Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.33singletonON41441420010.0
Kpol_1055.49singletonON36836312231e-167
Kpol_1066.32singletonON2031827791e-102
NDAI0D00660singletonON3542512593e-24
NDAI0B00740singletonON5822412628e-24
NDAI0A01420singletonON3771832524e-23
SAKL0C11913g2singletonON4402772368e-21
SAKL0F06809g1singletonON4402772369e-21
SAKL0B11583g1singletonON4402772369e-21
SAKL0E01287g1singletonON4402772369e-21
SAKL0D08217g1singletonON4402772369e-21
SAKL0H19767g1singletonON4402772369e-21
SAKL0H04631g2singletonON4402732351e-20
KAFR0B06620singletonON11852182382e-20
SAKL0C11913g1singletonON17552772345e-20
SAKL0B11583g2singletonON17552772345e-20
SAKL0F06809g2singletonON17552772336e-20
Skud_2.339singletonON4772482272e-19
Suva_14.55singletonON5852362282e-19
YNL054W-BsingletonOFF17492632274e-19
NDAI0G00610singletonON3992642145e-18
TPHA0H01270singletonON13654172081e-16
NDAI0B04860singletonON3971732022e-16
KAFR0B06625singletonON5222311882e-14
NCAS0B05650singletonON2921541832e-14
NCAS0H01960singletonON2751341752e-13
KNAG0I01240singletonON3461491683e-12
TDEL0D06670singletonON3232211621e-11
NCAS0A09640singletonON5011221552e-10
TDEL0E00260singletonON12481891519e-10
KLLA0E25180gsingletonON3741601462e-09
TBLA0C06630singletonON1801591392e-09
Skud_7.459singletonON2361961422e-09
TBLA0E02355singletonON1351221231e-07
TBLA0G02020singletonON2431761244e-07
NDAI0D03060singletonON13031781232e-06
Kwal_23.3709singletonON3562441071e-04
Kwal_47.19340singletonOFF3562441062e-04
NDAI0B02880singletonON157117984e-04
Kwal_55.22270singletonON2602261006e-04
TPHA0I03310singletonON12482957e-04
TBLA0B08200singletonON4571221017e-04
Kwal_13.697singletonON223120980.001
Kwal_55.19804singletonON213120970.001
Kwal_1.402singletonON341120980.001
Kwal_34.16301singletonOFF356120980.001
Kwal_50.19423singletonON268120970.002
Kwal_2.417singletonON286120970.002
Kwal_27.12435singletonOFF357120970.002
Kwal_47.17038singletonON287120960.002
Kwal_14.761singletonON311226960.002
Kwal_26.7896singletonON258120930.004
Kwal_34.15663singletonOFF10168870.005
KNAG0A01870singletonON77685940.007
KNAG0G02855singletonON19397900.008
TPHA0E04090singletonON155108870.011
TBLA0B07225singletonON16659850.022
Kwal_9.613singletonOFF356120870.028
Kwal_47.17671singletonON334120860.037
Kwal_36.16333singletonON298120850.044
TPHA0G00150singletonON19562840.044
TBLA0B06370singletonON26759780.35
NDAI0B06160singletonON140370780.55
KLLA0F10912g5.717ON1283116751.2
NDAI0A040201.509ON91392741.4
TBLA0D025008.39ON852120732.1
CAGL0J08030g1.94ON221798732.3
TBLA0H018805.370ON1708141722.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.33
         (414 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.33 s1037 (79024..80268) [1245 bp, 414 aa] {ON} (79024....   775   0.0  
Kpol_1055.49 s1055 complement(119573..120679) [1107 bp, 368 aa] ...   475   e-167
Kpol_1066.32 s1066 complement(53574..54185) [612 bp, 203 aa] {ON...   304   e-102
NDAI0D00660 Chr4 (144078..145142) [1065 bp, 354 aa] {ON}              104   3e-24
NDAI0B00740 Chr2 (166514..168262) [1749 bp, 582 aa] {ON}              105   8e-24
NDAI0A01420 Chr1 (318456..319586) [1131 bp, 377 aa] {ON}              101   4e-23
SAKL0C11913g2 Chr3 complement(1073886..1075208) [1323 bp, 440 aa...    96   8e-21
SAKL0F06809g1 Chr6 (518357..519679) [1323 bp, 440 aa] {ON} Retro...    96   9e-21
SAKL0B11583g1 Chr2 (998260..999582) [1323 bp, 440 aa] {ON} Retro...    96   9e-21
SAKL0E01287g1 Chr5 (95220..96542) [1323 bp, 440 aa] {ON} Retrotr...    96   9e-21
SAKL0D08217g1 Chr4 (679723..681045) [1323 bp, 440 aa] {ON} Retro...    96   9e-21
SAKL0H19767g1 Chr8 (1740696..1742018) [1323 bp, 440 aa] {ON} Ret...    96   9e-21
SAKL0H04631g2 Chr8 complement(430996..432318) [1323 bp, 440 aa] ...    95   1e-20
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    96   2e-20
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    95   5e-20
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    95   5e-20
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...    94   6e-20
Skud_2.339 Chr2 complement(611631..613064) [1434 bp, 477 aa] {ON...    92   2e-19
Suva_14.55 Chr14 (94266..96023) [1758 bp, 585 aa] {ON} YNL054W-B...    92   2e-19
YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 a...    92   4e-19
NDAI0G00610 Chr7 complement(132631..133830) [1200 bp, 399 aa] {O...    87   5e-18
TPHA0H01270 Chr8 (284616..288713) [4098 bp, 1365 aa] {ON}              85   1e-16
NDAI0B04860 Chr2 complement(1189351..1190541) [1191 bp, 397 aa] ...    82   2e-16
KAFR0B06625 Chr2 (1380125..1381207,1381209..1381694) [1569 bp, 5...    77   2e-14
NCAS0B05650 Chr2 complement(1073091..1073969) [879 bp, 292 aa] {...    75   2e-14
NCAS0H01960 Chr8 (381724..382551) [828 bp, 275 aa] {ON}                72   2e-13
KNAG0I01240 Chr9 complement(234446..235486) [1041 bp, 346 aa] {O...    69   3e-12
TDEL0D06670 Chr4 complement(1210732..1211703) [972 bp, 323 aa] {...    67   1e-11
NCAS0A09640 Chr1 (1924869..1926374) [1506 bp, 501 aa] {ON}             64   2e-10
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...    63   9e-10
KLLA0E25180g Chr5 complement(2229939..2231063) [1125 bp, 374 aa]...    61   2e-09
TBLA0C06630 Chr3 complement(1601120..1601662) [543 bp, 180 aa] {...    58   2e-09
Skud_7.459 Chr7 (755230..755940) [711 bp, 236 aa] {ON} YNL054W-B...    59   2e-09
TBLA0E02355 Chr5 (588263..588670) [408 bp, 135 aa] {ON}                52   1e-07
TBLA0G02020 Chr7 complement(527210..527941) [732 bp, 243 aa] {ON}      52   4e-07
NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON}              52   2e-06
Kwal_23.3709 s23 (399199..400269) [1071 bp, 356 aa] {ON} [contig...    46   1e-04
Kwal_47.19340 s47 (1198185..1199255) [1071 bp, 356 aa] {OFF} [co...    45   2e-04
NDAI0B02880 Chr2 (733429..733902) [474 bp, 157 aa] {ON}                42   4e-04
Kwal_55.22270 s55 (1176867..1177649) [783 bp, 260 aa] {ON} [cont...    43   6e-04
TPHA0I03310 Chr9 (733120..733494) [375 bp, 124 aa] {ON}                41   7e-04
TBLA0B08200 Chr2 (1957742..1959115) [1374 bp, 457 aa] {ON}  poss...    44   7e-04
Kwal_13.697 s13 complement(5594..6265) [672 bp, 223 aa] {ON} [co...    42   0.001
Kwal_55.19804 s55 complement(133761..134402) [642 bp, 213 aa] {O...    42   0.001
Kwal_1.402 s1 (628..1653) [1026 bp, 341 aa] {ON} [contig 695] FULL     42   0.001
Kwal_34.16301 s34 (279917..280987) [1071 bp, 356 aa] {OFF} [cont...    42   0.001
Kwal_50.19423 s50 complement(3011..3817) [807 bp, 268 aa] {ON} [...    42   0.002
Kwal_2.417 s2 (536..1396) [861 bp, 286 aa] {ON} [contig 305] FULL      42   0.002
Kwal_27.12435 s27 (1218177..1219250) [1074 bp, 357 aa] {OFF} [co...    42   0.002
Kwal_47.17038 s47 complement(219724..220587) [864 bp, 287 aa] {O...    42   0.002
Kwal_14.761 s14 (31709..32644) [936 bp, 311 aa] {ON} [contig 245...    42   0.002
Kwal_26.7896 s26 complement(559123..559899) [777 bp, 258 aa] {ON...    40   0.004
Kwal_34.15663 s34 complement(2019..2324) [306 bp, 101 aa] {OFF} ...    38   0.005
KNAG0A01870 Chr1 (132203..134533) [2331 bp, 776 aa] {ON}               41   0.007
KNAG0G02855 Chr7 complement(632776..633357) [582 bp, 193 aa] {ON}      39   0.008
TPHA0E04090 Chr5 (853540..854007) [468 bp, 155 aa] {ON}                38   0.011
TBLA0B07225 Chr2 (1711953..1712453) [501 bp, 166 aa] {ON}              37   0.022
Kwal_9.613 s9 (50..1120) [1071 bp, 356 aa] {OFF} [contig 351] FULL     38   0.028
Kwal_47.17671 s47 complement(508381..509385) [1005 bp, 334 aa] {...    38   0.037
Kwal_36.16333 s36 (2113..3009) [897 bp, 298 aa] {ON} [contig 364...    37   0.044
TPHA0G00150 Chr7 (7467..8054) [588 bp, 195 aa] {ON}                    37   0.044
TBLA0B06370 Chr2 (1505360..1506163) [804 bp, 267 aa] {ON}              35   0.35 
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            35   0.55 
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...    33   1.2  
NDAI0A04020 Chr1 complement(901967..904708) [2742 bp, 913 aa] {O...    33   1.4  
TBLA0D02500 Chr4 complement(623059..625617) [2559 bp, 852 aa] {O...    33   2.1  
CAGL0J08030g Chr10 complement(785064..791717) [6654 bp, 2217 aa]...    33   2.3  
TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5....    32   2.9  

