%), Positives = 134/310 (43%), Gaps = 27/310 (8%)

Query: 884  LDISSAYLYADLKEELYIRTPPHL-----GHKNKIFKLEKSLYGLKQSGANWYENIKKYL 938
            +D+ +A+L + +++ +Y++ PP        H+  ++KL   +YGLKQ+   W ++I + L
Sbjct: 1    MDVDTAFLNSQMEDAVYVKQPPSFIDSDPAHEGWVWKLYGGMYGLKQAPLFWNKHINRSL 60

Query: 939  TEDCGMSNIRGWPCAFK---NEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVN 995
            T      N + +   FK   +  L++ L+VDD+++     +      + L+  Y  K  +
Sbjct: 61   TALGFTRNEKEFGLYFKQTADGPLLIGLYVDDLLIAAPSPRILSLTKKKLQELYSMK--D 118

Query: 996  DGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPG 1055
             G +       +  LG+ IT   + +++  +   + +  P     L+   +++  P  P 
Sbjct: 119  LGPV-------FKFLGMNITQFSNGNITLSLADYIAKAAPDQQTPLH---KKVHIPLFPT 168

Query: 1056 IILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLS 1115
            I   D    ++E      V   Q++V    ++    R D+ Y +++L +    P    + 
Sbjct: 169  INYFDDNSPVAE-----NVPAYQRIVDQLIFIANAGRPDIAYSVSLLPRFLKDPRVVHVY 223

Query: 1116 LTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIIT 1175
              ++++QY++ T  + L +           +  +  + A+ P   S  GY   +    +T
Sbjct: 224  AAHRVMQYLYTTCFQGLSYRAGSPLQLTVYSDASHGSLADMP--FSTGGYVTRLAGGCVT 281

Query: 1176 ARSTKATLTC 1185
              S K   T 
Sbjct: 282  WSSKKIKTTV 291

>Kpol_248.1 s248 complement(4851..5807) [957 bp, 318 aa] {ON}
            complement(4851..5807) [957 nt, 319 aa]
          Length = 318

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/310 (20%), Positives = 134/310 (43%), Gaps = 27/310 (8%)

Query: 884  LDISSAYLYADLKEELYIRTPPHL-----GHKNKIFKLEKSLYGLKQSGANWYENIKKYL 938
            +D+ +A+L + +++ +Y++ PP        H+  ++KL   +YGLKQ+   W ++I + L
Sbjct: 1    MDVDTAFLNSQMEDAVYVKQPPSFIDSDPAHEGWVWKLYGGMYGLKQAPLFWNKHINRSL 60

Query: 939  TEDCGMSNIRGWPCAFK---NEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVN 995
            T      N + +   FK   +  L++ L+VDD+++     +      + L+  Y  K  +
Sbjct: 61   TALGFTRNEKEFGLYFKQTADGPLLIGLYVDDLLIAAPSPRILSLTKKKLQELYSMK--D 118

Query: 996  DGKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPG 1055
             G +       +  LG+ IT   + +++  +   + +  P     L+   +++  P  P 
Sbjct: 119  LGPV-------FKFLGMNITQFSNGNITLSLADYIAKAAPDQQTPLH---KKVHIPLFPT 168

Query: 1056 IILSDSKLDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLS 1115
            I   D    ++E      V   Q++V    ++    R D+ Y +++L +    P    + 
Sbjct: 169  INYFDDNSPVAE-----NVPAYQRIVDQLIFIANAGRPDIAYSVSLLPRFLKDPRVVHVY 223

Query: 1116 LTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIIT 1175
              ++++QY++ T  + L +           +  +  + A+ P   S  GY   +    +T
Sbjct: 224  AAHRVMQYLYTTCFQGLSYRAGSPLQLTVYSDASHGSLADMP--FSTGGYVTRLAGGCVT 281

Query: 1176 ARSTKATLTC 1185
              S K   T 
Sbjct: 282  WSSKKIKTTV 291

>Skud_46.1 Chr46 complement(1..294) [294 bp, 98 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 98

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 732 WEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRK 791
           W   NM S++ PP+ ++RIH I +VK   +  P    T++ Y +AI+ N+N  EKE Y +
Sbjct: 31  WNAKNMRSLE-PPRSKKRIHLIAAVKAVKSIKP--IRTTLRYDEAITYNKNNEEKEKYTE 87

Query: 792 AYMKELDQLMK 802
           AY KE++QL+K
Sbjct: 88  AYHKEVNQLLK 98

>KLTH0B04686g Chr2 (381618..381932) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 40/78 (51%)

Query: 768 NTSMSYRDAISSNQNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMI 827
           +T +SY+DAI  N N  EK  +  AY +EL +L    TWD +       + P+ II++  
Sbjct: 25  DTWLSYKDAILDNINAPEKSQFENAYARELSRLESVGTWDATAPRPAHSLAPEAIIDTNF 84

Query: 828 IFTTKRDGTHKCRFVARG 845
            F T  +G   CR V  G
Sbjct: 85  EFNTNSNGEKCCRVVQEG 102

>Skud_14.331 Chr14 complement(599259..599558) [300 bp, 100 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 100

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 732 WEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRK 791
           W   NM S++ PP+ ++RIH I +VK AV +  ++  T + Y +AI+ N+N  EKE Y +
Sbjct: 31  WNAKNMRSLE-PPRSKKRIHLIAAVK-AVKSIKTIRPT-LRYDEAITYNKNNVEKEKYTE 87

Query: 792 AYMKELDQLMKHN 804
           AY KE++QL+K N
Sbjct: 88  AYHKEVNQLLKMN 100

>Kwal_12.679 s12 complement(41150..41341) [192 bp, 63 aa] {OFF}
           [contig 461] FULL
          Length = 63