>Kpol_1037.33 s1037 (79024..80268) [1245 bp, 414 aa] {ON}
           (79024..80268) [1245 nt, 415 aa]
          Length = 414

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/414 (92%), Positives = 383/414 (92%)

Query: 1   MNHSDIKLTSEHGSAAKVPFDSNKADDSLDTSLHNNNSGDTSTKVPQDESLKNSFKGING 60
           MNHSDIKLTSEHGSAAKVPFDSNKADDSLDTSLHNNNSGDTSTKVPQDESLKNSFKGING
Sbjct: 1   MNHSDIKLTSEHGSAAKVPFDSNKADDSLDTSLHNNNSGDTSTKVPQDESLKNSFKGING 60

Query: 61  XXXXXXXXXXXXXXXXLMSHPYPIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFPIPPS 120
                           LMSHPYPIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFPIPPS
Sbjct: 61  SPAYGPSNNPYYSPYALMSHPYPIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFPIPPS 120

Query: 121 IPSDYYHHNXXXXXXXXXXXXXXXDSNSQTQHASVISKPKDMIMLTRATSAHDFDRWITD 180
           IPSDYYHHN               DSNSQTQHASVISKPKDMIMLTRATSAHDFDRWITD
Sbjct: 121 IPSDYYHHNPPITPTQAPPSTSATDSNSQTQHASVISKPKDMIMLTRATSAHDFDRWITD 180

Query: 181 FVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSASKKTDL 240
           FVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSASKKTDL
Sbjct: 181 FVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSASKKTDL 240

Query: 241 LTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETL 300
           LTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETL
Sbjct: 241 LTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETL 300

Query: 301 ICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYELENKREKTSNRIKPTPNTA 360
           ICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYELENKREKTSNRIKPTPNTA
Sbjct: 301 ICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYELENKREKTSNRIKPTPNTA 360

Query: 361 VKPVATNVKNNSVAKVTNAKSAFKKSTKPTSHKANNITPGLVELDADDNTLRLA 414
           VKPVATNVKNNSVAKVTNAKSAFKKSTKPTSHKANNITPGLVELDADDNTLRLA
Sbjct: 361 VKPVATNVKNNSVAKVTNAKSAFKKSTKPTSHKANNITPGLVELDADDNTLRLA 414

>Kpol_1055.49 s1055 complement(119573..120679) [1107 bp, 368 aa]
           {ON} complement(119573..120679) [1107 nt, 369 aa]
          Length = 368

 Score =  475 bits (1223), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 240/363 (66%), Positives = 281/363 (77%), Gaps = 1/363 (0%)

Query: 1   MNHSDIKLTSEHGSAAKVPFDSNKADDSLDTSLHNNNSGDTSTKVPQDESLKNSFKGING 60
           M++SDIK+ SEH SAA VPFDSNKA+DSL TSLHNNNS  TSTKV QDESL+NS KGI+G
Sbjct: 1   MSNSDIKVPSEHDSAAIVPFDSNKAEDSLKTSLHNNNSIGTSTKVSQDESLQNSPKGISG 60

Query: 61  XXXXXXXXXXXXXXXXLMSHPYPIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFPIPPS 120
                           LMSHPYPIGWSPYGNH+ PPI+PNYF   YAG+HPGLQFPIPPS
Sbjct: 61  SPAYDANNIPYYSPYALMSHPYPIGWSPYGNHYPPPIFPNYFGQTYAGMHPGLQFPIPPS 120

Query: 121 IPSDYYHHNXXXXXXXXXXXXXXXDSNSQTQHASVISKPKDMIMLTRATSAHDFDRWITD 180
           IP+DYY  +               DS SQ   A V + P D IMLT A+SAHDF+RWI D
Sbjct: 121 IPNDYYQQHPPITPNQVPSSTSATDSTSQPPTAPVHTHPMDRIMLTVASSAHDFNRWIND 180

Query: 181 FVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSASKKTDL 240
           FVKFLKQ+ L D+IPD+YG AKRTP +V+KA+I+N FNMYVP ++YPDWMK S S+ TDL
Sbjct: 181 FVKFLKQSNLVDIIPDEYGCAKRTPTDVEKAYIINIFNMYVPADTYPDWMKSSISEGTDL 240

Query: 241 LTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETL 300
           LTLILHAIGTVAN DP EEL+  L+N+TFDGS+AAFIFAAKIRSLV+NCR+S++NIPE++
Sbjct: 241 LTLILHAIGTVANKDPEEELLNRLSNITFDGSNAAFIFAAKIRSLVKNCRSSDVNIPESI 300

Query: 301 ICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYELENKREKTSN-RIKPTPNT 359
           ICKCIMNGLKG Y SL  RYA +G +VTL+LLLRDIQILYE+E+KR+K SN R KP  + 
Sbjct: 301 ICKCIMNGLKGQYLSLNTRYAENGAKVTLNLLLRDIQILYEIESKRDKPSNLRNKPKSDN 360

Query: 360 AVK 362
            VK
Sbjct: 361 VVK 363

>Kpol_1066.32 s1066 complement(53574..54185) [612 bp, 203 aa] {ON}
           complement(53574..54185) [612 nt, 204 aa]
          Length = 203

 Score =  304 bits (779), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/182 (76%), Positives = 163/182 (89%)

Query: 162 MIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYV 221
           MIMLTRATSAH+FDRWITDFVKFLKQNKL+DL+PDKYGSAKRTPNNVDKAFILNT NMYV
Sbjct: 1   MIMLTRATSAHNFDRWITDFVKFLKQNKLEDLVPDKYGSAKRTPNNVDKAFILNTINMYV 60

Query: 222 PENSYPDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAK 281
           PENSYPDWMK S SK+T+LLTLILHA+G VANNDP EEL+  L+N+TFDGS+AAFIFAAK
Sbjct: 61  PENSYPDWMKSSISKRTNLLTLILHAVGAVANNDPEEELLNELHNITFDGSNAAFIFAAK 120

Query: 282 IRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYE 341
           IRSL ENC+ S+ +I E+L+CK IM GL+G Y +L  RY+LDG ++TL+LLLRDIQI Y+
Sbjct: 121 IRSLFENCKTSKTDISESLVCKFIMKGLRGTYQTLNARYSLDGIKITLELLLRDIQIQYD 180

Query: 342 LE 343
           +E
Sbjct: 181 IE 182

>NDAI0D00660 Chr4 (144078..145142) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  104 bits (259), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 118/251 (47%), Gaps = 11/251 (4%)

Query: 159 PKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFN 218
           P++   L   +S  +F  WI   +  LK  +  DLIP+K+G A RTP++ ++  +   F+
Sbjct: 92  PQNPSPLYPISSTGEFSNWIRTLMDHLKSAQYGDLIPNKHGVAARTPSHWEELGLQWLFS 151

Query: 219 MYVPENSYPDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIF 278
            YV ++ YP W+K++      L T++  A+        +  +++ L +L F+G   AFIF
Sbjct: 152 TYVKKDFYPKWVKQAQEASVPLFTILQRAMTLAMQATDITIIMRKLRDLHFEGKEPAFIF 211

Query: 279 AAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQI 338
            A ++S++      E+   E LI  CI+N L G Y ++ K +    +  ++  +   I  
Sbjct: 212 NANVQSIISQIDTKELTQYEPLIKDCILNALAGPYSTINKEFRTSQSPYSISDIYTRISA 271

Query: 339 LYEL----ENKREKTS-----NRIKPTPNTAVKPVATN--VKNNSVAKVTNAKSAFKKST 387
            Y+     ++ R K S        +     AV P  TN   K  S  + T +    +K +
Sbjct: 272 EYDYITTTQSARPKCSYCHIVGHTRDQCFKAVAPSTTNPIPKPKSNTRTTRSSPTHRKQS 331

Query: 388 KPTSHKANNIT 398
             +S   NNIT
Sbjct: 332 AKSSKITNNIT 342

>NDAI0B00740 Chr2 (166514..168262) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  105 bits (262), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 116/241 (48%), Gaps = 11/241 (4%)

Query: 169 TSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPD 228
           +S  +F  WI   +  LK  K  DLIP+K+G A RTP++ ++  +   F+ YV ++ YP 
Sbjct: 90  SSTGEFSNWIRTLMDHLKSAKYGDLIPNKHGVAARTPSHWEELGLQWLFSTYVKKDFYPK 149

Query: 229 WMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVEN 288
           W+K++      L T++  A+        +  +++ L +L F+G   AFIF A ++S++  
Sbjct: 150 WVKQAQEASVPLFTILQRAMTLAMQATDITIIMRKLRDLHFEGKEPAFIFNANVQSIISQ 209

Query: 289 CRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYEL----EN 344
               E+   E LI  CI+N L G Y ++ K +    +  ++  +   I   Y+     ++
Sbjct: 210 IDTKELTQYEPLIKDCILNALTGPYSTINKEFRTSQSPYSISDIYTRISAEYDYITTTQS 269

Query: 345 KREKTS--NRIKPTPNTAVKPVATNVKN-----NSVAKVTNAKSAFKKSTKPTSHKANNI 397
            R K S  + +  T +   K VA +  N      S  + T +    +K +  +S   NNI
Sbjct: 270 ARPKCSYCHIVGHTRDQCFKAVAPSTANPIPKPKSNTRTTRSSPTHRKQSAKSSKITNNI 329

Query: 398 T 398
           T
Sbjct: 330 T 330

>NDAI0A01420 Chr1 (318456..319586) [1131 bp, 377 aa] {ON}
          Length = 377

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 93/183 (50%)

Query: 159 PKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFN 218
           P++   L   +S  +F  WI   +  LK  +  DLIP+K+G A RTP++ ++  +   F+
Sbjct: 188 PQNPSPLYPISSTGEFSNWIRTLMDHLKSAQYGDLIPNKHGVAARTPSHWEELGLQWLFS 247

Query: 219 MYVPENSYPDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIF 278
            YV ++ YP W+K++      L T++  A+        +  +++ L +L F+G   AFIF
Sbjct: 248 TYVKKDFYPKWVKQAQEASVPLFTILQRAMTLAMQATDITIIMRKLRDLHFEGKEPAFIF 307

Query: 279 AAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQI 338
            A ++S++      E+   E LI  CI+N L G Y ++ K +    +  ++  +   I  
Sbjct: 308 NANVQSIISQIDTKELTQYEPLIKDCILNALAGPYSTINKEFRTSQSPYSISDIYTRISA 367

Query: 339 LYE 341
            Y+
Sbjct: 368 EYD 370

>SAKL0C11913g2 Chr3 complement(1073886..1075208) [1323 bp, 440 aa]
           {ON} Retrotransposon Gag gene co-transcribed with Pol
          Length = 440

 Score = 95.5 bits (236), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTRA----TSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>SAKL0F06809g1 Chr6 (518357..519679) [1323 bp, 440 aa] {ON}
           Retrotransposon Gag gene co-transcribed with Pol
          Length = 440

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTRA----TSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>SAKL0B11583g1 Chr2 (998260..999582) [1323 bp, 440 aa] {ON}
           Retrotransposon Gag gene co-transcribed with Pol
          Length = 440

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTRA----TSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>SAKL0E01287g1 Chr5 (95220..96542) [1323 bp, 440 aa] {ON}
           Retrotransposon Gag gene
          Length = 440

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTRA----TSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>SAKL0D08217g1 Chr4 (679723..681045) [1323 bp, 440 aa] {ON}
           Retrotransposon Gag gene
          Length = 440

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTRA----TSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>SAKL0H19767g1 Chr8 (1740696..1742018) [1323 bp, 440 aa] {ON}
           Retrotransposon Gag gene
          Length = 440

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTRA----TSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>SAKL0H04631g2 Chr8 complement(430996..432318) [1323 bp, 440 aa]
           {ON} Retrotransposon Gag gene
          Length = 440

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 123/273 (45%), Gaps = 28/273 (10%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS--------PESS 149

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIP 195
                     SN    + SV  +P   +     TS+ +F  W+ +++KFL+ + L D+IP
Sbjct: 150 NTPTGPPSAKSNMTPVNKSV--RPPPFL-----TSSSEFLIWVRNYIKFLQNSNLGDIIP 202

Query: 196 DKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGTV-AN 253
              G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  + ++
Sbjct: 203 KTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEKMQSD 262

Query: 254 NDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAY 313
           N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL G Y
Sbjct: 263 NQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGLSGEY 321

Query: 314 HSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
             L  RYA      +T+  L  DI  +YE + +
Sbjct: 322 RFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 107/218 (49%), Gaps = 10/218 (4%)

Query: 148 SQTQHASVISKPKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNN 207
           ++T  A+  S   + + LT  T+  +FD W+  F +FLK+  L   IPDK G      ++
Sbjct: 168 TETSFANHSSYSANAVNLTMVTTTDEFDTWLKKFCRFLKERNLGHAIPDKSGYTTEVLDH 227

Query: 208 VDKAFILNTFNMYVPENSYPDWMKRSA-SKKTDLLTLILHAIGTVANNDPLEELIKALNN 266
            ++A+I  TFN +VP   Y  W K        +L   I+ A+     +   +++   L N
Sbjct: 228 -ERAYIEQTFNYFVPAKHYAKWFKDLLYVHHLELSDAIMSALSKAEKSASGQDIHDELMN 286

Query: 267 LTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTE 326
           +++DG    F+F  K++SLV+     +I IPE +I K I++ LK  + ++   Y     +
Sbjct: 287 ISYDGKMDVFVFKRKLQSLVKKAAEYDIIIPEWIITKRIVDNLKNQFKNVNDFYHSRMGK 346

Query: 327 VTLDLLLRDIQILYELENKREKTSNRIKPTPNTAVKPV 364
           V+LD +L  I  L         T    KPTP T+ + V
Sbjct: 347 VSLDDVLVRINYL--------ATEVINKPTPTTSSQSV 376

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
           [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol
           genes
          Length = 1755

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTR----ATSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTR----ATSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 36/277 (12%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-------IPPSIPSDYYHHNXXXXXX 135
           P GWS YG+ +  P  P    P Y       Q+P        P S PS            
Sbjct: 98  PSGWSVYGHPYMMPYTPYQMSPMYYPPGSQQQYPQYTSGVGTPLSTPS------------ 145

Query: 136 XXXXXXXXXDSNSQTQHASVISKPKDMIMLTR----ATSAHDFDRWITDFVKFLKQNKLD 191
                     SN+ T   S  S    +    R     TS+ +F  W+ +++KFL+ + L 
Sbjct: 146 -------PESSNTPTGPPSAKSNMTPVNKSVRPPPFLTSSSEFLIWVRNYIKFLQNSNLG 198

Query: 192 DLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGT 250
           D+IP   G A R     +  F+ NTF  + P    P W+K   S   TD++ ++  ++  
Sbjct: 199 DIIPKTNGKATRQMTYDEHTFLYNTFQTFAPSQFLPTWVKDILSVDYTDIMKILTKSMEK 258

Query: 251 V-ANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGL 309
           + ++N  + + I  L NL +DGS  A +F  ++ + ++  R+S ++I + L CK I  GL
Sbjct: 259 MQSDNQEVNDYI-TLANLQYDGSIPADMFETQVINTIDRLRDSGLHINDKLACKLIRRGL 317

Query: 310 KGAYHSLTKRYALDG-TEVTLDLLLRDIQILYELENK 345
            G Y  L  RYA      +T+  L  DI  +YE + +
Sbjct: 318 SGEYRFL--RYARHRHLNMTVTELFMDIHAIYEEQQE 352

>Skud_2.339 Chr2 complement(611631..613064) [1434 bp, 477 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 477

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 117/248 (47%), Gaps = 16/248 (6%)

Query: 169 TSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPD 228
           TSA DF  W+  ++KFL+ + L D++P     A R   N + AF+ NTF ++ P    P 
Sbjct: 153 TSAKDFLNWVRFYIKFLQNSNLGDILPSATEKAVRQMTNEEHAFLYNTFRVFAPLQFLPI 212

Query: 229 WMKRSA-SKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVE 287
           W+K+   +  TD++ ++  ++  +  +      + AL  L ++GS+    F   + +++E
Sbjct: 213 WVKQILYNDYTDIMKILSKSMERMQFDTQEVTDLVALTTLKYNGSTPVDTFETTVTNIIE 272