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 153 RFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGK 205
           +   E +H    H+N+K I+ S+  GLIK++   ++DWS  + F+C  C+  K
Sbjct: 10  KIPLEILHESLSHINVKYIRKSVELGLIKDVKISDVDWSELEWFECESCMARK 62

>Kwal_47.19345 s47 (1200237..1200536) [300 bp, 99 aa] {ON} YAR009C -
           TyB Gag-Pol protein [contig 344] FULL
          Length = 99

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 1/93 (1%)

Query: 340 LDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTXXXXXXXXXXXXXXTILPFGQ 399
           ++DCRT+L+ S +  HLWF++V+ A   RN+L N T  T               +  FGQ
Sbjct: 1   MNDCRTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGTSPRSKIGLPPIRAQKLPRFGQ 60

Query: 400 HVITHDTNPI-DKLHVRGHHGYALTPSKESHGY 431
             + HD + +  KL  R   GY L  S+ S+ +
Sbjct: 61  PCMVHDYSALKKKLKERSIPGYILHKSETSYRF 93

>Kwal_34.15661 s34 complement(1269..1556) [288 bp, 95 aa] {OFF}
           [contig 312] FULL
          Length = 95

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 5/89 (5%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQ+ PI I+  GI++ +   G  V
Sbjct: 10  PQMFLIDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQEQPIAITGKGIIELNL--GRVV 66

Query: 78  KISAASSPNIRYDLISLDELDDAGIYADF 106
           K+ A  SP+I  D+IS  +L+  GIY  F
Sbjct: 67  KLEAYLSPDIFCDIISTTQLEQFGIYPKF 95

>Smik_13.225 Chr13 (360997..361116) [120 bp, 40 aa] {ON}  YNL054W-B
            (REPEAT)
          Length = 40

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/40 (52%), Positives = 30/40 (75%)

Query: 1156 QPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYA 1195
            QP YKSQVG   L+N K+I  +  KA+LTC S+TE+E+++
Sbjct: 1    QPYYKSQVGNIFLLNGKVIGGKLIKASLTCTSTTEAEMHS 40

>KNAG0D03630 Chr4 (664165..664320) [156 bp, 51 aa] {ON} 
          Length = 51

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 31/39 (79%)

Query: 340 LDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKT 378
           ++DCRTLL+++ L  +LWFY V+F T++RN++ N T ++
Sbjct: 1   MNDCRTLLKTTNLPYYLWFYDVQFVTILRNSVYNDTLQS 39

>Skud_46.3 Chr46 complement(1654..1752) [99 bp, 32 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 32

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 28/31 (90%)

Query: 237 VPNMPTSSPTYFISFTDEQSRFRWVFPLRSK 267
           V ++P S+P+YFISFTDE+++F+WV+PL+ +
Sbjct: 1   VHHLPKSAPSYFISFTDEKTKFKWVYPLQDR 31

>NCAS0B05650 Chr2 complement(1073091..1073969) [879 bp, 292 aa] {ON}
           
          Length = 292

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%)

Query: 13  VDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIPISSTGILKFHFA 72
            +D   LPG+LLL++G+STS+I +S LLH  ++     V DAQ  PIP  ++G L  +F 
Sbjct: 214 AEDYPSLPGHLLLNTGSSTSLIHYSDLLHNMKRTTDTMVPDAQSRPIPFQASGSLVLNFK 273

Query: 73  NGPPVKISA 81
           +   + + A
Sbjct: 274 HKNSIAVRA 282

>Kwal_27.11216 s27 complement(690403..690597) [195 bp, 64 aa] {OFF}
            [contig 345] FULL
          Length = 64

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 981  LVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSKSLSFGMEKS 1029
            LVQL K  +ETKVV +G  EK     YDILGLEI Y++   +  GMEK+
Sbjct: 15   LVQLQK-EFETKVVAEGTPEKDGFAKYDILGLEIEYKKDDKMLIGMEKT 62

>YCL074W Chr3 (2824..3750) [927 bp, 308 aa] {OFF} Pseudogene: encodes
            fragment of Ty Pol protein
          Length = 308

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/318 (21%), Positives = 137/318 (43%), Gaps = 30/318 (9%)

Query: 884  LDISSAYLYADLKEELYIRTPPHLGHK---NKIFKLEKSLYGLKQSGANWYENIKKYLTE 940
            +D+ +A+L + + E +Y++ PP   ++   + +++L   +YGLKQ+   W E+I   L +
Sbjct: 1    MDVDTAFLNSTMDEPIYVKQPPGFVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTL-K 59

Query: 941  DCGMSNIRGWPCAF----KNEDLIVCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVND 996
              G     G    +     +  + + ++VDD++V     K    + Q L   Y  K  + 
Sbjct: 60   KIGFCRHEGEHGLYFRSTSDGPIYIAVYVDDLLVAAPSPKIYDRVKQELTKLYSMK--DL 117

Query: 997  GKIEKAESRDYDILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGI 1056
            GK++K        LGL I    +  ++  ++  + +          SE    K    P  
Sbjct: 118  GKVDK-------FLGLNIHQSSNGDITLSLQDYIAK------AASESEINTFKLTQTP-- 162

Query: 1057 ILSDSK-LDMSEAEYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLS 1115
             L +SK L  + + + + +   Q +VG   +     R D+ Y +++L++    P    L 
Sbjct: 163  -LCNSKPLFETTSPHLKDITPYQSIVGQLLFCANTGRPDISYPVSLLSRFLREPRAIHLE 221

Query: 1116 LTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIIT 1175
               ++++Y++ TR+  L +    +         +  A  + P   S  GY  L+    +T
Sbjct: 222  SARRVLRYLYTTRSMCLKYRSGSQLALTVYCDASHGAIHDLP--HSTGGYVTLLAGAPVT 279