Query: 288 NCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYELENKRE 347
              NS INI + + C+ I+ GL G Y  +             D L  DI  +Y+ +   +
Sbjct: 273 RLNNSGININDKVACQLILKGLSGEYKYVRSTSHCRKNRTVSD-LFSDIHAVYDNQQYSK 331

Query: 348 K-----TSNR---------IKPTPNTAVKPVATNVKNNSVAKVTNAKSAFKKSTKPTSHK 393
           +     T NR            TPNT V   ++   N S ++ T A+++ +  + P+++ 
Sbjct: 332 QSELTYTKNRSHCKNASRSTSTTPNTNVVTRSSRTTNTSKSRKTKARNSARSRSDPSAND 391

Query: 394 ANNITPGL 401
            +   P +
Sbjct: 392 VSADVPSV 399

>Suva_14.55 Chr14 (94266..96023) [1758 bp, 585 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 585

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 110/236 (46%), Gaps = 9/236 (3%)

Query: 169 TSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPD 228
           TSA+DF  W+  ++KFL+ + L D++P + G A R     +  FI NTF M+ P    P 
Sbjct: 176 TSANDFQNWVKFYIKFLQNSDLGDILPTENGKAAREMTYQEHTFIYNTFQMFAPYQFLPT 235

Query: 229 WMK-RSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVE 287
           W++    +   ++L ++  +I  +  +        AL+NL +DGS+ A  F + +  +++
Sbjct: 236 WVQDLLTTDYANILKVLSKSIDRMQTDTQDLNDFVALSNLKYDGSTPADEFESTVTKIID 295

Query: 288 NCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYELENK-- 345
              N+  NI + L C+ I  GL   Y     RY      +T+  LLRDI  +YE + +  
Sbjct: 296 RLNNNGHNINDKLGCQFIRRGLSCEYLYSHCRYRRQ-RNLTISELLRDICCIYEDQQELK 354

Query: 346 -----REKTSNRIKPTPNTAVKPVATNVKNNSVAKVTNAKSAFKKSTKPTSHKANN 396
                 + TS+  K T  T+       V   +  K T  KS   K    TS  A +
Sbjct: 355 LAKLCTKNTSSGRKHTSRTSPTITDAKVVTRTSKKKTTPKSGRGKKYNATSTSAED 410

>YNL054W-B Chr14 (519456..520760,520762..524706) [5250 bp, 1749 aa]
           {OFF} TyB Gag-Pol protein; proteolytically processed to
           make the Gag, RT, PR, and IN proteins that are required
           for retrotransposition
          Length = 1749

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 117/263 (44%), Gaps = 16/263 (6%)

Query: 83  PIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP-IPPSIPSDYYHHNXXXXXXXXXXXX 141
           P  WS YG     P  P    P Y    P  QFP  P S+ +     +            
Sbjct: 98  PSDWSFYGRPSMIPYTPYQMSPMYFPPGPHSQFPQYPSSVGTPLSTPSPESGNTFTDSSS 157

Query: 142 XXXDSNSQTQHASVISKPKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSA 201
              D  S  ++     +P  M+     TS +DF  W+  ++KFL+ + L  +IP   G  
Sbjct: 158 ADSDMTSTKKYV----RPPPML-----TSPNDFLNWVKTYIKFLQNSNLGGIIPTVNGKP 208

Query: 202 KRTPNNVDKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGTVANNDPLEEL 260
            R   + +  F+ NTF ++ P    P W+K   S   TD++ ++  +I  + ++      
Sbjct: 209 VRQITDDELTFLYNTFQIFAPSQFLPTWVKDILSVDYTDIMKILSKSIEKMQSDTQEAND 268

Query: 261 IKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSL--TK 318
           I  L NL ++GS+ A  F  K+ ++++   N+ I+I   + C+ IM GL G Y  L  T+
Sbjct: 269 IVTLANLQYNGSTPADAFETKVTNIIDRLNNNGIHINNKVACQLIMRGLSGEYKFLRYTR 328

Query: 319 RYALDGTEVTLDLLLRDIQILYE 341
              L+   +T+  L  DI  +YE
Sbjct: 329 HRHLN---MTVAELFLDIHAIYE 348

>NDAI0G00610 Chr7 complement(132631..133830) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 116/264 (43%), Gaps = 23/264 (8%)

Query: 79  SHPYPIGWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFP--IPPSIPSDYYHHNXXXXXXX 136
           SH YPI     GN   P      F P +    P    P  IPP      +H         
Sbjct: 152 SHMYPI----MGNQRIP------FQPPFMAFSPASNVPSFIPP------FHQPSDDNISQ 195

Query: 137 XXXXXXXXDSNSQTQHASVISKPKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPD 196
                    S++     S  S    ++ ++  +   +F+ WI  F+K+L+   L  +IPD
Sbjct: 196 GMDSTTYNGSHATMPKMSQFSAGNRLMPISNES---EFNGWIKTFIKYLRHQNLGHVIPD 252

Query: 197 KYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSASKK-TDLLTLILHAIGTVANND 255
           + G+        +K FI+  FN  VP  +YP W + + + +  +L+ +I  A+    +  
Sbjct: 253 RLGNTGNI-KEPEKDFIIEAFNYCVPSTAYPKWFQFALTNEYIELIDVIGRAMSLAEDKA 311

Query: 256 PLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHS 315
            ++E+ + L  + +DG S A +F   + SL+       I+IP  ++C+ I + L  +Y  
Sbjct: 312 GVDEIYEQLLAVKYDGKSDAILFKKLLNSLIAKGEKVGIHIPNEVLCQRIASNLTDSYRP 371

Query: 316 LTKRYALDGTEVTLDLLLRDIQIL 339
           +   Y ++   V+L+ LL + + L
Sbjct: 372 IADFYRMNYGNVSLEDLLVNYRYL 395

>TPHA0H01270 Chr8 (284616..288713) [4098 bp, 1365 aa] {ON} 
          Length = 1365

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 168/417 (40%), Gaps = 45/417 (10%)

Query: 9   TSEHGSAAKVPFDSNKADDSLDTSLHNNNSGDTSTKVPQDESLKNSFKGINGXXXXXXXX 68
           T EHGSAAK P DS             N  G   + V +D  +K                
Sbjct: 4   TIEHGSAAKNPIDST------------NLEGSPRSSVNEDIRVKQDLNPNEFNFSPYGND 51

Query: 69  XXXXXXXXLMSHPYPI-GWSPYGNHFTPPIYPNYFDPNYAGIHPGLQFPIPPS-IPSDYY 126
                      HPY I G  P+     PP YP  + P   G H     P+PPS I     
Sbjct: 52  ANGFYHGYPQHHPYVIHGGFPW----YPPNYPYQYGP---GPHTHRYPPVPPSNIKVQGN 104

Query: 127 HHNXXXXXXXXXXXXXXXDSNSQTQHASVISKPKDMI-----MLTRATSAHDFDRWITDF 181
             N                 ++++ + S     K+ I      L + +   +FD W+  F
Sbjct: 105 ASNVPDQSSEISDPTINVGESTRSNNDSFQDLRKNDIDSSSETLEQISHPSEFDNWLYGF 164

Query: 182 VKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMKRSASKKTDL- 240
           +  LK   +   IPD YG   +   N +K +I + F  YVP  +YP W+     K T+  
Sbjct: 165 MNKLKSQDMSHCIPDMYGRYLKIVTNNEKKYITDMFKYYVPITAYPKWLIDIYDKHTNTK 224

Query: 241 LTLILHAIGT-VANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPET 299
             LI +A+   VA  +P E +IK LN+L +  +  + +F  K+  L++     +++I E 
Sbjct: 225 YALISYAMKRYVAKRNP-ETIIKELNSLKYHPNMDSILFTDKVNKLIDEAELMDVHISEK 283

Query: 300 LICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYELENKREKTSNRIKPTPN- 358
            IC+  +  L  +  S+   Y      +TL       ++L+++E  +   SN    +PN 
Sbjct: 284 NICENFIKSLPPSLSSILHLYVHTPKPMTLS------EVLFQVEKIQPYLSNLETKSPNG 337

Query: 359 TAVKPVATNVKNNSVA----KVTNAKSA--FKKSTKPTSHKANNITPGLVE-LDADD 408
             V+  A     +S      K  NAK     K ++  +SH+   + P   E LDADD
Sbjct: 338 RTVEKTAVKHHQHSTTIDKKKFPNAKKVHHLKNTSTLSSHE--QLRPASSENLDADD 392

>NDAI0B04860 Chr2 complement(1189351..1190541) [1191 bp, 397 aa]
           {ON}
          Length = 397

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 85/173 (49%), Gaps = 1/173 (0%)

Query: 169 TSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPD 228
           +S  +F  WI   +  L  ++  DLIP+K+  A RTP++ ++  +   F+ YV  + YP 
Sbjct: 177 SSTGEFSNWIRT-LDHLNSSQYGDLIPNKHCVAARTPSHWEELGLQWLFSTYVKMDFYPQ 235

Query: 229 WMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVEN 288
           W+K++      L T++  A+        +  +++ L +L F+    AFIF A ++S++  
Sbjct: 236 WVKQAQETSVPLFTILQRAMTLAMQATDITIIMRKLCDLHFESKEPAFIFNANVQSIISQ 295

Query: 289 CRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYE 341
               E+   E LI   I+N L G Y ++ K +    +  ++  +   I   Y+
Sbjct: 296 IDTKELTQYEPLIKDYILNALTGPYSTINKEFRTSQSPYSISDIYTRISAEYD 348

>KAFR0B06625 Chr2 (1380125..1381207,1381209..1381694) [1569 bp, 522
           aa] {ON}
          Length = 522

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 99/231 (42%), Gaps = 13/231 (5%)

Query: 164 MLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPE 223
           ML +   A +F  WI  F  F+K++ ++ ++PD  G     P   ++ F+   F  +VP 
Sbjct: 113 MLYKLADASEFQDWIKVFSAFIKEHGMEHVLPDAQGDPTTEPTESEERFLTQVFQYFVPT 172

Query: 224 NSYPDW----MKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFA 279
            +YP W    ++ + +   D++ + L        +    E+ K LNN+ +DG     +F 
Sbjct: 173 TTYPQWFKTELRNNLTSTYDVIEIALSKYDVYMRD---YEIAKKLNNIHYDGKENPKLFK 229

Query: 280 AKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQIL 339
            ++  L +      I   +  IC  ++  L  AY  +   Y +     TL+ +L  IQ  
Sbjct: 230 KRVAKLRKIGEKIGITTTDRAICDQLITTLPTAYKPIVDDYRIHYRSTTLNDILNSIQ-- 287

Query: 340 YELENKREKTSNRIKPTPNTAVKPVATNVKNNSVAKVTNAKSAFKKSTKPT 390
            + +  R  TS+    +P    + ++T+    +V   T       K+  PT
Sbjct: 288 -QFKISRPDTSSY---SPKNTRQQISTSAPTKNVPSKTQTTGNTTKANNPT 334

>NCAS0B05650 Chr2 complement(1073091..1073969) [879 bp, 292 aa] {ON}
           
          Length = 292

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 78/154 (50%), Gaps = 19/154 (12%)

Query: 260 LIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKR 319
           ++  ++NL++DG   AF F   +R+L+     + I+IP+ +IC+ ++ GLKG Y +L  +
Sbjct: 13  ILSQIHNLSYDGKEDAFFFCNDVRNLITRPHQNSISIPDVVICEILLQGLKGPYKTLQSK 72

Query: 320 YALDGTEVTLDLLLRDIQILYELENKREKTSNRIKPTPNTAVKPVATNVKNN-------- 371
           YAL  +   +  +L+DIQ LY L      TS+ +  T + +     TNV ++        
Sbjct: 73  YALGESNKNISSILQDIQWLYHLHG----TSSVVPSTKSGSATSSKTNVAHDKGKHENKG 128

Query: 372 -----SVAKVTNAKSAFKKSTKPTS--HKANNIT 398
                +  K  +    FKK++ P     KA NI+
Sbjct: 129 PTTSSTTKKSGSTSKTFKKASPPKKRLEKAQNIS 162

>NCAS0H01960 Chr8 (381724..382551) [828 bp, 275 aa] {ON} 
          Length = 275

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 27/134 (20%)

Query: 99  PNYFD-PNYAGIHPGLQFPIPPSIPSDYYHHNXXXXXXXXXXXXXXXDSNSQTQHASVIS 157
           P  F+ P    I P +Q P PP I                       + NSQ    + I+
Sbjct: 160 PEIFNLPQQIPIEPKIQTPSPPPI---------------------IMNPNSQPSSLTSIT 198

Query: 158 KPKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTF 217
                I LT+  S  +F+ WI  F+KFL    L D+IPD++G+AKR   N +K FI   F
Sbjct: 199 -----INLTKVKSPDEFNLWIIHFIKFLNGRLLTDVIPDEFGTAKRLCTNQEKKFITYIF 253

Query: 218 NMYVPENSYPDWMK 231
             +VP + YP WMK
Sbjct: 254 KQHVPYDHYPSWMK 267

>KNAG0I01240 Chr9 complement(234446..235486) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 71/149 (47%), Gaps = 6/149 (4%)

Query: 165 LTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPEN 224
           L+  TSA  FD WI   +  L+     DL+PDK+G+ KR   + ++  I   F  YV + 
Sbjct: 183 LSFITSATGFDLWIQQLINHLRNKGYADLVPDKFGTTKRYATDGEELGITWLFTHYVKKE 242

Query: 225 SYPDW---MKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAK 281
            YP+W   MK S   + D++   +     +  +DP +   + ++ LTF  S  A  F  +
Sbjct: 243 YYPNWIPTMKGSDLSEYDIIQTAM--TKHIQKHDPGQTAWE-ISQLTFGPSEPAITFIGR 299

Query: 282 IRSLVENCRNSEINIPETLICKCIMNGLK 310
           +R LV         + +TLI   I+  LK
Sbjct: 300 VRRLVRYLPPDMTPLLDTLIKNGILVALK 328

>TDEL0D06670 Chr4 complement(1210732..1211703) [972 bp, 323 aa] {ON}
           
          Length = 323

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 102/221 (46%), Gaps = 11/221 (4%)

Query: 162 MIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYV 221
           MI     T    F++W+  F  +L++    D+IP+ +G  KR P   +   I + FN  V
Sbjct: 93  MIRPEPLTDVKGFNKWMKKFAFYLERINCKDIIPNSFGETKRQPTMAESWHIEHVFNDCV 152

Query: 222 PENSYPDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAK 281
              +YP W+K +  +   +  +I  A   +   D  + + K L + T+DG     ++  K
Sbjct: 153 SPENYPPWIKVAQDEGFSMSEIISIAFEKITYEDNFDAM-KRLMSFTYDGKYQPKVYINK 211

Query: 282 IR-SLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILY 340
           ++ ++ E   +    +P+T   + +  GL+G + S+  +  +   E  ++ + ++I   Y
Sbjct: 212 VKTAIAEWEEDGNTLVPKTK-AQLLSQGLRGDFMSIHSQLCVGKIEPNINAVEKEILSFY 270

Query: 341 ELENKREKTSNRIKPTPNTAVKPVATNVKNNSVAKVTNAKS 381
              N+R + +     T NT     +   KN+ +AK  + ++
Sbjct: 271 ---NRRLEYN-----TTNTKAVKCSICHKNDRMAKYCDNRT 303

>NCAS0A09640 Chr1 (1924869..1926374) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 61/122 (50%), Gaps = 12/122 (9%)

Query: 279 AAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQI 338
           A  +R+L+   +  EI+IP+  IC  ++NGLKG Y +L  +YALD +  ++  +L+DIQ 
Sbjct: 102 ANYVRNLLRRAKQYEISIPDNAICDILLNGLKGPYKTLQSKYALDDSNKSMSAILQDIQR 161

Query: 339 LYELENKREKTSNRIKPTPNTAVKPVATNVKNNSVAKVTNAKSAFKKSTKPTSHKANNIT 398
           LY L            PTPNT      +N    S    +  K+  K ST    +K +   
Sbjct: 162 LYHLHG----------PTPNTPSN--KSNSGQQSKRSSSTVKTDSKNSTNAFLNKDSKSK 209

Query: 399 PG 400
           PG
Sbjct: 210 PG 211

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 90/189 (47%), Gaps = 12/189 (6%)

Query: 169 TSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPD 228
           T    F+ W+  F  +L++  L D+IP+ +   KR P   +   I + FN  V    YP 
Sbjct: 100 TDVRGFNDWMKKFAFYLEKINLKDIIPNSFDETKRQPTRAESRHIEHVFNECVSPKYYPP 159

Query: 229 WMKRSASKKT---DLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKI-RS 284
           W+ ++  +     +++T     I T  NN    + IK L +  +DG     ++  K+ ++
Sbjct: 160 WILKAMDEGLSMPEIITTAFEKITTCGNN---FDAIKRLVSFRYDGKYDPRVYINKVKKA 216

Query: 285 LVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILY--EL 342
           + E   +  I +P T   + +  GL+G + S+  +  +   E  ++ + ++I  +Y  ++
Sbjct: 217 IAEWEEDGNILVPMTK-AQLLSQGLRGDFMSIHSQLCVGKIEPNINAVDKEILSIYNSKM 275

Query: 343 ENK--REKT 349
           E+K   EKT
Sbjct: 276 EHKITEEKT 284

>KLLA0E25180g Chr5 complement(2229939..2231063) [1125 bp, 374 aa]
           {ON} Retrotransposon Gag gene
          Length = 374

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/160 (18%), Positives = 69/160 (43%)

Query: 154 SVISKPKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFI 213
           S +  P     L+R   +HD+  W+ +F + L++  L + +  +    ++   + ++ +I
Sbjct: 142 SCLHDPNSTFTLSRVFYSHDYKDWVWEFSEILRKQGLGENLSARRNGYRKCLKDDEEEYI 201

Query: 214 LNTFNMYVPENSYPDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSS 273
            N     VP  SYP W K+      + +   L A+  ++  +    L++ +  L+     
Sbjct: 202 ANIHTACVPNTSYPKWFKKCLENNMEFIDCFLEAVAIISEENDKLTLLREIVALSLRDRE 261

Query: 274 AAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAY 313
           +   FA +   L +    ++++  + L+   ++  L   Y
Sbjct: 262 SIEKFAQRATKLYQRAERAKVSDLDELLTSQVLEVLHNEY 301

>TBLA0C06630 Chr3 complement(1601120..1601662) [543 bp, 180 aa] {ON}
           
          Length = 180

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 73/159 (45%), Gaps = 8/159 (5%)

Query: 163 IMLTRATSAHDFDRWITDFVKFLKQNKLDDLI--PDKYGSAKRTPNNVDKAFILNTFNMY 220
           + L R +   +FD+W   F +F K   L  +I  P+ +       +N +K ++L  FN+Y
Sbjct: 4   VCLYRISGKSEFDQWTKLFRQFPKHQGLGHIIITPETHTIQ---VSNEEKDYVLRKFNIY 60

Query: 221 VPENSYPDWMKRSASKKTDLLTLILHAI---GTVANNDPLEELIKALNNLTFDGSSAAFI 277
           VP  +YP W +   +K    L  I+          +++  EE + +L N++FD    A I
Sbjct: 61  VPAKAYPTWFQNELNKGFMSLYDIVECTLSKDIRTDHEIYEEFLDSLYNISFDTKMDATI 120

Query: 278 FAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSL 316
           F +         +  +I I +  I + I+   KG Y S+
Sbjct: 121 FRSTTLGASNKAKELDIAINDDWIARRILKSSKGQYASI 159

>Skud_7.459 Chr7 (755230..755940) [711 bp, 236 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 236

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 98/196 (50%), Gaps = 13/196 (6%)

Query: 209 DKAFILNTFNMYVPENSYPDWMKRSAS-KKTDLLTLILHAIGTV-ANNDPLEELIKALNN 266
           + A++ NTF  + P +  P W K+       D+LT++  +I  +  +N  L++ +  L  
Sbjct: 10  EHAYLYNTFQTFAPFHLLPTWAKKILEIDYADILTILSKSIQKMQTDNQDLQDWM-TLAQ 68

Query: 267 LTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTE 326
           L ++GS  A  F   I +++E  + S+I   + L C+ I+ GL G Y  L +++      
Sbjct: 69  LEYNGSIPAETFEITITTILERLKESDIKANDKLGCQLILKGLSGEYSCLRQQFRSRRNM 128

Query: 327 VTLDLLLRDIQILY-ELENKREKTSNRIKPTPN----TAVKPVATNVKNNSVAKVTNAKS 381
              DL + +IQ +Y E +  R +  N++K + +      V P  T+ K   +A  T+ KS
Sbjct: 129 KMSDLFI-EIQSIYDEQKVIRYRKFNKMKISDDYYRTNRVPPPMTDAK---IAARTSKKS 184

Query: 382 AFKKSTKPTSHKANNI 397
           A  + + P + K +N+
Sbjct: 185 APSRHS-PRTGKRHNV 199

>TBLA0E02355 Chr5 (588263..588670) [408 bp, 135 aa] {ON}
          Length = 135

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 58/122 (47%), Gaps = 3/122 (2%)

Query: 219 MYVPENSYPDWMKRSASKKTDLLTLILHAI---GTVANNDPLEELIKALNNLTFDGSSAA 275
           MYVP  +Y  W++   +K    L  I+      G   +++  E ++ AL N++FDG++ A
Sbjct: 1   MYVPAKAYSTWVQTELNKDYISLYNIVECTLSKGIQTDHEIYENILDALYNISFDGNTDA 60

Query: 276 FIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRD 335
            IF +    L    R  +I+I +  I + I+  LKG Y  +   Y        L+ LL  
Sbjct: 61  SIFRSTTLGLRNKARELDISISDDWISRRILKSLKGNYAGINADYLKISGSYDLEELLFT 120

Query: 336 IQ 337
           IQ
Sbjct: 121 IQ 122

>TBLA0G02020 Chr7 complement(527210..527941) [732 bp, 243 aa] {ON} 
          Length = 243

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 10/176 (5%)

Query: 219 MYVPENSYPDWMKRSASKKTDLLTLILHAI---GTVANNDPLEELIKALNNLTFDGSSAA 275
           MYVP  +YP W +   +K    L  I+          +++  EE + +L N++FD    A
Sbjct: 1   MYVPARAYPTWFQNELNKGFMSLYYIVECTLSKDIRTDHEIYEEFLDSLYNISFDTKMDA 60

Query: 276 FIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRD 335
            IF   I  L    +  +I I +  I + I+  LKG Y ++T  Y    +   L   L  
Sbjct: 61  TIFRFTILGLRNKAKELDIAISDDWIARRILKSLKGEYFNITSNYLKGSSSYDLKNFLFA 120

Query: 336 IQILYELENKREKTSNRIKPTPNTAVKPVATNVKNNSVAKVTNAKSAFKKSTKPTS 391
           IQI       +     R+  T    V       ++++   VT      + ++KPT+
Sbjct: 121 IQI-------KSPEIARVTSTLKAKVNLNCQTCQSSTHTAVTCPNRVLEHASKPTT 169

>NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON} 
          Length = 1303

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 77/178 (43%), Gaps = 11/178 (6%)

Query: 232 RSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLVENCRN 291
           + A     L T++  A+        +  +++ L +L F+G   AFIF A ++S++     
Sbjct: 9   QQARGSVPLFTILQRAMTLAMQATDITIIMRKLRDLHFEGKEPAFIFNANVQSIISQIDT 68

Query: 292 SEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQILYEL----ENKRE 347
            E+   E LI  CI+N L G Y ++ K +    +  ++  +   I   Y+     ++ R 
Sbjct: 69  KELTQYEPLIKDCILNALTGPYSTINKEFRTSQSPYSISDIYTRISAEYDYITTTQSARP 128

Query: 348 KTS--NRIKPTPNTAVKPVATNVKN-----NSVAKVTNAKSAFKKSTKPTSHKANNIT 398
           K S  + +  T +   K VA +  N      S  +   +    +K +  +S   NNIT
Sbjct: 129 KCSYCHIVGHTRDQCFKAVAPSTANPIPKAKSNTRTPRSSPTHRKQSAKSSKITNNIT 186

>Kwal_23.3709 s23 (399199..400269) [1071 bp, 356 aa] {ON} [contig
           254] FULL
          Length = 356

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/244 (20%), Positives = 91/244 (37%), Gaps = 22/244 (9%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 103 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 162

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 163 PSWVNRPSGGLSGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 221

Query: 287 ENCRNSEI-NIPETLICK---------------CIMNGLKGAYHSLTK--RYALDGTEVT 328
            +     I    E  + +               C+ NG+ G    +     +     +VT
Sbjct: 222 ADSLEHGIFKKKEEAVFRIYQSINSGLPFNPDVCVTNGVDGILSCILNYGEFCKAAGQVT 281

Query: 329 LDLLLRDIQILYELENKREKTSNRIKPTPNTAVKPVATNVKNNSVAKVTNAKSAFKKSTK 388
                ++I  L  L+N R  T N +    N   K + +  K + +    N +       K
Sbjct: 282 ---WRKNINELQNLQNTRCYTCNEVGHLSNNCKKNITSKNKGSKLGYQRNHQRTPFDKNK 338

Query: 389 PTSH 392
           P  H
Sbjct: 339 PRKH 342

>Kwal_47.19340 s47 (1198185..1199255) [1071 bp, 356 aa] {OFF}
           [contig 344] FULL
          Length = 356

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/244 (20%), Positives = 91/244 (37%), Gaps = 22/244 (9%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 103 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 162

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 163 PSWVNRPSGGLSGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 221

Query: 287 ENCRNSEI-NIPETLICK---------------CIMNGLKGAYHSLTK--RYALDGTEVT 328
            +     I    E  + +               C+ NG+ G    +     +     +VT
Sbjct: 222 ADSLEHGIFKKKEEAVFRIYQSINSGLPFNPDVCVTNGVDGILSCILNYGEFCKAAGQVT 281

Query: 329 LDLLLRDIQILYELENKREKTSNRIKPTPNTAVKPVATNVKNNSVAKVTNAKSAFKKSTK 388
                ++I  L  L+N R  T N +    N   K + +  K + +    N +       K
Sbjct: 282 ---WRKNINELQNLQNTRCYTCNEVGHLSNNCKKNITSKNKGSKLGYQRNHQRTPFDKNK 338

Query: 389 PTSH 392
           P  H
Sbjct: 339 PRKH 342

>NDAI0B02880 Chr2 (733429..733902) [474 bp, 157 aa] {ON} 
          Length = 157

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 10/117 (8%)