Query: 1176 ARSTK-ATLTCISSTESE 1192
              S K   +  + STE+E
Sbjct: 280  WSSKKLKGVIPVPSTEAE 297

>Kpol_381.1 s381 (3213..6806) [3594 bp, 1197 aa] {ON} (3213..6806)
           [3594 nt, 1198 aa]
          Length = 1197

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 82/215 (38%), Gaps = 15/215 (6%)

Query: 160 HRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKY 219
           H  FGH  +       RK  +  I  D I  S       P C   K    K     +   
Sbjct: 459 HARFGHPGLDRYNTVARKFSLPRIVPDQISVS-------PTCALAKGVMRK----GKPSD 507

Query: 220 QREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNI 279
            +     + +  DL G           YF++  D  +R+  V  L+ K  + V  +F  I
Sbjct: 508 TKLTCPLQLVQVDLCGGFRYKEFEDNKYFMTIRDAFTRYYVVIHLKDKKDAPVQ-LFNWI 566

Query: 280 VAT---FGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLN 336
             T     ++   KV   + D G EF N  +  F  E GI    T   +S  +G  ER +
Sbjct: 567 KKTEKFLASRGGYKVGSLRTDNGGEFRNKLLHDFLIEQGITHELTVPYNSFPNGGVERGH 626

Query: 337 RTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNAL 371
           RT+ +  R LL S  + P LW  +V  A  + N +
Sbjct: 627 RTIEETTRCLLISGRVPPSLWSEAVSCAVYLINRI 661

>Smik_108.1 Chr108 (1..492) [492 bp, 163 aa] {ON} YNL054W-B (REPEAT)
          Length = 163

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 77/148 (52%), Gaps = 2/148 (1%)

Query: 1146 TAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVIPLLNS 1205
            T ITDA+   +   +S++G  I     I    S K++  C+SSTE+EL+AI        +
Sbjct: 1    TTITDASVGTEYDAQSRIGVIIWYGKNIFNVYSNKSSNKCVSSTEAELHAIYEGYADSET 60

Query: 1206 IKM-LMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKL 1264
            +K  L E   G   +  ++TDS PAI  +N +   + + K+   ++  I++++K   +KL
Sbjct: 61   LKATLTELGEGGDKELTMLTDSKPAIEGLN-RSYLQPKQKFTWIKTEIIKEKIKEKIIKL 119

Query: 1265 EYVNTDNNIADILTKALPAKRFNDLTNV 1292
              +   +NIAD+LTK +    F+    V
Sbjct: 120  IKIKGKDNIADLLTKPVSISDFDRFIKV 147

>TBLA0B08195 Chr2 complement(1955768..1956820) [1053 bp, 350 aa]
           {ON}
          Length = 350

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 60/152 (39%), Gaps = 7/152 (4%)

Query: 320 YTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKTX 379
           +TS  +  A+   ER  RT++ D RTLL  + L    W Y+ + +  +RN   N   K  
Sbjct: 6   FTSTQNHSANARVERTIRTIITDTRTLLLQAKLPLKFWHYAAKASAEVRNCTYNKNTKDA 65

Query: 380 --XXXXXXXXXXXXXTILPFG--QHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYV 435
                            LPFG    +  H +    K          L+   +S GY  Y+
Sbjct: 66  PLNVISELPVKIILRNFLPFGAPATIWNHKSK---KTSAPSLQAVVLSKDPQSFGYFFYI 122

Query: 436 PHLHKVLDTSNYVVIRSDTNISADHNYDSTVF 467
           P  ++V+ T+N+ +     N     N + T+ 
Sbjct: 123 PKENRVITTTNFKIPDYSVNSQQKSNPEETII 154

>TBLA0D04530 Chr4 (1122477..1123892) [1416 bp, 471 aa] {ON} 
          Length = 471

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 88/417 (21%), Positives = 181/417 (43%), Gaps = 47/417 (11%)

Query: 897  EELYIRTPPHLG---HKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCA 953
            +E+Y++ PP      + N ++KL+K + GL+     W E IK+ L    G          
Sbjct: 64   DEIYVKQPPLFNSSTYPNHVWKLKKPIPGLRIIPLRWAETIKETLIY-LGFKEATATRFF 122

Query: 954  FKN--EDLIVCLFVDDIIVFGKKHKKCM-DLVQLLKLRYETKVVNDGKIEKAESRDYDIL 1010
            FK+   D+I+     + ++F       + +L + LK R+  K  + G+++K       I 
Sbjct: 123  FKHIPNDIILAFPYGENVLFASSETSILTELKKKLKKRFSYK--DQGELKK-------IF 173

Query: 1011 GLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSE--A 1068
             L I  +    +S   +  +   I    +T+           +P +    SK D ++  +
Sbjct: 174  DLNIMNKPKHYISITCDDYVSTLIEHFDMTVE----------KPILKPLPSKFDFTDNSS 223

Query: 1069 EYKRKVKLMQKLVGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTR 1128
             Y  K      ++G  +++    R D+L Y+N+L+++   P     + T QL+ Y++ TR
Sbjct: 224  PYLEKNTEYHIVLGYLTHISDIARPDILSYVNLLSKYAKKPRAIHFNATLQLLGYVFTTR 283

Query: 1129 NKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTK-ATLTCIS 1187
            N  + +        +  ++ ++    N+  +       IL+ +  I+  S + +   C S
Sbjct: 284  NLSIRYTYKSPDTIKLYSSGSEILALNKTSF--TYSNMILLGDSPISWYSKQISVFKCTS 341

Query: 1188 STESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLR--NKY 1245
              ++E++A  + +  ++ +  L+E I  + +           +SI+ ++ E + +  N Y
Sbjct: 342  LPDAEIFAAGVAVREVDWLDYLIEEINYHSL------GLMKKVSIMTNKPELRFKESNSY 395