Query: 260 LIKALNNLTFDG----SSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHS 315
           ++  ++NL++DG    SS+A  F   +  L +   +S     ETL     + GLKG Y +
Sbjct: 13  ILSQIHNLSYDGKKMHSSSAITFVISLEELSKFHSHSRCCYCETL-----LQGLKGPYKT 67

Query: 316 LTKRYALDGTEVTLDLLLRDIQILYELE-NKREKTSNRIKPTPNTAVKPVATNVKNN 371
           +  +  LD     +  +L DIQ LY L  N     SN+  PT +  +  +    KN+
Sbjct: 68  MQLKDTLDERSKIVSSILEDIQRLYHLYGNSTLNASNKTVPTQHLRLHSINNLFKND 124

>Kwal_55.22270 s55 (1176867..1177649) [783 bp, 260 aa] {ON} [contig
           327] FULL
          Length = 260

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/226 (19%), Positives = 86/226 (38%), Gaps = 22/226 (9%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 29  QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 88

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 89  PSWVNRPSGGLSGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 147

Query: 287 ENCRNSEI-NIPETLICK---------------CIMNGLKGAYHSLTK--RYALDGTEVT 328
            +     I    E  + +               C+ NG+ G    +     +     +VT
Sbjct: 148 ADSLEHGIFKKKEEAVFRIYQSINSGLPFNPDVCVTNGVDGILSCILNYGEFCKAAGQVT 207

Query: 329 LDLLLRDIQILYELENKREKTSNRIKPTPNTAVKPVATNVKNNSVA 374
                ++I  L  L+N R  T N +    N   K + +  K + + 
Sbjct: 208 WR---KNINELQNLQNTRCYTCNEVGHLSNNCKKNITSKNKGSKLG 250

>TPHA0I03310 Chr9 (733120..733494) [375 bp, 124 aa] {ON} 
          Length = 124

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 260 LIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKR 319
           ++  L NL + GS  AFIF + IR L+   R  E    E +I   I+N L G Y S+   
Sbjct: 13  IMNKLKNLNYIGSEPAFIFISMIRELINPIRPEEYFHLEPIIINYILNSLNGDYASIRDH 72

Query: 320 YALDGTEVTLDLLLRDIQILYE 341
           ++    + T++ +   I+  YE
Sbjct: 73  FS-QPPQYTIEDIFASIRSKYE 93

>TBLA0B08200 Chr2 (1957742..1959115) [1374 bp, 457 aa] {ON}
           possible pseudogene; NNN added to avoid internal stop
           codon
          Length = 457

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 219 MYVPENSYPDWMKRSASKKTDLLTLILHAI---GTVANNDPLEELIKALNNLTFDGSSAA 275
           MYVP  +YP W +   +K    L  I+          +++  E ++ +L N++FD    A
Sbjct: 1   MYVPAKAYPTWFQNELNKGFMSLYNIIECTLSKDIRKDHEIYEGVLDSLYNISFDTKMDA 60

Query: 276 FIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRD 335
            IF +    L    +  +I I +  I + I+  LKG Y S+            L+ LL  
Sbjct: 61  AIFRSTTLGLRNKAKELDIAISDDWIARKILKSLKGQYASINSENLKRSGSYDLEKLLFT 120

Query: 336 IQ 337
           IQ
Sbjct: 121 IQ 122

>Kwal_13.697 s13 complement(5594..6265) [672 bp, 223 aa] {ON}
           [contig 696] FULL
          Length = 223

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 29  QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 88

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A   V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 89  PSWVNRPSGGLSGYKTF-REAAMLVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 147

>Kwal_55.19804 s55 complement(133761..134402) [642 bp, 213 aa] {ON}
           [contig 159] FULL
          Length = 213

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 29  QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 88

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A   V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 89  PSWVNRPSGGLSGYKTF-REAAMLVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 147

>Kwal_1.402 s1 (628..1653) [1026 bp, 341 aa] {ON} [contig 695] FULL
          Length = 341

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 104 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 163

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 164 PSWVNRPSGGISGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 222

>Kwal_34.16301 s34 (279917..280987) [1071 bp, 356 aa] {OFF} [contig
           710] FULL
          Length = 356

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 103 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 162

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 163 PSWVNRPSGGLSGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 221

>Kwal_50.19423 s50 complement(3011..3817) [807 bp, 268 aa] {ON}
           [contig 328] FULL
          Length = 268

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 83  QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 142

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A   V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 143 PSWVNRPSGGISGYKTF-REAAMLVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 201

>Kwal_2.417 s2 (536..1396) [861 bp, 286 aa] {ON} [contig 305] FULL
          Length = 286

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 103 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 162

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 163 PSWVNRPSGGISGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 221

>Kwal_27.12435 s27 (1218177..1219250) [1074 bp, 357 aa] {OFF}
           [contig 457] FULL
          Length = 357

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 104 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 163

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A   V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 164 PSWVNRPSGGLSGYKTF-REAAMLVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 222

>Kwal_47.17038 s47 complement(219724..220587) [864 bp, 287 aa] {ON}
           [contig 215] FULL
          Length = 287

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 103 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 162

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A   V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 163 PSWVNRPSGGISGYKTF-REAAMLVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 221

>Kwal_14.761 s14 (31709..32644) [936 bp, 311 aa] {ON} [contig 245]
           FULL
          Length = 311

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/226 (19%), Positives = 86/226 (38%), Gaps = 22/226 (9%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 80  QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKKAIARIMDTYLDYEAY 139

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D ++  F++   ++ L+
Sbjct: 140 PSWVNRPSGGLSGYKTFREAAM-LVSTDASRNSINRRWDELILDKNTNPFVYVEDVKDLI 198

Query: 287 ENCRNSEI-NIPETLICK---------------CIMNGLKGAYHSLTK--RYALDGTEVT 328
            +     I    E  + +               C+ NG+ G    +     +     +VT
Sbjct: 199 ADSLEHGIFKKKEEAVFRIYQSINSGLPFNPDVCVTNGVDGILSCILNYGEFCKAAGQVT 258

Query: 329 LDLLLRDIQILYELENKREKTSNRIKPTPNTAVKPVATNVKNNSVA 374
                ++I  L  L+N R  T N +    N   K + +  K + + 
Sbjct: 259 ---WRKNINELQNLQNTRCYTCNEVGHLSNNCKKNITSKNKGSKLG 301

>Kwal_26.7896 s26 complement(559123..559899) [777 bp, 258 aa] {ON}
           [contig 55] FULL
          Length = 258

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 97  QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKKAIARIMDTYLDYEAY 156

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A   V+ +     + +  + L  D ++  F++   ++ L+
Sbjct: 157 PSWVNRPSGGLSGYKTF-REAAMLVSTDASRNSINRRWDELILDKNTNPFVYVEDVKDLI 215

>Kwal_34.15663 s34 complement(2019..2324) [306 bp, 101 aa] {OFF}
           [contig 312] FULL
          Length = 101

 Score = 38.1 bits (87), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 31/68 (45%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    + Y+   +Y
Sbjct: 7   QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTYLDYEAY 66

Query: 227 PDWMKRSA 234
           P W+ R +
Sbjct: 67  PSWVNRPS 74

>KNAG0A01870 Chr1 (132203..134533) [2331 bp, 776 aa] {ON} 
          Length = 776

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%)

Query: 264 LNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALD 323
           ++ LTF  S  A  F  ++R LV N       + +TLI   I+  LKG Y      +   
Sbjct: 32  ISQLTFGPSEPAITFIGRVRRLVRNLPPDMTPLLDTLIKNSILAALKGPYEPTKNHFRNL 91

Query: 324 GTEVTLDLLLRDIQILYELENKREK 348
               T+D +L  IQ  Y++ +  ++
Sbjct: 92  TAPYTIDDMLHRIQTTYDISHTDQQ 116

>KNAG0G02855 Chr7 complement(632776..633357) [582 bp, 193 aa] {ON}
          Length = 193

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 39/97 (40%)

Query: 159 PKDMIMLTRATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFN 218
           P+    L   T   ++  W    V  L++   + LIP+  GS K      +   + + F 
Sbjct: 80  PRQAHDLYEITDPAEYTGWFEALVSHLRETGYEHLIPNSDGSFKHNLAMEESIGLRSLFW 139

Query: 219 MYVPENSYPDWMKRSASKKTDLLTLILHAIGTVANND 255
            +V   +YPDW+ R          LI  +I  VA  D
Sbjct: 140 YFVRRRAYPDWVMRCERNGYRSHELICRSIVRVAYKD 176

>TPHA0E04090 Chr5 (853540..854007) [468 bp, 155 aa] {ON} 
          Length = 155

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 4/108 (3%)

Query: 260 LIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKR 319
           ++  L N+ + GS  AFIF + IR L+   R  E    E +I   I+N L G Y S+   
Sbjct: 13  IMNKLKNINYIGSEPAFIFISMIRELINPIRPEEYFHLELIIINYILNSLNGDYASIRDH 72