Query: 1246 --FGARSMKIRDEVKYSHLKLEYVNTDN-----NIADILTKALPAKRFNDLTNVWMV 1295
              F  + +K+R  +    L L+ +   N     +IA ILT  +P K+F  L    +V
Sbjct: 396  ETFSYK-VKVRYAIVQEALILKTIILINIPDSEHIAKILTDVIPYKKFLTLRKKILV 451

>Kpol_1018.175 s1018 complement(444710..447160) [2451 bp, 816 aa]
           {ON} complement(444710..447160) [2451 nt, 817 aa]
          Length = 816

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 69/176 (39%), Gaps = 6/176 (3%)

Query: 198 CPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSR 257
           CP C   K    K     +    +     + +   L G           YF++  D  +R
Sbjct: 493 CPTCALAKGVMRK----GKPSDTKLTCPLQLVQVGLCGGFRYKEFKDNKYFMTIRDAFTR 548

Query: 258 FRWVFPLRSKDASTVTTV--FRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENG 315
           +  V  L+ K  + V  +   +     F ++   +V     + G EF N  +  FF E G
Sbjct: 549 YYVVIHLKDKKDAPVQLINWIKKTEKYFASRGGYRVGSLCTNNGGEFRNKLLHDFFIEQG 608

Query: 316 IQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNAL 371
           I    T   DS  +G  ER +RT+ +  R LL S  + P LW  +V  A  + N +
Sbjct: 609 ITHELTIPYDSFQNGGIERGHRTIEETTRCLLISGRVPPSLWSEAVSCAVYLINRI 664

>TBLA0B06380 Chr2 (1507107..1507604) [498 bp, 165 aa] {ON} 
          Length = 165

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 154 FSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNIDWSGFDTFQCPDC 201
           F+ + IH LFGH+NIK IK +I   +I ++  D IDW+G D    P C
Sbjct: 16  FTMQMIHNLFGHLNIKDIKRTIDAKVIGSLRSDMIDWTGLDHVS-PAC 62

>Kpol_1035.1 s1035 complement(2508..3287) [780 bp, 259 aa] {ON}
           complement(2508..3287) [780 nt, 260 aa]
          Length = 259

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 91/248 (36%), Gaps = 19/248 (7%)

Query: 19  LPGYLLLDSGASTSIIRHSSLL------HFPQQPIHIGVQDAQDNPIPISSTGILKFHFA 72
           L  ++++D+G+  +I      L      H P + + +G     D+P+ I    +L     
Sbjct: 16  LKDHVIIDTGSGYNITNRKDWLLEYGSIHNPPELLEVG---DGDSPLKIVGFRLLPVRLN 72

Query: 73  NGPPVKISAASSPNIRYDLISLDEL-DDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWL 131
               V       PN    +IS ++L  D G+  +     L  KD       LK     W+
Sbjct: 73  KNTIVGTGTFYCPNEDTTIISANKLWRDTGLSLNTGYDKLVGKD--CALNTLKIEDTIWI 130

Query: 132 STKYLMLPARSRNHRINNIL------PRFSFEFIHRLFGHVNIKIIKDSIRKGLIKNISY 185
            ++ L+  +     R   +L      P  S    H    H+  ++I+ S++     +++ 
Sbjct: 131 PSRELIYASHENKLRAVRLLNIKINKPDISLLEAHLRLNHLPSQVIQKSVKNNFFYDVN- 189

Query: 186 DNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSP 245
           +  D        C  C  GK T+H HY  +   Y            D FGPV   P +  
Sbjct: 190 EIKDHKSTKNLWCQTCSAGKMTRHFHYTDTMNHYSSIKEPGSSWSLDTFGPVKPTPKNDD 249

Query: 246 TYFISFTD 253
            Y +   D
Sbjct: 250 KYMLVMID 257

>Kpol_272.2 s272 complement(12525..12788) [264 bp, 87 aa] {ON}
            complement(12525..12788) [264 nt, 88 aa]
          Length = 87

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 1219 KNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILT 1278
            K KL  D+ PAI + +       R K+   R  KIR  V+   + LEYVNT +  ADILT
Sbjct: 8    KTKLYVDNEPAIKL-SKNPVMHPRTKHIALRYHKIRHAVEQDIVDLEYVNTKDQQADILT 66

Query: 1279 KALPAKRFNDL 1289
            K L   +F  L
Sbjct: 67   KILAKSQFETL 77

>Kwal_36.16337 s36 (3201..3458) [258 bp, 85 aa] {OFF} [contig 364]
           FULL
          Length = 85

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 23  LLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQD-NPIPISSTGILKFHFANGPPVKI 79
            L+DSGAS SI  +S        P+    +  DAQ+  PI IS  GI++ +   G  +K+
Sbjct: 2   FLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQEVQPIAISGKGIIELNL--GRVIKL 58

Query: 80  SAASSPNIRYDLISLDELDDAGIYADF 106
            A  SP+I  D+IS  +L+  GIY  F
Sbjct: 59  EAYLSPDIFCDIISTIQLEQFGIYPIF 85

>Kpol_1036.29 s1036 complement(71398..71730) [333 bp, 110 aa] {ON}
            complement(71398..71730) [333 nt, 111 aa]
          Length = 110

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 1219 KNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILT 1278
            K KL  D+ PAI + +       R K+   R  KIR  V+   + LEYVNT +  ADILT
Sbjct: 31   KTKLYVDNEPAIKL-SKNPVMHPRTKHIALRYHKIRHAVEQDIVDLEYVNTKDQQADILT 89

Query: 1279 KALPAKRFNDL 1289
            K L   +F  L
Sbjct: 90   KILAKSQFETL 100

>Suva_6.192 Chr6 (348905..350707) [1803 bp, 600 aa] {ON} YPL060C-A
           (REPEAT)
          Length = 600

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 112/268 (41%), Gaps = 25/268 (9%)

Query: 24  LLDSGASTSIIRHSSLLHFPQ------QPIHIGVQDAQDNPIPISSTGILKFHFANGPPV 77
           ++D+G+  +I  +  LLH  +      Q   IG    ++N + +  +G +K    N    
Sbjct: 273 IIDTGSGVNITNNKELLHNYKDNKENIQFFGIG----KNNSVSVKGSGYIKIK-GNTDDD 327

Query: 78  KISAASSPNIRYDLISLDEL---DDAGIYADFSTRSLRDKDNNVIATLLKHGPFYWLSTK 134
            + A   P     +IS  EL    D  +  ++ T   RD +   I T +K+G  Y     
Sbjct: 328 YLLAHYVPEEETTIISGYELAKETDLVLSRNYFTLGNRDMN---IKTQVKNGIIYVKIDD 384

Query: 135 YLMLPARS--RNHRINNILPR---FSFEFIHRLFGHVNIKIIKDSIRKGLIKNISYDNID 189
            +  PA    R+    N  P+    S    H+  GH  ++ I++SI+    +  S D I 
Sbjct: 385 IIDHPAYDVIRSATQPNSSPKTKCLSLNDAHKRMGHTGVQQIENSIKHSHYEE-SIDLIK 443

Query: 190 WSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFI 249
               + F C  C   K+T+  HY GS  ++  ++        D+FGPV N  + +  Y  
Sbjct: 444 EP--NEFWCETCKVSKATRRNHYAGSIKEHSIDHEPGSSWCMDIFGPVTNSNSDAKRYMF 501

Query: 250 SFTDEQSRFRWVFPLRSKDASTVTTVFR 277
              D  +++       +K+A TV  + +
Sbjct: 502 IMVDNNTKYCITSTHFNKNAETVLILIK 529

>Kwal_34.16308 s34 (281969..282232) [264 bp, 87 aa] {OFF} [contig
           710] FULL
          Length = 87

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%)

Query: 340 LDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYKT 378
           ++DCRT+L+ S +  HLWF++V+ A   RN+L N T  T
Sbjct: 1   MNDCRTILKGSKMPKHLWFHAVKTACNHRNSLFNPTLGT 39

>Kwal_14.769 s14 (34464..34850) [387 bp, 128 aa] {OFF} [contig 245]
           FULL
          Length = 128

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 746 QRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSNQNVREKELYRKAYMK 795
           +R+RI+YI +++HA      +   S+ YRDAIS N N +E+  Y+ AY K
Sbjct: 78  KRKRINYIRAIRHA-KMKAEIAEKSIQYRDAISRNNNSKERSEYKAAYDK 126

>Kpol_1061.17 s1061
           (43191..43412,43416..43739,43743..44006,44010..44084)
           [885 bp, 295 aa] {ON}
           (43191..43412,43416..43739,43743..44006,44010..44084)
           [885 nt, 295 aa]
          Length = 295

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 90/234 (38%), Gaps = 23/234 (9%)

Query: 152 PRFSFEFIHRLFGHVNIKIIKDSIRKGL------IKNISYDNIDWSGFDTFQCPDCLKGK 205
           P  S    H    H+  ++I++S++         IK +  +   W       C  C   K
Sbjct: 20  PEISLLEAHLRLNHLTSQVIQESVKNNTFYDLDKIKELKTNKNLW-------CQTCNTEK 72

Query: 206 STQHKHYVGSRVKYQ--REYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFP 263
            T   HY  +   Y   +E      L+T   GPV   P +   Y +   D  SR+  +  
Sbjct: 73  MTNF-HYTDTMNHYSSIKEPGLSWSLYT--LGPVKLTPANHDKYMLMMIDNISRYILIST 129

Query: 264 LRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSV 323
             S D    T      +    TQF   V    MDRG+EF N E+     E GI+  +TS 
Sbjct: 130 NNSMDMIPFTAHIEKNIKYIQTQFGRGVQELIMDRGNEFDNLEMIDLCAEYGIR-IFTSA 188

Query: 324 GDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYSVEFATLIRNALLNTTYK 377
            D   +  AE     ++ D RTL   S +    W ++ + A  +R      TYK
Sbjct: 189 QDHSTNTRAEWGITIIITDIRTLFIRSRVPLKYWNFAAKAAVNVRKC----TYK 238

>Kwal_26.7895 s26 complement(558601..558861) [261 bp, 86 aa] {OFF}
          [contig 55] FULL
          Length = 86

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 20 PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
          P   L+DSGAS S   +S        P+    +  DAQD PI I+  GI++ +   G  +
Sbjct: 10 PQMFLIDSGASFSTFSNSKFFT-ELYPVETDDEMFDAQDQPIAITGKGIIELNL--GRVI 66

Query: 78 KISAASSPNIRYDLIS 93
          K+ A  SP+I  D+IS
Sbjct: 67 KLEAYLSPDIFCDIIS 82

>Kpol_455.14 s455 complement(36863..37699) [837 bp, 278 aa] {ON}
           complement(36863..37699) [837 nt, 279 aa]
          Length = 278

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%)

Query: 283 FGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDD 342
           F ++   KV   + D G EF N  +  +    GI    T    S  +G  ER +RT+ + 
Sbjct: 37  FSSRGGYKVGSIKTDNGGEFKNTVLHEYLISKGITHELTIPYSSFQNGAVERAHRTIEER 96

Query: 343 CRTLLESSGLSPHLWFYSVEFATLIRN 369
            R+LL S  + P LW  +V  A  + N
Sbjct: 97  ARSLLISGRVLPELWSEAVFCAVYLIN 123

>Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {ON}
           complement(68315..70429) [2115 nt, 705 aa]
          Length = 704

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 54/138 (39%), Gaps = 10/138 (7%)

Query: 197 QCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQS 256
           QCP C   ++ Q    +   +   R    F   H D  GP+ +       YF+   D  S
Sbjct: 353 QCPRC---ETYQKFRDIPIELPEIRRIPVFSRWHLDFAGPLKD--KDGYKYFLLAADYTS 407

Query: 257 RFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGI 316
               V PLR +   +V  + R I A FG+       +   D G +F NA I    R   +
Sbjct: 408 NLILVKPLREQTFHSVYEIMRAIYAIFGSPH-----MLITDNGRQFANAIIPQVARSLKL 462

Query: 317 QPCYTSVGDSRAHGVAER 334
           +   +S    R +  AER
Sbjct: 463 KYYQSSAYHPRGNSKAER 480

>NCAS0G02330 Chr7 complement(413199..415172) [1974 bp, 657 aa] {ON} 
            retrotransposon
          Length = 657

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 50/109 (45%), Gaps = 7/109 (6%)

Query: 226 FEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGT 285
           F   H D  GP+P    +   +F+   D  S F  V P R+ DA TV  +  +I++ FG 
Sbjct: 332 FSRWHLDFAGPLPK--DNIYRHFLIAVDYTSNFVVVQPARAADADTVKDMILHILSMFGK 389

Query: 286 QFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAER 334
             DT V     D    F N  +R    + GI+  ++SV   R +  AER
Sbjct: 390 P-DTIV----TDNAKSFENQVVRPLTTKLGIKYLHSSVYHPRGNSKAER 433

>Kwal_55.19798 s55 complement(132074..132382) [309 bp, 102 aa] {OFF}
           [contig 159] FULL
          Length = 102

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 411 KLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 11  KLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 55

>Kpol_1059.43 s1059 complement(99187..99804) [618 bp, 205 aa] {ON}
            complement(99187..99804) [618 nt, 206 aa]
          Length = 205

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%)

Query: 1215 GNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIA 1274
             N +   + TDS P+I  +N    +K R+K+   +  K+ ++V+ + + +E +    N+A
Sbjct: 97   SNNIDINIFTDSKPSIQFLNKDYRSKKRDKFIDLKLAKLSEQVRENIIAIEKIPGVTNVA 156

Query: 1275 DILTKALPAKRF 1286
            DILTK +   +F
Sbjct: 157  DILTKPVTTIQF 168

>Kwal_12.675 s12 complement(40166..40564) [399 bp, 132 aa] {ON}
           YLR035C-A - Ty ORF [contig 461] FULL
          Length = 132

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 411 KLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 11  KLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 55

>KNAG0J01130 Chr10 complement(201867..202607) [741 bp, 246 aa] {ON} 
          Length = 246

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 77/165 (46%), Gaps = 12/165 (7%)

Query: 1119 QLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARS 1178
            +++ Y++ TR  ++++   +E +   +   + A++A+    KS  GY +      ++  S
Sbjct: 21   KVLHYLYTTRGVKIVY---RETSNNCLKIYSAASYADNSDMKSTFGYIVKYAGGAVSWGS 77

Query: 1179 TKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISI----IN 1234
             K     +S+ E+E  A S  +  +  I  L+  +      ++L+ D+  A+ +    IN
Sbjct: 78   KKIPCVVLSTAEAEYIAASESLKEVIWIDELLRYMGIRCSPHQLLVDNQSALKLLDHPIN 137

Query: 1235 SQDETKLRNKYFGARSMKIRDEVKYSHLKLEYVNTDNNIADILTK 1279
                  +R K+        R+ V    +  +Y+NT++ +AD+ TK
Sbjct: 138  HSKTKHIRVKFHF-----FREHVAKGTVVPQYLNTEDQMADVNTK 177

>Smik_12.315 Chr12 (572410..572748) [339 bp, 112 aa] {ON} YNL054W-B
            (REPEAT)
          Length = 112

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 1116 LTYQLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIIT 1175
            + Y+ IQY+    N  + + +   ++ +++T I DA+   +   +S +G  I     I  
Sbjct: 1    MIYKTIQYLVQHTNIGVHYDRDLNKD-KKITTIADASVGTEYDAQSIIGVIIWYEKNIFN 59

Query: 1176 ARSTKATLTCISSTESELYAI 1196
              S +++  C+S TE+EL+AI
Sbjct: 60   VYSNESSNKCVSLTEAELHAI 80

>Suva_6.194 Chr6 (350869..351309) [441 bp, 146 aa] {ON} YPL060C-A
           (REPEAT)
          Length = 146

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 40/92 (43%), Gaps = 17/92 (18%)

Query: 393 TILPFGQHVITHDTNPIDKLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRS 452
           + LPFG+  +  D N   K   RG     L     S GY  +VP + KVL +SNY +   
Sbjct: 2   SFLPFGEQGVVWDHNH-KKPKQRGLTAILLCKDPNSQGYKFFVPSIKKVLTSSNYTL--- 57

Query: 453 DTNISADHNYDSTVFDPLMQSIARPYDDFLND 484
                      + V DPL+++    Y   LND
Sbjct: 58  ----------SNNVVDPLLRNTQGIY---LND 76

>Kwal_26.7889 s26 complement(556831..557676) [846 bp, 281 aa] {ON}
           YDR261W-B - TyB Gag-Pol protein [contig 55] FULL
          Length = 281

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 411 KLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRS 452
           KL  R   GY L  S+ S+G+LIY+P   +V+DT NY +I +
Sbjct: 11  KLKERSIPGYILRKSETSYGFLIYIPSTGRVVDTQNYNLIEN 52