Query: 320 YALDGTEVTLDLLLRDIQILYE---LENKREKTSNRIKPTPNTAVKPV 364
           ++    + T++ +   I+  YE   +      TS     T +T  +P+
Sbjct: 73  FS-QPPQYTIEDIFASIRSKYEYMKMNKSINTTSTSQTDTCHTCSRPL 119

>TBLA0B07225 Chr2 (1711953..1712453) [501 bp, 166 aa] {ON}
          Length = 166

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 173 DFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMK 231
           +F++WI  F   L+   L+  +  K  +   TP+   K +I+N F  YV   +YP W +
Sbjct: 92  EFEQWIRSFASHLRSQDLE-FVFSKSKTDNLTPDIDCKKYIVNIFQTYVHVKAYPTWFQ 149

>Kwal_9.613 s9 (50..1120) [1071 bp, 356 aa] {OFF} [contig 351] FULL
          Length = 356

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    +  +   +Y
Sbjct: 103 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTDLDYEAY 162

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 163 PSWVNRPSGGISGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 221

>Kwal_47.17671 s47 complement(508381..509385) [1005 bp, 334 aa] {ON}
           [contig 206] FULL
          Length = 334

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    +  +   +Y
Sbjct: 103 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTDLDYEAY 162

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 163 PSWVNRPSGGISGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 221

>Kwal_36.16333 s36 (2113..3009) [897 bp, 298 aa] {ON} [contig 364]
           FULL
          Length = 298

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 51/120 (42%), Gaps = 1/120 (0%)

Query: 167 RATSAHDFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSY 226
           + T    F  +IT  +  L++     +IPD  GS  R P   +K  I    +  +   +Y
Sbjct: 103 QVTKVAGFLPFITKILNLLQRVNRQGIIPDNDGSCAREPTLSEKRAIARIMDTDLDYEAY 162

Query: 227 PDWMKRSASKKTDLLTLILHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFAAKIRSLV 286
           P W+ R +   +   T    A+  V+ +     + +  + L  D S+  F++   ++ L+
Sbjct: 163 PSWVNRPSGGISGYKTFREAAM-LVSTDASRNSINRRWDELILDKSTNPFVYVEDVKDLI 221

>TPHA0G00150 Chr7 (7467..8054) [588 bp, 195 aa] {ON} 
          Length = 195

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%)

Query: 260 LIKALNNLTFDGSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKR 319
           ++  L N+ + GS  AFIF + IR L+   R  E    E +I   I+N L G Y S+   
Sbjct: 53  IMNKLKNINYIGSEPAFIFISMIRELINLIRPEEYFHLELIIINYILNSLNGDYASIRDH 112

Query: 320 YA 321
           ++
Sbjct: 113 FS 114

>TBLA0B06370 Chr2 (1505360..1506163) [804 bp, 267 aa] {ON} 
          Length = 267

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 173 DFDRWITDFVKFLKQNKLDDLIPDKYGSAKRTPNNVDKAFILNTFNMYVPENSYPDWMK 231
           +F++WI  F   L+   L+  +  K  +   TP+   K +I+N    YV   +YP W +
Sbjct: 193 EFEQWIRSFASHLRSQDLE-FVFSKSKTDNLTPDIDCKKYIVNISQTYVHVKAYPTWFQ 250

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%)

Query: 271 GSSAAFIFAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLD 330
           G+    +F   + SL+    +  I+IP  ++C+ I   L G Y  ++  Y ++   V+L+
Sbjct: 3   GNLTPILFRKLLNSLISKGNSLGIHIPNEVLCQRIAGNLTGPYKPISDFYRMNYGMVSLE 62

Query: 331 LLLRDIQILY 340
            +L  IQ  Y
Sbjct: 63  DILDQIQRTY 72

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
           similarities with uniprot|P40450 Saccharomyces
           cerevisiae YIL159W BNR1 Formin nucleates the formation
           of linear actin filaments involved in cell processes
           such as budding and mitotic spindle orientation which
           require the formation of polarized actin cables
           functionally redundant with BNI1
          Length = 1283

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 22/116 (18%)

Query: 257 LEELIKALNNLTFDGSSAAF-IFAAKIRSLVENCRNS---EINIPETLICKC--IMNGLK 310
           +E +++ +N  T +GS   F +F + +  L E+  +    E N  +  +     IM+ L+
Sbjct: 414 IETILELVNERTTEGSIKLFYVFNSILTYLCEHTLDGSFDETNTEQVFMTSLDHIMDNLQ 473

Query: 311 GAYHSLTKRYAL---------DGTEVTLDLLLRDIQI-----LYELENKREKTSNR 352
              H + KR  +         DG ++ LD LL+D Q+     L +LENK E   +R
Sbjct: 474 S--HQIAKRAMMELDEKKKEFDGIQLQLDTLLQDKQVSKGDLLQKLENKEELLKSR 527

>NDAI0A04020 Chr1 complement(901967..904708) [2742 bp, 913 aa] {ON}
           Anc_1.509
          Length = 913

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 7/92 (7%)

Query: 190 LDDLIPDKYGSAKRTPNNVDKAFILNTF--NMYVPENSYPDWMKRSASKKTDLLTLILHA 247
           +D LIP K+ ++ RT   + + F   TF  N+Y+PE  Y  W K    KK   +  I  +
Sbjct: 680 VDALIPHKFITSLRTEYKLPEKFGFTTFQGNVYLPELRY--WFKFPILKKAANINKIFDS 737

Query: 248 IGTVA---NNDPLEELIKALNNLTFDGSSAAF 276
           + ++    N+  L +++   +NL   GS   F
Sbjct: 738 LNSLTSSLNDIKLSDILIVYHNLLRIGSRDLF 769

>TBLA0D02500 Chr4 complement(623059..625617) [2559 bp, 852 aa] {ON}
           Anc_8.39 YLR057W
          Length = 852

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 273 SAAFIFAAKIRSLVENCRNSEINIPETLICKCI-MNGLKGAYHSLTKRY--ALDGTEVTL 329
           ++ F F +K+ ++ E      I I E L   CI  N L          Y   LDG+    
Sbjct: 598 ASTFAFGSKVFNISE-----YIKIAENLTISCIKYNSLFSGILPKHSYYDPCLDGSSCMF 652

Query: 330 DLL--LRDIQILYELENKREKTSNRIKPTPNTAVKPVATNVK-NNSVAKVTNAKSAFKKS 386
           D +  + +I+  Y L N+ + + + IK + N    P+      NN + KV N KS  KKS
Sbjct: 653 DSVSKINNIKQGYYLRNEMDSSDSVIKVSQNLNKHPILEKENDNNMITKVLNFKSHSKKS 712

>CAGL0J08030g Chr10 complement(785064..791717) [6654 bp, 2217 aa] {ON}
            highly similar to uniprot|P21951 Saccharomyces cerevisiae
            YNL262w POL2 DNA-directed DNA polymerase epsilon
            catalytic subunit A
          Length = 2217

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 3/98 (3%)

Query: 221  VPENSYPDWMKRSASKKTDLLTLI-LHAIGTVANNDPLEELIKALNNLTFDGSSAAFIFA 279
            VP   +PDW+KR  + K D      L    + ++ +P    IK +  L  +      I  
Sbjct: 1171 VPRVEHPDWLKRRIAVKEDKFKQSKLERFLSKSSQEPQNRRIKDIEELFHEDDDIKRIKL 1230

Query: 280  AKIRSLVENCRNSEI--NIPETLICKCIMNGLKGAYHS 315
            AK+ S  +N RN ++  N  E+L+    M  ++  Y S
Sbjct: 1231 AKVTSRNKNKRNRDVQKNDEESLVLPATMPSMEEDYVS 1268

>TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5.370
            YHR080C
          Length = 1708

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 69/141 (48%), Gaps = 18/141 (12%)

Query: 278  FAAKIRSLVENCRNSEINIPETLICKCIMNGLKGAYHSLTKRYALDGTEVTLDLLLRDIQ 337
            F+  +++L+    N+  N+   +    I  G +    S  +R ++DG + +  +LL++++
Sbjct: 1417 FSIHVKTLLTWGPNNTTNLD--MYTSVIWTG-RSFLKSAIERGSIDGQKESAKILLKELK 1473

Query: 338  ILYEL----------ENKREKTSNR-IKPTPNTAVKPVATNVKNNSVAKVTNAKSAFKKS 386
             +             + K+ K+S+R ++PTP   V PV+ ++ +    + +N +S    S
Sbjct: 1474 SIIATAKVTKPVAASQRKKNKSSSRSVEPTPQPQVLPVSEDISSQMGLESSNVES----S 1529

Query: 387  TKPTSHKANNITPGLVELDAD 407
              PTS  ++ +TP +  L  D
Sbjct: 1530 QAPTSSNSSFLTPIIDNLFGD 1550

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,682,106
Number of extensions: 1962548
Number of successful extensions: 6849
Number of sequences better than 10.0: 88
Number of HSP's gapped: 7061
Number of HSP's successfully gapped: 88
Length of query: 414
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 302
Effective length of database: 40,638,807
Effective search space: 12272919714
Effective search space used: 12272919714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)