>Kwal_9.619 s9 (2289..2810) [522 bp, 173 aa] {ON} YAR009C - TyB
           Gag-Pol protein [contig 351] FULL
          Length = 173

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 411 KLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 11  KLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 55

>Suva_10.197 Chr10 (373838..373933) [96 bp, 32 aa] {ON}  YNL054W-B
            (REPEAT)
          Length = 32

 Score = 34.7 bits (78), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 1266 YVNTDNNIADILTKALPAKRFNDLTNVWM 1294
            +++   NIADI+TK LP K F  LTN W+
Sbjct: 3    HIDIKRNIADIMTKPLPLKSFKLLTNKWI 31

>Smik_3.59 Chr3
           complement(87134..87220,87224..87259,87263..87286,
           87290..87373,87377..87559) [414 bp, 138 aa] {OFF}
           YNL054W-B (PSEUDO)
          Length = 138

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 878 DMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKIFKLEKSLYGLKQS 926
           +MF+  L+I+  +LYA L+E++YI  P   G +    KL+K  YGLK+S
Sbjct: 13  NMFVETLNINHVFLYAILEEKIYIPNPYVGGCE---VKLKKIFYGLKRS 58

>Kwal_14.767 s14 (33880..34431) [552 bp, 183 aa] {ON} YAR009C - TyB
           Gag-Pol protein [contig 245] FULL
          Length = 183

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 411 KLHVRGHHGYALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTN 455
           KL  R   GY L  S+ S+G LIY+P   +V+DT NY +I + +N
Sbjct: 11  KLKERSIPGYILHKSETSYGSLIYIPSTGRVVDTQNYNLIENHSN 55

>Kwal_1.406 s1 (1719..2021) [303 bp, 100 aa] {OFF} [contig 695]
          FULL
          Length = 100

 Score = 35.8 bits (81), Expect = 0.11,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 23 LLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPVKIS 80
           L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +K+ 
Sbjct: 2  FLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVIKLE 58

Query: 81 AASSPNIRY 89
          A  SP   +
Sbjct: 59 AYLSPGYSF 67

>CAGL0G07183g2 Chr7 complement(678730..682425,682425..683243) [4515
            bp, 1504 aa] {ON} encodes gag, pol, protease, reverse
            transcriptase,RNaseH and integrase of gb|AY673967 Candida
            glabrata Tcg3 LTR retrotransposon (Ty3/gypsy superfamily)
          Length = 1504

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 77/207 (37%), Gaps = 14/207 (6%)

Query: 162  LFGHVNIKIIKDSIRKGLIKNISYDN-IDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQ 220
            LFGH       D+  K L+K   + N +D       +CP+C KGK     H  G    + 
Sbjct: 1065 LFGHRGA----DTTYKHLLKGFYWPNMLDSIKQYIKRCPECRKGKHPT-THPYGPLHSHP 1119

Query: 221  REYNTFEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKD--ASTVTTVF-R 277
                 +  +  D          +     ++  D  ++     P R KD  A  +T +F +
Sbjct: 1120 IPNQRWSEISIDFIDAFKTSGDNKYDRILTIVDNFTKMAHFIPCRKKDFTAEMLTDIFIQ 1179

Query: 278  NIVATFGTQFDTKVLVFQMDRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNR 337
            NI+   G     + L    D    +T            I   YT+V  S ++  AER NR
Sbjct: 1180 NIIKLHG-----RPLRILSDNDVLYTATAWTAVMNRLQIHRDYTTVASSSSNSFAERTNR 1234

Query: 338  TLLDDCRTLLESSGLSPHLWFYSVEFA 364
            T+ +   TL+  S      +    EFA
Sbjct: 1235 TIEEILNTLVAHSPTKWSTYLPLAEFA 1261

>Skud_110.1 Chr110 (3..560) [558 bp, 186 aa] {ON} YPL060C-A (REPEAT)
          Length = 186

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 82/196 (41%), Gaps = 25/196 (12%)

Query: 55  QDNPIPISSTGILKFHFANGPPVKISAASSPNIRYDLISLDEL---DDAGIYADFSTRSL 111
           +DN +P+  +G +K    N     +     P     +IS  EL    D  +  ++ST  L
Sbjct: 1   KDNSVPVKGSGYIKIK-CNTNDDYLLTHYVPEEETTIISGYELAKETDLVLSKNYST--L 57

Query: 112 RDKDNNVIATLLKHGPFYWLSTKYLMLPARSRNHRINNILPR-----------FSFEFIH 160
            +KD N I T +K G  +      +  P    + +IN I P             S +  H
Sbjct: 58  ENKDMN-IKTHVKDGIIHVKMDDLIDHPPH--DFKINAIQPTSFKKIRMKPKIISLKDAH 114

Query: 161 RLFGHVNIKIIKDSIRKGLIKNISYDNIDW-SGFDTFQCPDCLKGKSTQHKHYVGSRVKY 219
           +  GH  ++ I++SI+    +    +NID     + F C  C   K+T+  HY GS  ++
Sbjct: 115 KRMGHTGVQRIENSIKHSHYE----ENIDLIKEPNEFWCETCKVSKATRRNHYAGSMNEH 170

Query: 220 QREYNTFEFLHTDLFG 235
             ++        D+FG
Sbjct: 171 SIDHEPGSSWCMDIFG 186

>NDAI0F01730 Chr6 (424126..424542) [417 bp, 138 aa] {ON} 
          Length = 138

 Score = 36.2 bits (82), Expect = 0.15,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 58/116 (50%), Gaps = 5/116 (4%)

Query: 1119 QLIQYIWDTRNKRLIWPKAKERNTQRVTAITDAAFANQPGYKSQVGYFILVNNKIIT--A 1176
            ++++Y++ TR+  + +    +R     T  +  A  + P   S  GY   +    IT  +
Sbjct: 6    RIMRYLYTTRDYGIRYRSKLKRQLTVYTDASQGAAWDMP--FSTSGYATFLAGGAITWCS 63

Query: 1177 RSTKATLTCISSTESELYAISMVIPLLNSIKMLMETITGNQVKNKLITDSAPAISI 1232
            R  ++T+ C+SSTE+E  A S  +  +  +  L+E +     +N L+ D+ PAI +
Sbjct: 64   RRIRSTI-CLSSTEAECIAASEAVLEIMWLYNLLEHMGYPLSENLLVIDNEPAIKL 118

>Kwal_33.15092 s33 complement(958321..958851) [531 bp, 176 aa] {OFF}
           [contig 94] FULL
          Length = 176

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 20  PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
           P   L+DSGAS SI  +S        P+    +  DAQD PI IS  GI++ +   G  +
Sbjct: 75  PQMFLMDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQDQPIAISGKGIIELNL--GRVI 131

Query: 78  KISAASSPN----IRYDLISLDELDDAGI 102
           K+ A  SP     I Y   +L+ L    I
Sbjct: 132 KLEAYLSPGYSFVILYPQFNLNNLGSTQI 160

>TBLA0I02850 Chr9 complement(672290..674410) [2121 bp, 706 aa] {ON}
           Anc_4.233 YDL057W
          Length = 706

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 393 TILPFGQHVITHDTNPIDKLHVRG--------HHGYALTPSKESHGYLIYVPHLHKVLDT 444
           TIL + + +I  + N +D L  +         HH   L P   SH   I++P+L  VL +
Sbjct: 57  TILSYPKSIIKFNNNKLDMLKKKNLMEYKFPNHHLILLLPGMGSHKNSIFLPYLADVLSS 116

Query: 445 SNYVVIRSD 453
           + + VIR D
Sbjct: 117 NGFFVIRLD 125

>NCAS0A05290 Chr1 complement(1047369..1050149) [2781 bp, 926 aa]
           {ON} 
          Length = 926

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 297 DRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLES-----SG 351
           DR   FT+A    F +  GI   +T+  + +  G  ERLNRT+ +  RTL E      + 
Sbjct: 582 DRDKLFTSAVWDRFAQRLGIHLNFTTSNNPQGDGQVERLNRTISERMRTLCEQYPQSWNE 641

Query: 352 LSPHLWF-YSVEFATLIR 368
           L P L F Y+  + + IR
Sbjct: 642 LLPMLEFGYNNSYQSTIR 659

>NCAS0H03510 Chr8 (662442..666104) [3663 bp, 1220 aa] {ON} 
          Length = 1220

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 297 DRGSEFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLES-----SG 351
           DR   FT+A    F +  GI   +T+  + +  G  ERLNRT+ +  RTL E      + 
Sbjct: 876 DRDKLFTSAVWDRFAQRLGIHLNFTTSNNPQGDGQVERLNRTISERMRTLCEQYPQSWNE 935

Query: 352 LSPHLWF-YSVEFATLIR 368
           L P L F Y+  + + IR
Sbjct: 936 LLPMLEFGYNNSYQSTIR 953

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 226 FEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVF 276
            E +H ++  P P +     ++ +   D  SRF W+ PL S+  S +T  F
Sbjct: 192 LERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAF 242

>Kwal_23.3711 s23 (400253..400588) [336 bp, 111 aa] {OFF} [contig
          254] FULL
          Length = 111

 Score = 32.3 bits (72), Expect = 2.1,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 20 PGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQ--DAQDNPIPISSTGILKFHFANGPPV 77
          P   L+DSGAS SI  +S        P+    +  DAQ+ PI I+  GI++ +   G  V
Sbjct: 10 PQMFLIDSGASFSIFSNSKFFT-ELYPVETDDEMFDAQEQPIAITGKGIIELNL--GRVV 66

Query: 78 KISA 81
          K+ A
Sbjct: 67 KLEA 70

>Skud_63.2 Chr63 complement(665..994) [330 bp, 109 aa] {ON}
           YPL060C-A (REPEAT)
          Length = 109

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 10/72 (13%)

Query: 422 LTPSKESHGYLIYVPHLHKVLDTSNYV--------VIRSDTNISADHNYDSTVFDPLMQS 473
           L     SHGY  +VP + KV+ + NY         ++ +  NI  D    S +F+    S
Sbjct: 2   LCKDPNSHGYKFFVPSIKKVVTSDNYTIPDYAVDSILGNTQNIYLDDQSRSDIFNEAENS 61

Query: 474 --IARPYDDFLN 483
             ++R YD F N
Sbjct: 62  DAVSRLYDAFEN 73

>NCAS0H02470 Chr8 complement(489960..490880) [921 bp, 306 aa] {ON}
            Anc_5.505 YOR158W
          Length = 306

 Score = 32.7 bits (73), Expect = 5.6,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 1009 ILGLEITYRRSKSLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEA 1068
            IL LE T R +K L    EKS +  IP+L   L     R + P +  I+    K +    
Sbjct: 131  ILELEKTERENKLLK---EKSSDLTIPTLENILEQPLIRWRTPEERKILQLKRKFNRDLL 187

Query: 1069 EYKRKVKLMQKLVGL 1083
            E++ K + M+KL+ L
Sbjct: 188  EFQTKERKMEKLLNL 202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 137,255,660
Number of extensions: 6157956
Number of successful extensions: 17631
Number of sequences better than 10.0: 262
Number of HSP's gapped: 17627
Number of HSP's successfully gapped: 300
Length of query: 1295
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1173
Effective length of database: 39,492,147
Effective search space: 46324288431
Effective search space used: 46324288431
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)